FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41059

FusionGeneSummary for USP32_PGS1

check button Fusion gene summary
Fusion gene informationFusion gene name: USP32_PGS1
Fusion gene ID: 41059
HgeneTgene
Gene symbol

USP32

PGS1

Gene ID

84669

9489

Gene nameubiquitin specific peptidase 32phosphatidylglycerophosphate synthase 1
SynonymsNY-REN-60|USP10-
Cytomap

17q23.1-q23.2

17q25.3

Type of geneprotein-codingprotein-coding
Descriptionubiquitin carboxyl-terminal hydrolase 32deubiquitinating enzyme 32renal carcinoma antigen NY-REN-60ubiquitin specific protease 32ubiquitin thioesterase 32ubiquitin thiolesterase 32ubiquitin-specific-processing protease 32CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrialPGP synthase 1
Modification date2018052320180519
UniProtAcc

Q8NFA0

Q32NB8

Ensembl transtripts involved in fusion geneENST00000300896, ENST00000592339, 
ENST00000393003, ENST00000586881, 
ENST00000262764, ENST00000329897, 
ENST00000588281, 
Fusion gene scores* DoF score28 X 15 X 9=37804 X 3 X 3=36
# samples 274
** MAII scorelog2(27/3780*10)=-3.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: USP32 [Title/Abstract] AND PGS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A0DG-01AUSP32chr17

58329742

-PGS1chr17

76415627

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000300896ENST00000262764USP32chr17

58329742

-PGS1chr17

76415627

+
Frame-shitENST00000300896ENST00000329897USP32chr17

58329742

-PGS1chr17

76415627

+
5CDS-3UTRENST00000300896ENST00000588281USP32chr17

58329742

-PGS1chr17

76415627

+
Frame-shitENST00000592339ENST00000262764USP32chr17

58329742

-PGS1chr17

76415627

+
Frame-shitENST00000592339ENST00000329897USP32chr17

58329742

-PGS1chr17

76415627

+
5CDS-3UTRENST00000592339ENST00000588281USP32chr17

58329742

-PGS1chr17

76415627

+
In-frameENST00000393003ENST00000262764USP32chr17

58329742

-PGS1chr17

76415627

+
Frame-shitENST00000393003ENST00000329897USP32chr17

58329742

-PGS1chr17

76415627

+
5CDS-3UTRENST00000393003ENST00000588281USP32chr17

58329742

-PGS1chr17

76415627

+
intron-3CDSENST00000586881ENST00000262764USP32chr17

58329742

-PGS1chr17

76415627

+
intron-3CDSENST00000586881ENST00000329897USP32chr17

58329742

-PGS1chr17

76415627

+
intron-3UTRENST00000586881ENST00000588281USP32chr17

58329742

-PGS1chr17

76415627

+

Top

FusionProtFeatures for USP32_PGS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
USP32

Q8NFA0

PGS1

Q32NB8

Functions in the biosynthesis of the anionicphospholipids phosphatidylglycerol and cardiolipin. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134241_2523781605Calcium binding1
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134277_2883781605Calcium binding2
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134228_2633781605DomainEF-hand 2
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134264_2993781605DomainEF-hand 3
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-113491_1263781605DomainEF-hand 1

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134369_5853781605DomainDUSP
HgeneUSP32chr17:58329742chr17:76415627ENST00000300896-1134734_15673781605DomainNote=USP
TgenePGS1chr17:58329742chr17:76415627ENST00000262764+710215_241517665DomainPLD phosphodiesterase 1
TgenePGS1chr17:58329742chr17:76415627ENST00000262764+710460_493517665DomainPLD phosphodiesterase 2
TgenePGS1chr17:58329742chr17:76415627ENST00000262764+710124_131517665Nucleotide bindingATP


Top

FusionGeneSequence for USP32_PGS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_USP32_ENST00000300896_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_418aa
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRG
KDEEKAKYIFSLFSSESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQK
FCFKVFDVDRDGVLSRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVC

>In-frame_USP32_ENST00000393003_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_418aa
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNNLIVGLVLLTRG
KDEEKAKYIFSLFSSESGNYVIREEMERMLHVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQK
FCFKVFDVDRDGVLSRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVEGILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_USP32_ENST00000300896_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_1256nt
ATGGGTGCCAAGGAGTCACGGATCGGATTCCTCAGCTACGAGGAGGCGCTGAGGAGAGTTACAGATGTAGAGCTAAAACGACTGAAGGAT
GCTTTCAAGAGGACCTGTGGACTCTCATATTACATGGGCCAGCACTGCTTCATCCGGGAAGTGCTTGGGGATGGAGTGCCTCCAAAGGTT
GCTGAGGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGC
AAAGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTC
CACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTT
TTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACT
TTCTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCC
CGGACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTT
GATGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAA
TTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGG
AAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAG
ATGGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGT
CACATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGGAGCAAGAGCAGCTCTACCTGAGGTCAGGTGTGG

>In-frame_USP32_ENST00000393003_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_1256nt
ATGGGTGCCAAGGAGTCACGGATCGGATTCCTCAGCTACGAGGAGGCGCTGAGGAGAGTTACAGATGTAGAGCTAAAACGACTGAAGGAT
GCTTTCAAGAGGACCTGTGGACTCTCATATTACATGGGCCAGCACTGCTTCATCCGGGAAGTGCTTGGGGATGGAGTGCCTCCAAAGGTT
GCTGAGGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGC
AAAGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAAATGGAAAGAATGCTC
CACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTT
TTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGATAGTGATACTCCTACT
TTCTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCC
CGGACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTT
GATGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAA
TTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGG
AAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCACATGACACCACAAAG
ATGGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGT
CACATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGGAGCAAGAGCAGCTCTACCTGAGGTCAGGTGTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_USP32_ENST00000300896_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_1955nt
ACGTGATCCGGCATGGAGGCGGTGGCGGCGACCGGGAGGAGCCGCCGGGGCAGAAGCCGCACTTGTTAGTGTGGGGGGAGGTGGGGGCGG
GGGACGCCGACACCGTCACCGTCACCCAGGGACGCCGAGGAGAAGGCGGGAGGGGGGTGGGGGCGAGATCAGGCTCCGACCCCCCGCCGA
GGGGATGAGGGGAGCATGGGTGCCAAGGAGTCACGGATCGGATTCCTCAGCTACGAGGAGGCGCTGAGGAGAGTTACAGATGTAGAGCTA
AAACGACTGAAGGATGCTTTCAAGAGGACCTGTGGACTCTCATATTACATGGGCCAGCACTGCTTCATCCGGGAAGTGCTTGGGGATGGA
GTGCCTCCAAAGGTTGCTGAGGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAATAATTTAATAGTTGGACTTGTC
CTCCTTACAAGAGGCAAAGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGGAACTATGTTATACGGGAAGAA
ATGGAAAGAATGCTCCACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGTGAAAAGGTAAACTATGAAAAG
TTTAGAAATTGGCTTTTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTGTATGTTACCCTCACTGATGAT
AGTGATACTCCTACTTTCTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGATCTTGAGAAACGCTATTGGTTA
TTGAAGGCTCAATCCCGGACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATTCGTCCATCTCTAAGTGAAGGT
TTGTTTAATGCTTTTGATGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCAGCCTGTTGCAGGGGACCCCTG
GCTGAAAGACAAAAATTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAACTGAGAGACATGGTGGTTGCA
CTTTTAGAAGTCTGGAAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATTGTAGAAGGCATACTGAATGCA
CATGACACCACAAAGATGGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTTGCCAATGAGTTTTTGAACCTC
CTTTTCCAGGTGTGTCACATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATTAGGAGCAAGAGCAGCTCTACC
TGAGGTCAGGTGTGGTGTCCTCTGCCACCTTCGAGCAGCCGAGTCGCCAGGTGAAGCTGTGGGTGAAGATGGTGACTCCACTGATCAAGA
ACTTCTTCTGAGGACAGACAGGAATGGCCTTGATGAAGATGACAGGCATGGCCGGGGTCAGCTCTTTCAGCCGCGCTTCAGCGATGACTC
CAGTCTGGGTGTCCCAGCGAGCCCCTGCAGGGACAGTATGGCTGAGGGTCAGGTGTGCTGCCAGTAAGTGAGGGAGGGGCTGGCAGGAAG
GGTGGGGTCCTCACACTCCCCGCCCTCTGCAGAGCTGGGCTCTACCCCAAAAGGCTTCAGGCCAGCTGCCACGGCTGGAAGCAGAGGCCT
TCGTAGGTGATGGCCTGCATGTTGTAACTACCCCGTCCCGCTGGGCTCAAGGAACAGCTCAGCTAAAGCCCTCGGGTTCCATCCGTTTAA
ATCTGTGGCATTTTCAGAGCCTCATCTGTCAGCCTTAATGTCAGTGGCAGGAAGTCATAACTCCAGCTAAAAATTACAGAGTAAAGTTCC

>In-frame_USP32_ENST00000393003_chr17_58329742_-_PGS1_ENST00000262764_chr17_76415627_+_1796nt
CAGGCTCCGACCCCCCGCCGAGGGGATGAGGGGAGCATGGGTGCCAAGGAGTCACGGATCGGATTCCTCAGCTACGAGGAGGCGCTGAGG
AGAGTTACAGATGTAGAGCTAAAACGACTGAAGGATGCTTTCAAGAGGACCTGTGGACTCTCATATTACATGGGCCAGCACTGCTTCATC
CGGGAAGTGCTTGGGGATGGAGTGCCTCCAAAGGTTGCTGAGGTGATTTACTGTTCTTTTGGTGGAACATCCAAAGGGCTGCACTTCAAT
AATTTAATAGTTGGACTTGTCCTCCTTACAAGAGGCAAAGATGAAGAGAAAGCAAAATACATTTTTAGTCTTTTTTCAAGTGAATCTGGG
AACTATGTTATACGGGAAGAAATGGAAAGAATGCTCCACGTGGTGGATGGTAAAGTCCCAGATACACTCAGGAAGTGTTTCTCAGAGGGT
GAAAAGGTAAACTATGAAAAGTTTAGAAATTGGCTTTTTCTAAACAAAGATGCTTTTACTTTCTCTCGATGGCTTCTATCTGGAGGTGTG
TATGTTACCCTCACTGATGATAGTGATACTCCTACTTTCTACCAAACTCTGGCTGGAGTCACACATTTGGAGGAATCAGACATCATTGAT
CTTGAGAAACGCTATTGGTTATTGAAGGCTCAATCCCGGACTGGACGATTTGATTTAGAGACATTTGGCCCATTGGTTTCACCACCTATT
CGTCCATCTCTAAGTGAAGGTTTGTTTAATGCTTTTGATGAAAATCGTGACAATCACATAGATTTTAAGGAGATATCCTGTGGGTTATCA
GCCTGTTGCAGGGGACCCCTGGCTGAAAGACAAAAATTTTGCTTCAAGGTATTTGATGTTGACCGTGATGGAGTTCTCTCCAGGGTTGAA
CTGAGAGACATGGTGGTTGCACTTTTAGAAGTCTGGAAGGACAACCGCACTGATGATATTCCTGAATTACATATGGATCTCTCTGATATT
GTAGAAGGCATACTGAATGCACATGACACCACAAAGATGGGTCATCTTACTCTGGAAGACTATCAGATCTGGAGTGTGAAAAATGTTCTT
GCCAATGAGTTTTTGAACCTCCTTTTCCAGGTGTGTCACATAGTTCTGGGGTTAAGACCAGCTACTCCGGAAGAAGAAGGACAAATTATT
AGGAGCAAGAGCAGCTCTACCTGAGGTCAGGTGTGGTGTCCTCTGCCACCTTCGAGCAGCCGAGTCGCCAGGTGAAGCTGTGGGTGAAGA
TGGTGACTCCACTGATCAAGAACTTCTTCTGAGGACAGACAGGAATGGCCTTGATGAAGATGACAGGCATGGCCGGGGTCAGCTCTTTCA
GCCGCGCTTCAGCGATGACTCCAGTCTGGGTGTCCCAGCGAGCCCCTGCAGGGACAGTATGGCTGAGGGTCAGGTGTGCTGCCAGTAAGT
GAGGGAGGGGCTGGCAGGAAGGGTGGGGTCCTCACACTCCCCGCCCTCTGCAGAGCTGGGCTCTACCCCAAAAGGCTTCAGGCCAGCTGC
CACGGCTGGAAGCAGAGGCCTTCGTAGGTGATGGCCTGCATGTTGTAACTACCCCGTCCCGCTGGGCTCAAGGAACAGCTCAGCTAAAGC
CCTCGGGTTCCATCCGTTTAAATCTGTGGCATTTTCAGAGCCTCATCTGTCAGCCTTAATGTCAGTGGCAGGAAGTCATAACTCCAGCTA


Top

FusionGenePPI for USP32_PGS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
USP32CDK1, FARSA, KRT8, KRT18, KRT19, ABCD3, YWHAB, TUBA1A, SMC1A, USP6, TRIP13, ERP44, UBXN1, MRPL39, VPS35, LRRC47, USP32P2, USP4, CUL3, CAND1, RBCK1, TRIM46, RNF144A, TRIM74, ZDHHC17, RAP1B, SORT1, SYNCRIP, BAG6, FDFT1, RAB6B, TPCN2, MANSC1, ENTPD7, ALDH3B1, CD83, NME4, HSPA12A, UBC, MTNR1A, TRIM25PGS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for USP32_PGS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for USP32_PGS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource