FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4095

FusionGeneSummary for BCR_RALGPS1

check button Fusion gene summary
Fusion gene informationFusion gene name: BCR_RALGPS1
Fusion gene ID: 4095
HgeneTgene
Gene symbol

BCR

RALGPS1

Gene ID

613

9649

Gene nameBCR, RhoGEF and GTPase activating proteinRal GEF with PH domain and SH3 binding motif 1
SynonymsALL|BCR1|CML|D22S11|D22S662|PHLRALGEF2|RALGPS1A
Cytomap

22q11.23

9q33.3

Type of geneprotein-codingprotein-coding
Descriptionbreakpoint cluster region proteinBCR/FGFR1 chimera proteinFGFR1/BCR chimera proteinbreakpoint cluster regionrenal carcinoma antigen NY-REN-26ras-specific guanine nucleotide-releasing factor RalGPS1Ral guanine nucleotide exchange factor RalGPS1ARalGEF 2ral GEF with PH domain and SH3-binding motif 1ral guanine nucleotide exchange factor 2ralA exchange factor RalGPS1
Modification date2018052720180519
UniProtAcc

P11274

Q5JS13

Ensembl transtripts involved in fusion geneENST00000305877, ENST00000359540, 
ENST00000398512, ENST00000436990, 
ENST00000424082, ENST00000259351, 
ENST00000394022, ENST00000373436, 
ENST00000373434, ENST00000394011, 
ENST00000480993, 
Fusion gene scores* DoF score17 X 39 X 8=53047 X 6 X 5=210
# samples 707
** MAII scorelog2(70/5304*10)=-2.92165394828026
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCR [Title/Abstract] AND RALGPS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRALGPS1

GO:0032485

regulation of Ral protein signal transduction

10747847


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1HQ622706BCRchr22

23615961

+RALGPS1chr9

129831507

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000305877ENST00000424082BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000305877ENST00000259351BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000305877ENST00000394022BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000305877ENST00000373436BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000305877ENST00000373434BCRchr22

23615961

+RALGPS1chr9

129831507

+
5CDS-intronENST00000305877ENST00000394011BCRchr22

23615961

+RALGPS1chr9

129831507

+
5CDS-intronENST00000305877ENST00000480993BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000359540ENST00000424082BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000359540ENST00000259351BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000359540ENST00000394022BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000359540ENST00000373436BCRchr22

23615961

+RALGPS1chr9

129831507

+
In-frameENST00000359540ENST00000373434BCRchr22

23615961

+RALGPS1chr9

129831507

+
5CDS-intronENST00000359540ENST00000394011BCRchr22

23615961

+RALGPS1chr9

129831507

+
5CDS-intronENST00000359540ENST00000480993BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000398512ENST00000424082BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000398512ENST00000259351BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000398512ENST00000394022BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000398512ENST00000373436BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000398512ENST00000373434BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-intronENST00000398512ENST00000394011BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-intronENST00000398512ENST00000480993BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000436990ENST00000424082BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000436990ENST00000259351BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000436990ENST00000394022BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000436990ENST00000373436BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-3CDSENST00000436990ENST00000373434BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-intronENST00000436990ENST00000394011BCRchr22

23615961

+RALGPS1chr9

129831507

+
intron-intronENST00000436990ENST00000480993BCRchr22

23615961

+RALGPS1chr9

129831507

+

Top

FusionProtFeatures for BCR_RALGPS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCR

P11274

RALGPS1

Q5JS13

GTPase-activating protein for RAC1 and CDC42. Promotesthe exchange of RAC or CDC42-bound GDP by GTP, thereby activatingthem. Displays serine/threonine kinase activity.{ECO:0000269|PubMed:1657398, ECO:0000269|PubMed:1903516}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+823498_6917051272DomainDH
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+822498_6917051228DomainDH
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+823197_3857051272RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+8231_4267051272RegionNote=Kinase
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+822197_3857051228RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+8221_4267051228RegionNote=Kinase
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394011+0521_26-91109Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000259351+619431_543161558DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373434+517431_543161530DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373436+612431_543161306DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394011+05431_543-91109DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394011+0550_289-91109DomainRas-GEF
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394022+612431_543161385DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000424082+618431_543161538DomainPH
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000259351+619330_333161558MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373434+517330_333161530MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373436+612330_333161306MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394011+05330_333-91109MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394022+612330_333161385MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000424082+618330_333161538MotifNote=PXXP
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000259351+619433_557161558RegionNote=Required for stimulation of nucleotide exchange by RALA
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373434+517433_557161530RegionNote=Required for stimulation of nucleotide exchange by RALA
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373436+612433_557161306RegionNote=Required for stimulation of nucleotide exchange by RALA
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394011+05433_557-91109RegionNote=Required for stimulation of nucleotide exchange by RALA
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394022+612433_557161385RegionNote=Required for stimulation of nucleotide exchange by RALA
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000424082+618433_557161538RegionNote=Required for stimulation of nucleotide exchange by RALA

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+823824_8277051272Compositional biasNote=Poly-Leu
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+822824_8277051228Compositional biasNote=Poly-Leu
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+8231054_12487051272DomainRho-GAP
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+823708_8667051272DomainPH
HgeneBCRchr22:23615961chr9:129831507ENST00000305877+823870_10027051272DomainC2
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+8221054_12487051228DomainRho-GAP
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+822708_8667051228DomainPH
HgeneBCRchr22:23615961chr9:129831507ENST00000359540+822870_10027051228DomainC2
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000259351+61921_26161558Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373434+51721_26161530Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373436+61221_26161306Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394022+61221_26161385Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000424082+61821_26161538Compositional biasNote=Poly-Ser
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000259351+61950_289161558DomainRas-GEF
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373434+51750_289161530DomainRas-GEF
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000373436+61250_289161306DomainRas-GEF
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000394022+61250_289161385DomainRas-GEF
TgeneRALGPS1chr22:23615961chr9:129831507ENST00000424082+61850_289161538DomainRas-GEF


Top

FusionGeneSequence for BCR_RALGPS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_1082aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLTATLGP
NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHTKSTPG
KKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQEAGAAPGPTGTDSHEVDHLEGGAGKEAGPC

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_1102aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVES
KSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESPTGPCICSLGNSAAVPTMEGPLRRKTLLKE
GRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHTKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHK

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_929aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAVSHLSSLSHQGQAEEARLKPTSGQHPAWMWPSSSRVPAAPPASAAPRSPWPRN

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_850aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_1074aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLTATLGP
NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHVSIVGW

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_1082aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLTATLGP
NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHTKSTPG
KKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQEAGAAPGPTGTDSHEVDHLEGGAGKEAGPC

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_1102aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVES
KSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESPTGPCICSLGNSAAVPTMEGPLRRKTLLKE
GRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHTKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAILWHK

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_929aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAVSHLSSLSHQGQAEEARLKPTSGQHPAWMWPSSSRVPAAPPASAAPRSPWPRN

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_850aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_1074aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGELLNRKDKTTFEKLDY
LMSKEDNYKRTRETIRSLKMVPSIPTLGITLLDLIYIDSATPASGSIMENEQRSNQMNNILRIIADLQVSCSTDHLTTLPHVQKYLKSVR
YIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAGPSAGSGSARFSRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNRGRLTATLGP
NWRVPVRNSPRTRSCVYSPTGPCICSLGNSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGAKSLRGTDRKHVSIVGW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_3246nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCC
AACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCC
GCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTAC
TGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACTATAAATCCACACCTGGC
AAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGC
AATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAG
GAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTGACAGCCACGAGGTGGACCACCTGGAGGGCGGTGCGGGGAAGGAGGCAGGGCCCTGT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_3306nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAATATGATGTGTCAGTTGAGTGTAGTTGAGAGT
AAAAGTGCGACATTCCCATCGGAGAAAGCAAGGCACCTACTGGACGACAGTGTCCTAGAGTCCCGCAGCCCCCGAAGGGGCCTGGCTCTG
ACCTCCTCCTCTGCTGTCACCAATGGACTCTCCCTAGGCAGTAGTGAGAGCTCAGAGTTTAGTGAAGAGATGTCTTCAGGGCTGGAAAGC
CCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAA
GGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGG
GGCACAGACAGAAAACACTATAAATCCACACCTGGCAAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCAC
CCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAG

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_2787nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGTCTCCCATCTCAGCAGCCTGTCACATCAAGGTCAAGCAGAAGAGGCAAGACTCAAACCCACCTCTGGC
CAACACCCTGCCTGGATGTGGCCCAGCTCCTCACGAGTACCAGCGGCTCCCCCAGCATCTGCTGCTCCGCGCTCCCCGTGGCCTAGGAAT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_2550nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_3222nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCC
AACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCC
GCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTAC
TGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACGTTTCCATCGTGGGCTGG
ATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGT
TCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAGGAAGCCGGAGCAGCTCCAGGTCCA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_3246nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCC
AACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCC
GCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTAC
TGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACTATAAATCCACACCTGGC
AAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGC
AATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAG
GAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTGACAGCCACGAGGTGGACCACCTGGAGGGCGGTGCGGGGAAGGAGGCAGGGCCCTGT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_3306nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAATATGATGTGTCAGTTGAGTGTAGTTGAGAGT
AAAAGTGCGACATTCCCATCGGAGAAAGCAAGGCACCTACTGGACGACAGTGTCCTAGAGTCCCGCAGCCCCCGAAGGGGCCTGGCTCTG
ACCTCCTCCTCTGCTGTCACCAATGGACTCTCCCTAGGCAGTAGTGAGAGCTCAGAGTTTAGTGAAGAGATGTCTTCAGGGCTGGAAAGC
CCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAA
GGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGG
GGCACAGACAGAAAACACTATAAATCCACACCTGGCAAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCAC
CCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_2787nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGTCTCCCATCTCAGCAGCCTGTCACATCAAGGTCAAGCAGAAGAGGCAAGACTCAAACCCACCTCTGGC
CAACACCCTGCCTGGATGTGGCCCAGCTCCTCACGAGTACCAGCGGCTCCCCCAGCATCTGCTGCTCCGCGCTCCCCGTGGCCTAGGAAT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_2550nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_3222nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTAC
CTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTAT
CTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATT
CTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGC
TACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTC
TCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCT
GGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCC
AACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCC
GCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTAC
TGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACGTTTCCATCGTGGGCTGG
ATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGT
TCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAGGAAGCCGGAGCAGCTCCAGGTCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_4441nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAA
AGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGAT
GGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAA
TGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCC
CCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAAT
CGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCG
GAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAA
CAGGGGACGTCTCTATGCCACCCTGGGGCCCAACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCAC
CGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCG
GAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCAC
AGACAGAAAACACTATAAATCCACACCTGGCAAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGA
TATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATTT
GGATGATGCATGTAAAAGCAACAGGCCTCAGGAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTGACAGCCACGAGGTGGACCACCTGGA
GGGCGGTGCGGGGAAGGAGGCAGGGCCCTGTGCCTGAAGCCTGGGCACCATGGTGGCCCCAGTCAGGAGCAACAGTGGTAGCCCTGAGTA
AAACCCATTGTCCCTCTTTGGAGGAGCGGCCAGAGGATGACAGCAGCCCCAGCAGGCAGCAGTGCCTGGGCAGGCTGATCCAGCAGAGCA
CTAATGGGTCAGTTTCATGTATTGGCAGATGTGGTGTAGCATGGCAAGGCTACAAGTTTTAAGGATTTTTGTCTGATTTTCAGACCTGGA
GGAGGGGATTTTTCTTCCTACTTTCCCCCTTTTTTATTTCTAATTTACTTTCAACCAAATATTCCCACTATGTGCTATATGTAATAATAA
AAAGTTGACAACAACTGAAATATTCAACAGCAGAGGATGATTTAAGTGAATCACAGTACATCCGTGTGATGGAATGCCAGGAGGGTGTAA

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_8452nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAA
AGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGAT
GGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAA
TGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCC
CCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAAT
CGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCG
GAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAA
TATGATGTGTCAGTTGAGTGTAGTTGAGAGTAAAAGTGCGACATTCCCATCGGAGAAAGCAAGGCACCTACTGGACGACAGTGTCCTAGA
GTCCCGCAGCCCCCGAAGGGGCCTGGCTCTGACCTCCTCCTCTGCTGTCACCAATGGACTCTCCCTAGGCAGTAGTGAGAGCTCAGAGTT
TAGTGAAGAGATGTCTTCAGGGCTGGAAAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGG
GCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCAC
CCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACTATAAATCCACACCTGGCAAAAAGGTTTCCATCGTGGGCTG
GATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGG
TTCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAGGTACCTGCAAACCTTATGTCATT
TGAGTAAGTCTCTGCAGGACGTGGCATGACTTCAGAGGCTTCTGGGAACCCAGGCTGGGCCTGGTGGTGAAGAGCAGTCCTGGGCACAGG
CTGTGAGCCAGGGTGCTGGGAAACTCACAGCTGGACTCAGGGGACACGGCCTGTGGCCTCACCATCCCAGAGGGCTTCACCAGTGTGGGA
TCCACCTGTCAGTCCCCAGCGACTCTCATGACACTCATTCTGCAGCACCGCCTCTTGGGGCAGTGGTCAGACCCCACACGCCCTCTCTGG
GCCCACCACCTGCATCTGCGACTAGAGAGCACCCGGCCCACGTTGGGTTCTCAGTGCTTTCTACTGCACAGAGTGGACAGCGCTAACTAA
CCTGTGAGAGGGGCCCGAGAGAAGGAACAGCTGTGGAACAGGCTTTTTACACCCCAAGTGCATGGGGTTGCTCGCCCACAGGGCTGCCTC
AGATTTTGTACAACCCCGAAGCGTCCTCTGCGTGTGCGTGCTGTACGTGTGTGTGTGTGTGTGAGCGAGTGTGAACTCTTCAAGAAACAT
GCATTTTGGCACAAGACTCGTGACATCACACACTTCATTCGCTTTGAGGCCCTGCTTTAACCTTAAGTTATAGCCCTGTCCACCGAGGAA
GGTCAGGGTGAGAGCCTAGATTCCTCCTGTGTCAAGGGTCCCTCGCATTCTTTTACTGTAAACAAACAATGCCTTAAATTGTGTCTTGTT
TTCTGTTCCTATGGGTGCTATTCATCTGGAAGGCCTGCTTCCAGGCCTCTTTGCTGTCAGCCCTTCTGAGACAGGACCTGGCTTCAGGAC
TGTGGACTGGGCTGCTGGCCTGCTTGCTTCCTCCCTTCCCCATTCCTAGCAGGGCCTGAGGCCCTCCTCTTCTCGCCCTTCCCACCATGC
CAGAATGGGAAGTTGTGACGTTGCAGCTCCAACCGACGTGCTCATAGTGATCAGCTGTGCAGGAGCCATGAGGCACCAACCTCTCCCCGC
AGGGCAAAGCCTGTGCCCCCATCATCTCACTCCTTTGCCTGCACTGCCAGGGTGGGGCCCACCAAGATTCCTGATCATGACGGGAAGCTG
AGTGACCCTGAGGCCTTAAGCTTCCCCAGTCTTGGCCCCAAATGCAGTCACCAGCAAGTTTTCCATTTTCCAAGTCCAAGGGCACAATTG
TTGATGACCGTGTGACAATAGAGCGAAGCCCCGGGGAGTGAACGGTCCAACCTCTGCATTCAGTTAGGAGCTCTTCACATGAATCACATC
CTTATCTGTCACCTTGTGTCACATTTTAAAGTGACTTTTATTTTGCACAAATAATTTTTATTCAGAATAATAAATCACTCTTTATCATAG
TATCTTCTCTTCCCTCTTCCCCTTTAGTTTGGATAGCCTAACTCTGAGAAGTTAACCCTTAAACAGTTTTCTGGAAGAGACTGAATTTCT
GGGTCCTTGCAGCTGTGATGGTTTCAGAGCTCAGACTGATCAGGCATCAAGCTACCCTCAAGAGTTTCTGGGCTGGATGTTTCAGAACAA
CATCTACACCAGTAAAGTGTAATAGGTCAGTTTCAAAACGACCAAAAGACCCACCACTGTATTTTGACCAAATAATGACAACTTCTTTAG
AAATTTGAATGGCTTGGTGAGGAAAGTAGTTGTCACCAGGGCCTCATTTTGTAGTTGAGCCTTACAATGCTTAGTAGTTCATCTTCTTTT
TGAGCAAAGACTAGAATACTTTCCTCCTAAGAGAAACTCCCAGGTGATAAAAGTTGATGCCATCAAACCTTGACACCGGGTGCTCTGCAC
ACCCACGCGGATGTTGCACCTCATTCTCCCGATGACTATTCAAATCAGCATCTAGAGGCTGAATGACAATGCCAAACACTCCACCTCTGA
TCAGAACCATGCAGTGTTAACACTTTAACCTACATTGAATCTGATTCTACCTGTTAACTTTTAAAAAGTCGTAAGTTTGGATGAAAGTGC
AAGATGTGGAACATCAACTACCTATTTTCCTTGGGTTTTTCCACTCTGCAAACTGTCCTGGTTTTTCACACCAATGAAGTATTATAGATG
CCAATCCAAAACCTCAGAATTTCAGGCACCACAAAAACAGGTAATTTTCTATCCCTTATAAGTTTGTCTTTTCTTTCAGAAACATCTCTT
AGCCTAATTTGAAATAGCACAATCACAATTCAAAATGTTTAGTCTTCTCACTAATTGAGTCTGCTTCCACGTCCTCTCCCAGGAACATTC
TTAGCTCGGACTCTTGAAGAATCTCTTTAGATTTTGTTGGCAAAAGCCTTATAGAAGCAGTAAGAGGCTTGACCACGCCGGAAGAGTCCT
GGAGCTAAAGCTGGAAGACACTCAGCTCTCTAAGCAGGGGCTCGGCCAAACATGGGAGTTAAGTGCTGCTTGTCTTCCCAGTGTTGGTTT
GAACCCTGTGAGCCTGAGACAGAGAGGGCCAGGCACCAACCACAAGGCGGGAAAGTCCATGGGTAGACCCTCCCCCTGGAGGGAAGCATT
TCTAGTTTTTGCTCCTTGACTGTCCAGAGTGTACAAATGTTCATAACGCCATTGAAGGGATTATTTCTTGCATGCATATGCTGAATTTTT
TTAAGCAAATGGATCATGGCACCCCAAAATGAAAGTTATAGAAAGCTGTCTACAACTGTGGAGTTGGTAGCTGGTAACATTGTTGTCTCA
AGAACAACTCACCTCTCTCCCTAGGACTAATTTTTGTCTCTCTCAGTTGAACATGTTTTGTCATTCAAGATCAGTCAGGTGCATTCTGGC
AACTGACATACTTGATGGAGGATTGATTCGGTAGAGAGCAGTAGAAATCTTGTTCTAACTGTGCCTGGTGAGAGACTTTGGCCCCCTCCC
TCCCTATAAGGCTGTGGAACCTGAGGAAGTAGATACTTGAAGAGATTCTGTTTAGGAAGAAACTCACTCTCTTTTGCCAGTTGAATTTAT
AGAGCATTTTTTTTCTTACCAAGATGGCCAGTATCATTTTACCCCCACCTCCCAAGCCCCAAGAGGTGTACCTTTTCAGATGCCATTTTA
CAGGCGGAAATGCTCCATGAAACAGGAAGCCACTTGCAAGCAACATCTGCTCTGTTCCTCAGGTGGGGCCCAGAGCCCTTCCCCGAGACT
GCTGATGTCTGTAACCACTGGGGAGCACTGCCAAAAATACAGCTTTCTGGTTTGTGAGCCCATAAATGACTTAAATCAGCTTTACATCAT
TTTTACATATCAAGTGGTTTCATGTTAAAAAACAAACTCCTAGTCCTTTAGAAATAACAGATTCTCTGCACAAAACCACCCATTCATTCA
TTTATTCATTCACAGCACTAGCAAGTGCTGCCTATGCTGAGAACAAGTCAGATCTGATCCCTGCCCTCATGGACCTGACCACTCAACAAA
CAGTCCCCACCACACCTATCTCCTTAGGCAAGACTTTGCCTCTCTCCTAGTCCTGAGTATAAATCCTGTGCATAGATTCCTCTAGAAAGG
CATCAAAAGGCTCAACAGACTGAATGGCCTCTTGGTCTGCGAAAATTCAGTTGCAATGAGGATGAAGTCACTATCCTAGAGGCTGCTTGG
CCCAGAAGAGCCAGGCACAGAGCTGCAGTTGGGCACGCCAAGGATTCCAAAGGTGGAATGAGAGAGTAGGGTCAAACTGTCACAGTATCT
GCTCCATAGGTTTCTGTTTTTAATTTCAATGTTAAATACAACTACAATATGAGCGAGAACTGCATTTTCTTGGGTGTTGAGAACTTGTAC
CATGGACTTCAGACCGCCTTGCAGCCGTATGCTGCACAAGCGTGTACACCCCCTGGGCAGCCTCAAAACCCCGCTTACAGCAGCAACACA
GGAGATCATCTGTCCATTTTAGAACCATTAATCTCTTTATCCATTGCTGAACGACTGTGACTATTCAGTAACGAAGTAATAGTAATTAAT
TAGTATGGTATAATCTTTAATAAATTTCGTGCCAAAATGCATGGTTTTCCACTTAGCATTCAAAATGTTGCATAGAGAGTAGTTTTCAAT
TTCTTATGTACTCTTCGAAGTAAGTTGAAAATCAGTTTCTACATTTTAATTCGTTTCCTGTTAAATCTGTTGCACTCTCCTGGGCTGTCT
TTTTCTCCAGCAGACCCCTGCATGCAGTTGTGTAAGGACTTTCTCTAATTCTTGTGAATCGTCTCACCCGCAGTAACCACTGAACGTCAA
TCAGCCCTCCATGGGGTTCTTTCGATTTTTGGTGAAGTATTTTGTTACCTCAGTCTTGTATCAAGTTGCTGTATTTTTCAGCTTGTTACA

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_3763nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAA
AGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGAT
GGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAA
TGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCC
CCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAAT
CGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGTCTCCCATCTCAGCAGCCTGTCACATCAAGGTCAAGC
AGAAGAGGCAAGACTCAAACCCACCTCTGGCCAACACCCTGCCTGGATGTGGCCCAGCTCCTCACGAGTACCAGCGGCTCCCCCAGCATC
TGCTGCTCCGCGCTCCCCGTGGCCTAGGAATCTAAGAAATGATCAAGGTCAACCAGGTGCAGTGGCTCTCACCTGTAATCCCAGCACTTT
GGGAAGCCGAAGCAGGAGGATCACTTGAGCCCAGGAGTTCAAGACCAGCCTGGGCAACATGGCAAAACCCCATCTCTACAAAAGTATATA
AATGATCTGGGCATGGTGGTGCGTGCCTACAGCCCCAGCTCCTCAGGGCTTAGGCGAGATCGCTTGATCCCAGGAGGGGGAGGCTACAGT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_3823nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAA
AGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGAT
GGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAA
TGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCC
CCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAAT
CGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGCCATGTGAGACCAGAAACCAGCAAGCCAGCCAACCTC
CAGCATCAGAGCCCTGGCAGGGGACAGAATGGACCCCAGATGGTTCACATGAAGAGACTTTAATGAACAGAACCAATAAAGCATGGCGAG
GCACCCATGGGCCGGCCCAGGGTCCTGGGGAGGGTGGAGCCCTAGGCTAAAGGGCATGGGGAAGAAGTGTTACCAATCCCAGGGATGGCT
GAGTTCTGGAGGATGATTGGCTGTGCAGGGTCTGTGGGCAGGGAGGGGGAAGCAGGAGCGAGCAGAGAAAAATCCCTGGCCTCCCTTTCC
TCCAGCCCTCAGTCTGCCACCAGAGCCTTTCATTGGCCAAATCCAATAGAAAGCTGGGGGCAAGGGGTCCAGGAGATGCATCTCAGGGGT
CAGCCTCCCCCGAACAGAAGTGGCAAGTGGGCAGGGCAAAAAATGCAGCTGAATTGTGTGAACAGACTACTCAGCATACTGCCAAGCCTC

>In-frame_BCR_ENST00000305877_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_4784nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGCTTTTAAATCGAAA
AGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACACGGGAATATATCCGAAGCCTGAAGAT
GGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATCCTGCCTCAGGCAGTATCATGGAAAA
TGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCAGCTATGATCACCTCACCACCCTGCC
CCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACGACAACTACAAACTGTCGCTCAGAAT
CGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTGGCTCCGGTTCTGCGAGGTTCAGCCG
GAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACAGGAAGAGCCACAGCCTAGGCAACAA
CAGGGGACGTCTCTATGCCACCCTGGGGCCCAACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAACCCGGAGCTGTGTCTACAGCCCCAC
CGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCG
GAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCAC
AGACAGAAAACACGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGA
CAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAG
GCCTCAGGAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTGACAGCCACGAGGTGGACCACCTGGAGGGCGGTGCGGGGAAGGAGGCAGG
GCCCTGTGCCTGAAGCCTGGGCACCATGGTGGCCCCAGTCAGGAGCAACAGTGGTAGCCCTGAGTAAAACCCATTGTCCCTCTTTGGAGG
AGCGGCCAGAGGATGACAGCAGCCCCAGCAGGCAGCAGTGCCTGGGCAGGCTGATCCAGCAGAGCACTAATGGGTCAGTTTCATGTATTG
GCAGATGTGGTGTAGCATGGCAAGGCTACAAGTTTTAAGGATTTTTGTCTGATTTTCAGACCTGGAGGAGGGGATTTTTCTTCCTACTTT
CCCCCTTTTTTATTTCTAATTTACTTTCAACCAAATATTCCCACTATGTGCTATATGTAATAATAAAAAGTTGACAACAACTGAAATATT
CAACAGCAGAGGATGATTTAAGTGAATCACAGTACATCCGTGTGATGGAATGCCAGGAGGGTGTAAGAAAGAGTGTGACAGAAATGCATC
TATTCACAAGGAAACATCGCAGTGACTAGAGTGATTTTCTGTTCTGTGGAACTGCATGTCCTAAACTTGTTTTTATTAACACTGAATACA
CTTAAACCTTATCTATAACATATGTATAGGTATAAACAACAGCAATAAAACACCTTATTGCCACCATGAGCCTAACAGCAGAGCCACCAG
GGCCTTGGAATGCTGTCCCTCACCATGGCCTCTTCCTAATTCGGTTTCTCTCCCTCCCACCTGTGCCCCAGCACCACTCTCCTGATTTGT
TTGCTGATTATTCCTTTAGAATTGCAGGTCACGTACTTGATTCCTTCATGTGTTGTCTGGGGTGCATTTTTAAACTTTCTTATAAATAGA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000424082_chr9_129831507_+_4286nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACAC
GGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATC
CTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCA
GCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACG
ACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTG
GCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACA
GGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCCAACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAA
CCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAA
GAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACT
ACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACTATAAATCCACACCTGGCAAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGC
TGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTC
ATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTCAGGAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTG
ACAGCCACGAGGTGGACCACCTGGAGGGCGGTGCGGGGAAGGAGGCAGGGCCCTGTGCCTGAAGCCTGGGCACCATGGTGGCCCCAGTCA
GGAGCAACAGTGGTAGCCCTGAGTAAAACCCATTGTCCCTCTTTGGAGGAGCGGCCAGAGGATGACAGCAGCCCCAGCAGGCAGCAGTGC
CTGGGCAGGCTGATCCAGCAGAGCACTAATGGGTCAGTTTCATGTATTGGCAGATGTGGTGTAGCATGGCAAGGCTACAAGTTTTAAGGA
TTTTTGTCTGATTTTCAGACCTGGAGGAGGGGATTTTTCTTCCTACTTTCCCCCTTTTTTATTTCTAATTTACTTTCAACCAAATATTCC
CACTATGTGCTATATGTAATAATAAAAAGTTGACAACAACTGAAATATTCAACAGCAGAGGATGATTTAAGTGAATCACAGTACATCCGT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000259351_chr9_129831507_+_8297nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACAC
GGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATC
CTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCA
GCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACG
ACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTG
GCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACA
GGAAGAGCCACAGCCTAGGCAACAATATGATGTGTCAGTTGAGTGTAGTTGAGAGTAAAAGTGCGACATTCCCATCGGAGAAAGCAAGGC
ACCTACTGGACGACAGTGTCCTAGAGTCCCGCAGCCCCCGAAGGGGCCTGGCTCTGACCTCCTCCTCTGCTGTCACCAATGGACTCTCCC
TAGGCAGTAGTGAGAGCTCAGAGTTTAGTGAAGAGATGTCTTCAGGGCTGGAAAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACT
CCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAAGAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGT
ACTGGGTCATACTCTCAGGATCCACCCTCCTGTACTACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACTATAAATCCACACCTG
GCAAAAAGGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAGATATCTTCCAGCTGAACAACCCTGACAAAG
GCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATTTGGATGATGCATGTAAAAGCAACAGGCCTC
AGGTACCTGCAAACCTTATGTCATTTGAGTAAGTCTCTGCAGGACGTGGCATGACTTCAGAGGCTTCTGGGAACCCAGGCTGGGCCTGGT
GGTGAAGAGCAGTCCTGGGCACAGGCTGTGAGCCAGGGTGCTGGGAAACTCACAGCTGGACTCAGGGGACACGGCCTGTGGCCTCACCAT
CCCAGAGGGCTTCACCAGTGTGGGATCCACCTGTCAGTCCCCAGCGACTCTCATGACACTCATTCTGCAGCACCGCCTCTTGGGGCAGTG
GTCAGACCCCACACGCCCTCTCTGGGCCCACCACCTGCATCTGCGACTAGAGAGCACCCGGCCCACGTTGGGTTCTCAGTGCTTTCTACT
GCACAGAGTGGACAGCGCTAACTAACCTGTGAGAGGGGCCCGAGAGAAGGAACAGCTGTGGAACAGGCTTTTTACACCCCAAGTGCATGG
GGTTGCTCGCCCACAGGGCTGCCTCAGATTTTGTACAACCCCGAAGCGTCCTCTGCGTGTGCGTGCTGTACGTGTGTGTGTGTGTGTGAG
CGAGTGTGAACTCTTCAAGAAACATGCATTTTGGCACAAGACTCGTGACATCACACACTTCATTCGCTTTGAGGCCCTGCTTTAACCTTA
AGTTATAGCCCTGTCCACCGAGGAAGGTCAGGGTGAGAGCCTAGATTCCTCCTGTGTCAAGGGTCCCTCGCATTCTTTTACTGTAAACAA
ACAATGCCTTAAATTGTGTCTTGTTTTCTGTTCCTATGGGTGCTATTCATCTGGAAGGCCTGCTTCCAGGCCTCTTTGCTGTCAGCCCTT
CTGAGACAGGACCTGGCTTCAGGACTGTGGACTGGGCTGCTGGCCTGCTTGCTTCCTCCCTTCCCCATTCCTAGCAGGGCCTGAGGCCCT
CCTCTTCTCGCCCTTCCCACCATGCCAGAATGGGAAGTTGTGACGTTGCAGCTCCAACCGACGTGCTCATAGTGATCAGCTGTGCAGGAG
CCATGAGGCACCAACCTCTCCCCGCAGGGCAAAGCCTGTGCCCCCATCATCTCACTCCTTTGCCTGCACTGCCAGGGTGGGGCCCACCAA
GATTCCTGATCATGACGGGAAGCTGAGTGACCCTGAGGCCTTAAGCTTCCCCAGTCTTGGCCCCAAATGCAGTCACCAGCAAGTTTTCCA
TTTTCCAAGTCCAAGGGCACAATTGTTGATGACCGTGTGACAATAGAGCGAAGCCCCGGGGAGTGAACGGTCCAACCTCTGCATTCAGTT
AGGAGCTCTTCACATGAATCACATCCTTATCTGTCACCTTGTGTCACATTTTAAAGTGACTTTTATTTTGCACAAATAATTTTTATTCAG
AATAATAAATCACTCTTTATCATAGTATCTTCTCTTCCCTCTTCCCCTTTAGTTTGGATAGCCTAACTCTGAGAAGTTAACCCTTAAACA
GTTTTCTGGAAGAGACTGAATTTCTGGGTCCTTGCAGCTGTGATGGTTTCAGAGCTCAGACTGATCAGGCATCAAGCTACCCTCAAGAGT
TTCTGGGCTGGATGTTTCAGAACAACATCTACACCAGTAAAGTGTAATAGGTCAGTTTCAAAACGACCAAAAGACCCACCACTGTATTTT
GACCAAATAATGACAACTTCTTTAGAAATTTGAATGGCTTGGTGAGGAAAGTAGTTGTCACCAGGGCCTCATTTTGTAGTTGAGCCTTAC
AATGCTTAGTAGTTCATCTTCTTTTTGAGCAAAGACTAGAATACTTTCCTCCTAAGAGAAACTCCCAGGTGATAAAAGTTGATGCCATCA
AACCTTGACACCGGGTGCTCTGCACACCCACGCGGATGTTGCACCTCATTCTCCCGATGACTATTCAAATCAGCATCTAGAGGCTGAATG
ACAATGCCAAACACTCCACCTCTGATCAGAACCATGCAGTGTTAACACTTTAACCTACATTGAATCTGATTCTACCTGTTAACTTTTAAA
AAGTCGTAAGTTTGGATGAAAGTGCAAGATGTGGAACATCAACTACCTATTTTCCTTGGGTTTTTCCACTCTGCAAACTGTCCTGGTTTT
TCACACCAATGAAGTATTATAGATGCCAATCCAAAACCTCAGAATTTCAGGCACCACAAAAACAGGTAATTTTCTATCCCTTATAAGTTT
GTCTTTTCTTTCAGAAACATCTCTTAGCCTAATTTGAAATAGCACAATCACAATTCAAAATGTTTAGTCTTCTCACTAATTGAGTCTGCT
TCCACGTCCTCTCCCAGGAACATTCTTAGCTCGGACTCTTGAAGAATCTCTTTAGATTTTGTTGGCAAAAGCCTTATAGAAGCAGTAAGA
GGCTTGACCACGCCGGAAGAGTCCTGGAGCTAAAGCTGGAAGACACTCAGCTCTCTAAGCAGGGGCTCGGCCAAACATGGGAGTTAAGTG
CTGCTTGTCTTCCCAGTGTTGGTTTGAACCCTGTGAGCCTGAGACAGAGAGGGCCAGGCACCAACCACAAGGCGGGAAAGTCCATGGGTA
GACCCTCCCCCTGGAGGGAAGCATTTCTAGTTTTTGCTCCTTGACTGTCCAGAGTGTACAAATGTTCATAACGCCATTGAAGGGATTATT
TCTTGCATGCATATGCTGAATTTTTTTAAGCAAATGGATCATGGCACCCCAAAATGAAAGTTATAGAAAGCTGTCTACAACTGTGGAGTT
GGTAGCTGGTAACATTGTTGTCTCAAGAACAACTCACCTCTCTCCCTAGGACTAATTTTTGTCTCTCTCAGTTGAACATGTTTTGTCATT
CAAGATCAGTCAGGTGCATTCTGGCAACTGACATACTTGATGGAGGATTGATTCGGTAGAGAGCAGTAGAAATCTTGTTCTAACTGTGCC
TGGTGAGAGACTTTGGCCCCCTCCCTCCCTATAAGGCTGTGGAACCTGAGGAAGTAGATACTTGAAGAGATTCTGTTTAGGAAGAAACTC
ACTCTCTTTTGCCAGTTGAATTTATAGAGCATTTTTTTTCTTACCAAGATGGCCAGTATCATTTTACCCCCACCTCCCAAGCCCCAAGAG
GTGTACCTTTTCAGATGCCATTTTACAGGCGGAAATGCTCCATGAAACAGGAAGCCACTTGCAAGCAACATCTGCTCTGTTCCTCAGGTG
GGGCCCAGAGCCCTTCCCCGAGACTGCTGATGTCTGTAACCACTGGGGAGCACTGCCAAAAATACAGCTTTCTGGTTTGTGAGCCCATAA
ATGACTTAAATCAGCTTTACATCATTTTTACATATCAAGTGGTTTCATGTTAAAAAACAAACTCCTAGTCCTTTAGAAATAACAGATTCT
CTGCACAAAACCACCCATTCATTCATTTATTCATTCACAGCACTAGCAAGTGCTGCCTATGCTGAGAACAAGTCAGATCTGATCCCTGCC
CTCATGGACCTGACCACTCAACAAACAGTCCCCACCACACCTATCTCCTTAGGCAAGACTTTGCCTCTCTCCTAGTCCTGAGTATAAATC
CTGTGCATAGATTCCTCTAGAAAGGCATCAAAAGGCTCAACAGACTGAATGGCCTCTTGGTCTGCGAAAATTCAGTTGCAATGAGGATGA
AGTCACTATCCTAGAGGCTGCTTGGCCCAGAAGAGCCAGGCACAGAGCTGCAGTTGGGCACGCCAAGGATTCCAAAGGTGGAATGAGAGA
GTAGGGTCAAACTGTCACAGTATCTGCTCCATAGGTTTCTGTTTTTAATTTCAATGTTAAATACAACTACAATATGAGCGAGAACTGCAT
TTTCTTGGGTGTTGAGAACTTGTACCATGGACTTCAGACCGCCTTGCAGCCGTATGCTGCACAAGCGTGTACACCCCCTGGGCAGCCTCA
AAACCCCGCTTACAGCAGCAACACAGGAGATCATCTGTCCATTTTAGAACCATTAATCTCTTTATCCATTGCTGAACGACTGTGACTATT
CAGTAACGAAGTAATAGTAATTAATTAGTATGGTATAATCTTTAATAAATTTCGTGCCAAAATGCATGGTTTTCCACTTAGCATTCAAAA
TGTTGCATAGAGAGTAGTTTTCAATTTCTTATGTACTCTTCGAAGTAAGTTGAAAATCAGTTTCTACATTTTAATTCGTTTCCTGTTAAA
TCTGTTGCACTCTCCTGGGCTGTCTTTTTCTCCAGCAGACCCCTGCATGCAGTTGTGTAAGGACTTTCTCTAATTCTTGTGAATCGTCTC
ACCCGCAGTAACCACTGAACGTCAATCAGCCCTCCATGGGGTTCTTTCGATTTTTGGTGAAGTATTTTGTTACCTCAGTCTTGTATCAAG
TTGCTGTATTTTTCAGCTTGTTACATTGATAATAATTATTTCACTAATTAAATACTTTAATGTACAAACATCTTTGTTTACTTTGAAATT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000394022_chr9_129831507_+_3608nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACAC
GGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATC
CTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCA
GCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACG
ACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGTCTCCCATCTCA
GCAGCCTGTCACATCAAGGTCAAGCAGAAGAGGCAAGACTCAAACCCACCTCTGGCCAACACCCTGCCTGGATGTGGCCCAGCTCCTCAC
GAGTACCAGCGGCTCCCCCAGCATCTGCTGCTCCGCGCTCCCCGTGGCCTAGGAATCTAAGAAATGATCAAGGTCAACCAGGTGCAGTGG
CTCTCACCTGTAATCCCAGCACTTTGGGAAGCCGAAGCAGGAGGATCACTTGAGCCCAGGAGTTCAAGACCAGCCTGGGCAACATGGCAA
AACCCCATCTCTACAAAAGTATATAAATGATCTGGGCATGGTGGTGCGTGCCTACAGCCCCAGCTCCTCAGGGCTTAGGCGAGATCGCTT
GATCCCAGGAGGGGGAGGCTACAGTGAGCCGTGATCGCGCCACCGCGCTCCAGCTTGGGTGACAGAGCAAGACCTTGTCTCAGGAAAAAA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373436_chr9_129831507_+_3668nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACAC
GGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATC
CTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCA
GCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACG
ACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGCCATGTGAGACC
AGAAACCAGCAAGCCAGCCAACCTCCAGCATCAGAGCCCTGGCAGGGGACAGAATGGACCCCAGATGGTTCACATGAAGAGACTTTAATG
AACAGAACCAATAAAGCATGGCGAGGCACCCATGGGCCGGCCCAGGGTCCTGGGGAGGGTGGAGCCCTAGGCTAAAGGGCATGGGGAAGA
AGTGTTACCAATCCCAGGGATGGCTGAGTTCTGGAGGATGATTGGCTGTGCAGGGTCTGTGGGCAGGGAGGGGGAAGCAGGAGCGAGCAG
AGAAAAATCCCTGGCCTCCCTTTCCTCCAGCCCTCAGTCTGCCACCAGAGCCTTTCATTGGCCAAATCCAATAGAAAGCTGGGGGCAAGG
GGTCCAGGAGATGCATCTCAGGGGTCAGCCTCCCCCGAACAGAAGTGGCAAGTGGGCAGGGCAAAAAATGCAGCTGAATTGTGTGAACAG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_RALGPS1_ENST00000373434_chr9_129831507_+_4629nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCTTTTAAATCGAAAAGACAAGACTACCTTTGAGAAATTGGACTACCTGATGTCGAAAGAAGATAATTACAAGCGGACAC
GGGAATATATCCGAAGCCTGAAGATGGTTCCAAGTATTCCCTATCTAGGAATCTATCTTCTGGATTTAATCTACATTGATTCTGCATATC
CTGCCTCAGGCAGTATCATGGAAAATGAACAAAGATCCAATCAGATGAACAATATTCTTCGAATAATTGCTGATTTACAAGTTTCCTGCA
GCTATGATCACCTCACCACCCTGCCCCATGTGCAGAAGTACCTGAAGTCCGTACGCTACATTGAAGAGCTCCAGAAGTTTGTGGAAGACG
ACAACTACAAACTGTCGCTCAGAATCGAACCAGGAAGCAGCTCTCCAAGACTAGTCTCTTCCAAGGAAGATCTTGCAGGTCCCTCTGCTG
GCTCCGGTTCTGCGAGGTTCAGCCGGAGGCCCACCTGTCCTGACACATCTGTTGCTGGCAGCCTCCCCACACCTCCAGTCCCCAGACACA
GGAAGAGCCACAGCCTAGGCAACAACAGGGGACGTCTCTATGCCACCCTGGGGCCCAACTGGCGGGTTCCAGTTAGGAATTCTCCCAGAA
CCCGGAGCTGTGTCTACAGCCCCACCGGCCCGTGCATCTGTTCTCTGGGGAACTCCGCAGCTGTGCCCACCATGGAGGGGCCTCTGAGAA
GAAAAACCCTGCTCAAGGAAGGGCGGAAGCCTGCGCTGTCCTCGTGGACCAGGTACTGGGTCATACTCTCAGGATCCACCCTCCTGTACT
ACGGAGCCAAGTCCTTGCGGGGCACAGACAGAAAACACGTTTCCATCGTGGGCTGGATGGTGCAGCTGCCCGATGACCCCGAGCACCCAG
ATATCTTCCAGCTGAACAACCCTGACAAAGGCAATGTTTACAAGTTTCAGACTGGTTCCCGATTTCATGCAATACTGTGGCACAAGCATT
TGGATGATGCATGTAAAAGCAACAGGCCTCAGGAAGCCGGAGCAGCTCCAGGTCCAACAGGAACTGACAGCCACGAGGTGGACCACCTGG
AGGGCGGTGCGGGGAAGGAGGCAGGGCCCTGTGCCTGAAGCCTGGGCACCATGGTGGCCCCAGTCAGGAGCAACAGTGGTAGCCCTGAGT
AAAACCCATTGTCCCTCTTTGGAGGAGCGGCCAGAGGATGACAGCAGCCCCAGCAGGCAGCAGTGCCTGGGCAGGCTGATCCAGCAGAGC
ACTAATGGGTCAGTTTCATGTATTGGCAGATGTGGTGTAGCATGGCAAGGCTACAAGTTTTAAGGATTTTTGTCTGATTTTCAGACCTGG
AGGAGGGGATTTTTCTTCCTACTTTCCCCCTTTTTTATTTCTAATTTACTTTCAACCAAATATTCCCACTATGTGCTATATGTAATAATA
AAAAGTTGACAACAACTGAAATATTCAACAGCAGAGGATGATTTAAGTGAATCACAGTACATCCGTGTGATGGAATGCCAGGAGGGTGTA
AGAAAGAGTGTGACAGAAATGCATCTATTCACAAGGAAACATCGCAGTGACTAGAGTGATTTTCTGTTCTGTGGAACTGCATGTCCTAAA
CTTGTTTTTATTAACACTGAATACACTTAAACCTTATCTATAACATATGTATAGGTATAAACAACAGCAATAAAACACCTTATTGCCACC
ATGAGCCTAACAGCAGAGCCACCAGGGCCTTGGAATGCTGTCCCTCACCATGGCCTCTTCCTAATTCGGTTTCTCTCCCTCCCACCTGTG
CCCCAGCACCACTCTCCTGATTTGTTTGCTGATTATTCCTTTAGAATTGCAGGTCACGTACTTGATTCCTTCATGTGTTGTCTGGGGTGC


Top

FusionGenePPI for BCR_RALGPS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCRMLLT4, HCK, PTPN6, FES, RB1, ERCC3, GRB2, ABL1, GAB2, HOXA9, CRKL, KIT, PIK3CG, IGSF21, TP53, UNC119, SOS1, PXN, RAC1, CDC42, RHOA, IL3, WDR48, TSG101, VPS28, INPP5D, MYC, HSP90AA1, HSPA8, HIF1A, CRK, GABRR1, CBL, LNX1, LRRK1, GRK5, UBASH3B, PIK3R2, SHC1, AP2M1, CFTR, ERBB2IP, DOK1, PTGES3, HSPA4, HSPD1, UBC, CSNK2A2, STUB1, CCDC183, RSPH9, SEC13, NTRK1, CEP128, NINL, XPO1, PIK3R1, PDZK1, COMMD1, TULP3, JPH4, NAGK, USP15, SPAG9, MCM2, MCM4, WEE1, CSNK1A1, MCM6, TRIM25, RAD51RALGPS1RALA, GRB2, NCK1, APP, C2orf88


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCR_RALGPS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneBCRP11274DB06616BosutinibBreakpoint cluster region proteinsmall moleculeapproved
HgeneBCRP11274DB01254DasatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational
HgeneBCRP11274DB08901PonatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational

Top

RelatedDiseases for BCR_RALGPS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBCRC0005586Bipolar Disorder4PSYGENET
HgeneBCRC0023473Myeloid Leukemia, Chronic3CTD_human;HPO;ORPHANET
HgeneBCRC0005699Blast Phase1CTD_human
HgeneBCRC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneBCRC0027022Myeloproliferative disease1CTD_human;HPO
HgeneBCRC0027540Necrosis1CTD_human
HgeneBCRC0027659Neoplasms, Experimental1CTD_human
HgeneBCRC0041696Unipolar Depression1PSYGENET
HgeneBCRC1269683Major Depressive Disorder1PSYGENET
TgeneRALGPS1C0005695Bladder Neoplasm1CTD_human