FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4089

FusionGeneSummary for BCR_MOV10L1

check button Fusion gene summary
Fusion gene informationFusion gene name: BCR_MOV10L1
Fusion gene ID: 4089
HgeneTgene
Gene symbol

BCR

MOV10L1

Gene ID

613

54456

Gene nameBCR, RhoGEF and GTPase activating proteinMov10 RISC complex RNA helicase like 1
SynonymsALL|BCR1|CML|D22S11|D22S662|PHLCHAMP|DJ402G11.8
Cytomap

22q11.23

22q13.33

Type of geneprotein-codingprotein-coding
Descriptionbreakpoint cluster region proteinBCR/FGFR1 chimera proteinFGFR1/BCR chimera proteinbreakpoint cluster regionrenal carcinoma antigen NY-REN-26RNA helicase Mov10l1MOV10-like protein 1Mov10-like 1Mov10l1, Moloney leukemia virus 10-like 1, homologcardiac helicase activated by MEF2C proteinmoloney leukemia virus 10-like protein 1putative helicase Mov10l1
Modification date2018052720180523
UniProtAcc

P11274

Q9BXT6

Ensembl transtripts involved in fusion geneENST00000305877, ENST00000359540, 
ENST00000398512, ENST00000436990, 
ENST00000545383, ENST00000262794, 
ENST00000395858, ENST00000395843, 
ENST00000540615, ENST00000395852, 
ENST00000354853, ENST00000475190, 
Fusion gene scores* DoF score17 X 39 X 8=53041 X 1 X 1=1
# samples 701
** MAII scorelog2(70/5304*10)=-2.92165394828026
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: BCR [Title/Abstract] AND MOV10L1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-C8-A27A-01ABCRchr22

23524426

+MOV10L1chr22

50530430

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000305877ENST00000545383BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000305877ENST00000262794BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000305877ENST00000395858BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000305877ENST00000395843BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000305877ENST00000540615BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000305877ENST00000395852BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000305877ENST00000354853BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-3UTRENST00000305877ENST00000475190BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000359540ENST00000545383BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000359540ENST00000262794BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000359540ENST00000395858BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000359540ENST00000395843BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000359540ENST00000540615BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000359540ENST00000395852BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000359540ENST00000354853BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-3UTRENST00000359540ENST00000475190BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000398512ENST00000545383BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000398512ENST00000262794BCRchr22

23524426

+MOV10L1chr22

50530430

+
In-frameENST00000398512ENST00000395858BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000398512ENST00000395843BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-5UTRENST00000398512ENST00000540615BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000398512ENST00000395852BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-intronENST00000398512ENST00000354853BCRchr22

23524426

+MOV10L1chr22

50530430

+
5CDS-3UTRENST00000398512ENST00000475190BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-3CDSENST00000436990ENST00000545383BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-3CDSENST00000436990ENST00000262794BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-3CDSENST00000436990ENST00000395858BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-5UTRENST00000436990ENST00000395843BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-5UTRENST00000436990ENST00000540615BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-intronENST00000436990ENST00000395852BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-intronENST00000436990ENST00000354853BCRchr22

23524426

+MOV10L1chr22

50530430

+
intron-3UTRENST00000436990ENST00000475190BCRchr22

23524426

+MOV10L1chr22

50530430

+

Top

FusionProtFeatures for BCR_MOV10L1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCR

P11274

MOV10L1

Q9BXT6

GTPase-activating protein for RAC1 and CDC42. Promotesthe exchange of RAC or CDC42-bound GDP by GTP, thereby activatingthem. Displays serine/threonine kinase activity.{ECO:0000269|PubMed:1657398, ECO:0000269|PubMed:1903516}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+123197_3854261272RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+1231_4264261272RegionNote=Kinase
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+122197_3854261228RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+1221_4264261228RegionNote=Kinase
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000262794+027886_889321212MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000354853+03886_889-102126MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395843+022886_889-870126MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395852+09886_889-59339MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395858+026886_889321166MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000540615+026886_889121166MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000545383+128886_889321212MotifNote=DEAG box
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000262794+027770_777321212Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000354853+03770_777-102126Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395843+022770_777-870126Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395852+09770_777-59339Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000395858+026770_777321166Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000540615+026770_777121166Nucleotide bindingATP
TgeneMOV10L1chr22:23524426chr22:50530430ENST00000545383+128770_777321212Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+123824_8274261272Compositional biasNote=Poly-Leu
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+122824_8274261228Compositional biasNote=Poly-Leu
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+1231054_12484261272DomainRho-GAP
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+123498_6914261272DomainDH
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+123708_8664261272DomainPH
HgeneBCRchr22:23524426chr22:50530430ENST00000305877+123870_10024261272DomainC2
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+1221054_12484261228DomainRho-GAP
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+122498_6914261228DomainDH
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+122708_8664261228DomainPH
HgeneBCRchr22:23524426chr22:50530430ENST00000359540+122870_10024261228DomainC2


Top

FusionGeneSequence for BCR_MOV10L1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_1560aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTDPCFGALLEYSITNGVYMGCDLPPALQS

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_1560aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTDPCFGALLEYSITNGVYMGCDLPPALQS

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_1606aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTVRSNEDRFEDDRTFLGFLSNSKRFNVAI

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_1560aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDAGDTKLKTVRGVVTRYCSDTGMIDD
MIYFSSDAVTSRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC
EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQSCTV
WRALCMTLVKRRDAAPVHEATHFTGTILLKNKGDIEVTQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD
QMCPVVSFVSVPEKENSSDENINSLNSHTKNKTSQMSESSLVNNRGISPGDCTCKGENGEKDNILSRKQMTEPEPGGLVPPGGKTFIVVI
CDGKNPGRCKELLLLCFSDFLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKRNSRRQLPSFLPQTPIPDRLRK
CVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEITAEMELKETNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGH
AIEYISYVTEIHEEDVTLKINPEFEQATNFEPMDVEFTTNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQS
TSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPTILFGPPGTGK
TVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRFEEIVIDAVKPTCRDGEDIWKASRFRIIITTCSS
SGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMATGLNVSFLERLMSRPAYQRDENAFGA
CGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRY
CCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNVDLMDIKVGSVEEFQGQETLVIIISTDPCFGALLEYSITNGVYMGCDLPPALQS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_4680nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCT
CTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGA

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_4680nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCT
CTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGA

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_4818nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATC
ACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATT
ACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCA

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_4680nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGAT
ATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTG
TCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGC
CCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGC
GAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAG
CCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTG
GACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTC
TGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAG
AACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAAT
AAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGAC
CAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAA
AACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAA
AAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATC
TGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTT
ATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACT
ACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAA
TGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACT
TTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTG
GTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACAT
GCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTT
GAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAA
GTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCC
ACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTG
GCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAAT
GAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAG
ACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCT
GACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATA
GTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGC
TCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGC
CTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGA
CTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCT
TGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTC
TACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTC
ATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTAC
TGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATC
AGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATT
TCGACCGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCT
CTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_5738nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAG
GTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGA
AGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAG
CAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCA
GACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGG
CACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGG
GGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGT
GGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGC
CACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAG
AAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAA
ACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGA
AAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGG
TGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCC
TCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTT
CCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAA
AAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCC
CCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAA
CATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGG
GATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACT
GATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAAT
TAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGC
ACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCA
TGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAG
GCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAG
AAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTA
TATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGAT
TTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCG
GGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACG
CTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGA
CGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCC
CATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGC
GTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGA
GGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTG
GGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAA
CCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCAT
CACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTT
TCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTT
GTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCC
CTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTG
TGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGATCTGCAGTGGC
TGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCTGTGGCCTGCCCTTGTCTCGCAGCCA

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_5810nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAG
GTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGA
AGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAG
CAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCA
GACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGG
CACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGG
GGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGT
GGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGC
CACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAG
AAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAA
ACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGA
AAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGG
TGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCC
TCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTT
CCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAA
AAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCC
CCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAA
CATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGG
GATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACT
GATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAAT
TAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGC
ACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCA
TGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAG
GCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAG
AAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTA
TATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGAT
TTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCG
GGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACG
CTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGA
CGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCC
CATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGC
GTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGA
GGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTG
GGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAA
CCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCAT
CACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTT
TCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAGATGATCGATATTTTTTGGGTTTCTT
GTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAAACCCCCATGTTCTCGTTCGAGACCC
CTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTG
TGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGATCTGCAGTGGC
TGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCTGTGGCCTGCCCTTGTCTCGCAGCCA
GGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGCATATGCCAGCCTGTTCCTGCCACAG

>In-frame_BCR_ENST00000305877_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_5672nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGAAAACTGTACGGGGTGTCGTGACAAG
GTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCAGAGTGCTTCTGAATGTTGGACAGGA
AGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTGTCTCTGATAAGTGGGAAGACGACAG
CAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGGTGGAGGGCGCAGGCTGTATCAGTCA
GACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGGAGGCTGAGTACCGGATCCGGCCTGG
CACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCATCTCTAGCCTCTGTGGAAGGAACGG
GGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCCGGAGAGGTGACGTGGTCAATGCAGT
GGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGCGAGACGCCGCCCCTGTTCATGAGGC
CACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGCATTTTGGAACCCTAAAGGAAGGAAG
AAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTAAACTGGCTGGCTGGGATAAATCTAA
ACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTCCTGAGAAGGAGAATTCATCAGATGA
AAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGGTGAACAACAGAGGAATCTCTCCAGG
TGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAGAGCCTGAGCCTGGGGGGCTTGTCCC
TCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGCTCCTTTTGCTCTGTTTTTCCGATTT
CCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCGAACCATTTTCTTGGAAAAAGCTTAA
AAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAAGACGACAACTTCCAAGTTTTCTTCC
CCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCCAGCCATTACTTGCAGAGCTTCTGAA
CATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGGAACTGAAAGAGTATAACATGAGCGG
GATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGCCTTCTCTCTACGCAGGTGATAAACT
GATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTCATGAAGAAGATGTAACTCTTAAAAT
TAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGACCACAAGCAGACGGTGTCACTTTGC
ACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTCCACAAGTGACGGGAAATTGGAACCA
TGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACCAAGCTGAGCATGGAACAGAGGAGAG
GCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAGATGAAATTCAGACCCCTAAAGCAAG
AAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGAGTGGTGACTGCCGTCCCCTCCCGTA
TATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTACACTTTGCCTTGCCGGACAGTCGGAT
TTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGGTGCTACAGCCGGCCACCATGGTCCG
GGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACGGAGAAGACATCTGGAAAGCCTCACG
CTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTGGGCACTTCACTCACGTGTTTGTGGA
CGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTGGCCAGATCGTGCTGGCAGGAGACCC
CATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTTTGGAACGGCTGATGTCTCGACCCGC
GTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGCTGGTGAAGAACTACCGGTCCCACGA
GGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCACAGTGGTGACCTCCTTGCTGGGCTG
GGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGGAGGGAAAAAGCCCATCGTGGTTCAA
CCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGGTGTCTGCCAGCGACATTGGCGTCAT
CACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATATAAAGGTTGGATCAGTAGAGGAGTT
TCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACAT
GGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCAC
AGGACCAGAGAAGCATCAGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAG
TCTGCTCCGTGGCTCCTGTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCT
GCTGCCCTGACTTTGGCATATGCCAGCCTGTTCCTGCCACAGGGCAGTCACTGCCGCCTACCCTGAAATAAACCCTCGAGTGACCCCCAG

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_5583nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAG
ATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAA
ACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTC
CTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATC
AGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCT
GTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGC

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_5655nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAG
ATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAA
ACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTC
CTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATC
AGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCT
GTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGC

>In-frame_BCR_ENST00000359540_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_5517nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGACCCCTGTTTTGGTGCTTTGCTGGAAT
ACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCT
CCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCT
CAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCTGTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGG
GGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGCATATGCCAGCCTGTTCCTGCCACAGGGCAGTCACTGCCGCCTACCCTG

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000545383_chr22_50530430_+_5583nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAG
ATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAA
ACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTC
CTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATC
AGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCT
GTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGC

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000262794_chr22_50530430_+_5655nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGTACGGTCAAATGAAGATAGATTTGAAG
ATGATCGATATTTTTTGGGTTTCTTGTCCAACTCAAAAAGATTTAATGTTGCAATCACCAGACCCAAAGCTTTGCTGATAGTGCTGGGAA
ACCCCCATGTTCTCGTTCGAGACCCCTGTTTTGGTGCTTTGCTGGAATACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTC
CTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCTCCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATC
AGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCTCAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCT
GTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGGGGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGC

>In-frame_BCR_ENST00000398512_chr22_23524426_+_MOV10L1_ENST00000395858_chr22_50530430_+_5517nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGGTGACACTAAGCTGA
AAACTGTACGGGGTGTCGTGACAAGGTACTGCAGCGATTATGGCATGATTGATGATATGATCTACTTCTCCAGTGATGCTGTGACTAGCA
GAGTGCTTCTGAATGTTGGACAGGAAGTGATTGCAGTTGTGGAAGAAAATAAAGTGTCCAATGGACTGAAAGCAATCAGGGTAGAAGCTG
TCTCTGATAAGTGGGAAGACGACAGCAGAAACCATGGGAGTCCCTCAGACTGCGGCCCCCGAGTGTTGATTGGCTGTGTGACTTCCCTGG
TGGAGGGCGCAGGCTGTATCAGTCAGACCACCTACTTCTCTCTGGAGAGTGTGTGCGAAGGCTTCGAGCCCTGCAAGGGAGACTGGGTGG
AGGCTGAGTACCGGATCCGGCCTGGCACGTGGAGCAGCGAAGCCACCTCAGTGAAGCCACTGAGATACAAGCGCGTGGACAAGGTCTGCA
TCTCTAGCCTCTGTGGAAGGAACGGGGTGTTAGAGGAAAGCATCTTCTTTACCTTGGACTCCTTGAAACTGCCAGATGGGTACACACCCC
GGAGAGGTGACGTGGTCAATGCAGTGGTGGTGGAGAGCAGCCAGTCATGCTATGTCTGGAGGGCACTTTGTATGACCCTAGTGAAGAGGC
GAGACGCCGCCCCTGTTCATGAGGCCACTCATTTCTATGGAACGATTTTGCTGAAGAACAAAGGTGATATTGAAGTTACACAGGTGACGC
ATTTTGGAACCCTAAAGGAAGGAAGAAGTAAAACCATGGTGATCTGGATAGAGAATAAAGGAGACATTCCTCAAAACTTAGTCAGCTGTA
AACTGGCTGGCTGGGATAAATCTAAACAATTCAGATTCCAAATGCTGGATAAAGACCAGATGTGCCCCGTGGTATCTTTTGTTTCTGTTC
CTGAGAAGGAGAATTCATCAGATGAAAATATTAATTCATTAAATAGCCACACAAAAAACAAAACCTCTCAGATGTCGGAGAGCAGTTTGG
TGAACAACAGAGGAATCTCTCCAGGTGATTGTACCTGTAAAGGAGAAAATGGAGAAAAAGACAACATTCTATCAAGGAAGCAGATGACAG
AGCCTGAGCCTGGGGGGCTTGTCCCTCCAGGGGGAAAAACCTTCATTGTGGTCATCTGTGACGGAAAAAATCCTGGCCGCTGCAAGGAGC
TCCTTTTGCTCTGTTTTTCCGATTTCCTAATTGGGCGATACCTTGAAGTAAATGTTATCAGTGGGGAGGAGTCACTAATTGCTGCGCGCG
AACCATTTTCTTGGAAAAAGCTTAAAAGTTCACAAGCGTTAACATCCGCAAAAACTACAGTTGTTGTGACCGCACAGAAAAGGAACTCAA
GACGACAACTTCCAAGTTTTCTTCCCCAATATCCAATCCCAGATAGACTTAGAAAATGTGTGGAACAAAAAATTGACATCCTGACTTTCC
AGCCATTACTTGCAGAGCTTCTGAACATGTCAAATTACAAGGAGAAGTTTTCGACTTTGCTGTGGCTTGAGGAGATTTATGCAGAAATGG
AACTGAAAGAGTATAACATGAGCGGGATCATCTTAAGAAGGAATGGGGATCTGCTGGTTCTGGAGGTCCCAGGGTTGGCCGAAGGGAGGC
CTTCTCTCTACGCAGGTGATAAACTGATTTTAAAAACTCAAGAGTACAATGGACATGCCATCGAATACATCAGCTACGTGACTGAGATTC
ATGAAGAAGATGTAACTCTTAAAATTAATCCAGAATTTGAACAAGCCTATAACTTTGAACCTATGGATGTGGAATTTACATATAATAGGA
CCACAAGCAGACGGTGTCACTTTGCACTTGAACACGTCATCCACTTAGGTGTAAAAGTGTTGTTTCCAGAAGAAATTATTTTACAGTCTC
CACAAGTGACGGGAAATTGGAACCATGCACAAGACACCAAAAGCAGTGGACAGTCCACCAGCAAAAAGAATAGGAAAACAATGACGGACC
AAGCTGAGCATGGAACAGAGGAGAGGCGTGTTGGTGACAAGGACCTGCCGGTGCTGGCACCCTTTACTGCAGAGATGAGCGATTGGGTAG
ATGAAATTCAGACCCCTAAAGCAAGAAAGATGGAGTTTTTCAACCCAGTGCTAAATGAAAATCAGAAGTTAGCAGTTAAAAGGATTCTGA
GTGGTGACTGCCGTCCCCTCCCGTATATTCTCTTTGGACCTCCTGGTACTGGAAAGACAGTGACAATAATAGAGGCTGTTTTACAGGTAC
ACTTTGCCTTGCCGGACAGTCGGATTTTAGTCTGTGCGCCCTCCAACAGTGCTGCTGACCTCGTGTGTCTGCGGCTGCACGAGAGCAAGG
TGCTACAGCCGGCCACCATGGTCCGGGTGAACGCCACCTGCAGGTTCGAGGAGATAGTTATTGACGCCGTCAAACCGTATTGCAGAGACG
GAGAAGACATCTGGAAAGCCTCACGCTTCCGGATAATCATCACCACATGCAGCAGCTCAGGGCTGTTTTACCAAATAGGAGTGAGAGTTG
GGCACTTCACTCACGTGTTTGTGGACGAGGCTGGGCAGGCAAGTGAGCCGGAATGCCTCATTCCTCTGGGGCTGATGTCGGACATCAGTG
GCCAGATCGTGCTGGCAGGAGACCCCATGCAGCTCGGCCCAGTCATTAAGTCCAGACTCGCCATGGCCTATGGGCTGAACGTGTCCTTTT
TGGAACGGCTGATGTCTCGACCCGCGTACCAGAGGGACGAAAATGCTTTCGGTGCTTGTGGCGCACATAATCCCCTGTTGGTCACAAAGC
TGGTGAAGAACTACCGGTCCCACGAGGCCCTGCTGATGCTGCCCTCACGGCTGTTCTACCACAGGGAACTCGAGGTCTGTGCGGACCCCA
CAGTGGTGACCTCCTTGCTGGGCTGGGAGAAGTTGCCTAAGAAAGGCTTCCCTCTCATCTTCCATGGTGTGCGGGGCAGCGAGGCACGGG
AGGGAAAAAGCCCATCGTGGTTCAACCCGGCCGAGGCCGTCCAGGTCCTGCGCTACTGCTGCCTCCTGGCCCACAGCATCTCCAGTCAGG
TGTCTGCCAGCGACATTGGCGTCATCACGCCCTACCGGAAGCAGGTGGAGAAAATCAGAATTCTTTTGCGTAATGTTGATCTGATGGATA
TAAAGGTTGGATCAGTAGAGGAGTTTCAAGGACAAGAGTATCTGGTCATCATCATTTCGACCGACCCCTGTTTTGGTGCTTTGCTGGAAT
ACAGTATTACAAACGGTGTTTACATGGGATGCGATTTACCTCCTGCACTGCAGTCTCTGCAAAACTGTGGCGAGGGGGTGGCAGACCCCT
CCTACCCAGTGGTGCCAGAATCCACAGGACCAGAGAAGCATCAGGAGCCCAGCTGATCTGCAGTGGCTGACAGCAGGGAGGCCATGTGCT
CAGCCTGGCCACGTTGCCGTTACAGTCTGCTCCGTGGCTCCTGTGGCCTGCCCTTGTCTCGCAGCCAGGCAGGGTCGTGTGTGGGTGTGG
GGCTGCCAGGTTGGACGCAGCTGCTGCTGCCCTGACTTTGGCATATGCCAGCCTGTTCCTGCCACAGGGCAGTCACTGCCGCCTACCCTG


Top

FusionGenePPI for BCR_MOV10L1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCRMLLT4, HCK, PTPN6, FES, RB1, ERCC3, GRB2, ABL1, GAB2, HOXA9, CRKL, KIT, PIK3CG, IGSF21, TP53, UNC119, SOS1, PXN, RAC1, CDC42, RHOA, IL3, WDR48, TSG101, VPS28, INPP5D, MYC, HSP90AA1, HSPA8, HIF1A, CRK, GABRR1, CBL, LNX1, LRRK1, GRK5, UBASH3B, PIK3R2, SHC1, AP2M1, CFTR, ERBB2IP, DOK1, PTGES3, HSPA4, HSPD1, UBC, CSNK2A2, STUB1, CCDC183, RSPH9, SEC13, NTRK1, CEP128, NINL, XPO1, PIK3R1, PDZK1, COMMD1, TULP3, JPH4, NAGK, USP15, SPAG9, MCM2, MCM4, WEE1, CSNK1A1, MCM6, TRIM25, RAD51MOV10L1AASDHPPT


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCR_MOV10L1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneBCRP11274DB06616BosutinibBreakpoint cluster region proteinsmall moleculeapproved
HgeneBCRP11274DB01254DasatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational
HgeneBCRP11274DB08901PonatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational

Top

RelatedDiseases for BCR_MOV10L1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBCRC0005586Bipolar Disorder4PSYGENET
HgeneBCRC0023473Myeloid Leukemia, Chronic3CTD_human;HPO;ORPHANET
HgeneBCRC0005699Blast Phase1CTD_human
HgeneBCRC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneBCRC0027022Myeloproliferative disease1CTD_human;HPO
HgeneBCRC0027540Necrosis1CTD_human
HgeneBCRC0027659Neoplasms, Experimental1CTD_human
HgeneBCRC0041696Unipolar Depression1PSYGENET
HgeneBCRC1269683Major Depressive Disorder1PSYGENET