FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40823

FusionGeneSummary for UNC79_BRF1

check button Fusion gene summary
Fusion gene informationFusion gene name: UNC79_BRF1
Fusion gene ID: 40823
HgeneTgene
Gene symbol

UNC79

BRF1

Gene ID

57578

2972

Gene nameunc-79 homolog, NALCN channel complex subunitBRF1, RNA polymerase III transcription initiation factor subunit
SynonymsKIAA1409BRF|BRF-1|CFDS|GTF3B|HEL-S-76p|TAF3B2|TAF3C|TAFIII90|TF3B90|TFIIIB90|hBRF
Cytomap

14q32.12

14q32.33

Type of geneprotein-codingprotein-coding
Descriptionprotein unc-79 homologunc-79 homologtranscription factor IIIB 90 kDa subunitB - related factor 1BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIBBRF1, RNA polymerase III transcription initiation factor 90 kDa subunitTATA box binding protein (TBP)-associate
Modification date2018051920180519
UniProtAcc

Q9P2D8

Q92994

Ensembl transtripts involved in fusion geneENST00000256339, ENST00000555664, 
ENST00000553484, ENST00000393151, 
ENST00000546474, ENST00000327359, 
ENST00000440513, ENST00000392557, 
ENST00000379937, ENST00000547530, 
ENST00000446501, ENST00000379932, 
ENST00000551787, ENST00000549044, 
ENST00000548421, 
Fusion gene scores* DoF score2 X 2 X 2=86 X 6 X 5=180
# samples 36
** MAII scorelog2(3/8*10)=1.90689059560852log2(6/180*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: UNC79 [Title/Abstract] AND BRF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLGGTCGA-DU-A5TU-01AUNC79chr14

94069764

+BRF1chr14

105752713

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000256339ENST00000546474UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000256339ENST00000327359UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000256339ENST00000440513UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000392557UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000379937UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000547530UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000446501UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000379932UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000551787UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000549044UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000256339ENST00000548421UNC79chr14

94069764

+BRF1chr14

105752713

-
In-frameENST00000555664ENST00000546474UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000555664ENST00000327359UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000555664ENST00000440513UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000392557UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000379937UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000547530UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000446501UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000379932UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000551787UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000549044UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000555664ENST00000548421UNC79chr14

94069764

+BRF1chr14

105752713

-
In-frameENST00000553484ENST00000546474UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000553484ENST00000327359UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000553484ENST00000440513UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000392557UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000379937UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000547530UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000446501UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000379932UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000551787UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000549044UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000553484ENST00000548421UNC79chr14

94069764

+BRF1chr14

105752713

-
In-frameENST00000393151ENST00000546474UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000393151ENST00000327359UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-5UTRENST00000393151ENST00000440513UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000392557UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000379937UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000547530UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000446501UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000379932UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000551787UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000549044UNC79chr14

94069764

+BRF1chr14

105752713

-
5CDS-intronENST00000393151ENST00000548421UNC79chr14

94069764

+BRF1chr14

105752713

-

Top

FusionProtFeatures for UNC79_BRF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UNC79

Q9P2D8

BRF1

Q92994

Component of the NALCN sodium channel complex, a cationchannel activated either by neuropeptides substance P orneurotensin that controls neuronal excitability. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBRF1chr14:94069764chr14:105752713ENST00000327359-018185_269-54563RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000327359-01891_172-54563RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000379937-017185_269-32651RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000379937-01791_172-32651RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000392557-014185_269-298474RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000392557-01491_172-298474RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000440513-018185_269-54585RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000440513-01891_172-54585RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000446501-013185_269-92440RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000446501-01391_172-92440RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000546474-018185_26961678RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000546474-01891_17261678RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000548421-04185_26961209RepeatNote=2
TgeneBRF1chr14:94069764chr14:105752713ENST00000548421-0491_17261209RepeatNote=1
TgeneBRF1chr14:94069764chr14:105752713ENST00000327359-0182_33-54563Zinc fingerTFIIB-type
TgeneBRF1chr14:94069764chr14:105752713ENST00000379937-0172_33-32651Zinc fingerTFIIB-type
TgeneBRF1chr14:94069764chr14:105752713ENST00000392557-0142_33-298474Zinc fingerTFIIB-type
TgeneBRF1chr14:94069764chr14:105752713ENST00000440513-0182_33-54585Zinc fingerTFIIB-type
TgeneBRF1chr14:94069764chr14:105752713ENST00000446501-0132_33-92440Zinc fingerTFIIB-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUNC79chr14:94069764chr14:105752713ENST00000256339+26502223_224310742459TransmembraneHelical
HgeneUNC79chr14:94069764chr14:105752713ENST00000256339+26502466_248610742459TransmembraneHelical
HgeneUNC79chr14:94069764chr14:105752713ENST00000393151+26502223_224312512636TransmembraneHelical
HgeneUNC79chr14:94069764chr14:105752713ENST00000393151+26502466_248612512636TransmembraneHelical
HgeneUNC79chr14:94069764chr14:105752713ENST00000553484+26512223_224312512658TransmembraneHelical
HgeneUNC79chr14:94069764chr14:105752713ENST00000553484+26512466_248612512658TransmembraneHelical
TgeneBRF1chr14:94069764chr14:105752713ENST00000546474-0182_3361678Zinc fingerTFIIB-type
TgeneBRF1chr14:94069764chr14:105752713ENST00000548421-042_3361209Zinc fingerTFIIB-type


Top

FusionGeneSequence for UNC79_BRF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UNC79_ENST00000256339_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_1691aa
MISTLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPS
QVKPPAVQMLFHYWPNLKPPGAISEYRGLQYTAWNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWL
IDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVE
AVISLLKEAEFHAEQREHELNRRRQLGLSSSHHSLDNADFDNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHST
AYMMDDEVGSLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPE
WLEAIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKE
LANQRKSRVSELAGNLASRRVSVASDPGRRVQHNMLSPFHSPFQSPFRSPLRSPFRSPFKNFGHPGGRTIDFDCEDDEMNLNCFILMFDL
LLKQMELQDDGITMGLEHSLSKDIISIINNVFQAPWGGSHTCQKDEKAIECNLCQSSILCYQLACELLERLAPKEESRLVEPTDSLEDSL
LSSRPEFIIGPEGEEEENPASKHGENPGNCTEPVEHAAVKNDTERKFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGE
CLYIARKDHPQFLAYIQDHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIH
SVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFV
NRFETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPVESKRALSLPETLTSKIRAGKTP
TLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQ
VNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVK
EVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRP
KAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSI
RECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ
ASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATG

>In-frame_UNC79_ENST00000555664_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_1868aa
MSTKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSI
NPTVTRSLLYSVLRDAPSERGPQSRDAQLSDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMIS
TLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVK
PPAVQMLFHYWPNLKPPGAISEYRGLQYTAWNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDV
LLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVI
SLLKEAEFHAEQREHELNRRRQLGLSSSHHSLDNADFDNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYM
MDDEVGSLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLE
AIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKELAN
QRKSRVSELAGNLASRRVSVASDPGRRVQHNMLSPFHSPFQSPFRSPLRSPFRSPFKNFGHPGGRTIDFDCEDDEMNLNCFILMFDLLLK
QMELQDDGITMGLEHSLSKDIISIINNVFQAPWGGSHTCQKDEKAIECNLCQSSILCYQLACELLERLAPKEESRLVEPTDSLEDSLLSS
RPEFIIGPEGEEEENPASKHGENPGNCTEPVEHAAVKNDTERKFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGECLY
IARKDHPQFLAYIQDHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVT
KNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRF
ETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPVESKRALSLPETLTSKIRAGKTPTLG
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNV
YVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVI
SVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAK
GGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIREC
ISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQAST
AREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEAL

>In-frame_UNC79_ENST00000553484_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_1868aa
MSTKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSI
NPTVTRSLLYSVLRDAPSERGPQSRDAQLSDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMIS
TLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVK
PPAVQMLFHYWPNLKPPGAISEYRGLQYTAWNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDV
LLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVI
SLLKEAEFHAEQREHELNRRRQLGLSSSHHSLDNADFDNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYM
MDDEVGSLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLE
AIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKELAN
QRKSRVSELAGNLASRRVSVASDPGRRVQHNMLSPFHSPFQSPFRSPLRSPFRSPFKNFGHPGGRTIDFDCEDDEMNLNCFILMFDLLLK
QMELQDDGITMGLEHSLSKDIISIINNVFQAPWGGSHTCQKDEKAIECNLCQSSILCYQLACELLERLAPKEESRLVEPTDSLEDSLLSS
RPEFIIGPEGEEEENPASKHGENPGNCTEPVEHAAVKNDTERKFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGECLY
IARKDHPQFLAYIQDHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVT
KNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRF
ETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPVESKRALSLPETLTSKIRAGKTPTLG
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNV
YVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVI
SVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAK
GGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIREC
ISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQAST
AREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEAL

>In-frame_UNC79_ENST00000393151_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_1868aa
MSTKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSI
NPTVTRSLLYSVLRDAPSERGPQSRDAQLSDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMIS
TLATFPPFLHKDIIEYLSTSFLPMAILGSSRREGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVK
PPAVQMLFHYWPNLKPPGAISEYRGLQYTAWNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIAGDHSEWLIDV
LLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGAAAETHLYQTSPPPINTRECGAEELVCAVEAVI
SLLKEAEFHAEQREHELNRRRQLGLSSSHHSLDNADFDNKDDDKHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVAMVFQWFHSTAYM
MDDEVGSLVEKLKPQFVTKWLKTVCDVRFDVMVMCLLPKPMEFARVGGYWDKSCSTVTQLKEGLNRILCLIPYNVINQSVWECIMPEWLE
AIRTEVPDNQLKEFREVLSKMFDIELCPLPFSMEEMFGFISCRFTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVKELAN
QRKSRVSELAGNLASRRVSVASDPGRRVQHNMLSPFHSPFQSPFRSPLRSPFRSPFKNFGHPGGRTIDFDCEDDEMNLNCFILMFDLLLK
QMELQDDGITMGLEHSLSKDIISIINNVFQAPWGGSHTCQKDEKAIECNLCQSSILCYQLACELLERLAPKEESRLVEPTDSLEDSLLSS
RPEFIIGPEGEEEENPASKHGENPGNCTEPVEHAAVKNDTERKFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLKILCLHGECLY
IARKDHPQFLAYIQDHMLIASLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVT
KNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRF
ETLSLEAQLHLDCNKEFPFPTTITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPVESKRALSLPETLTSKIRAGKTPTLG
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNV
YVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVI
SVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAK
GGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIREC
ISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQAST
AREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEAL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UNC79_ENST00000256339_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_5073nt
ATGATATCAACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTG
GGCTCCTCAAGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCA
GTGTATCATTGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCA
CAAGTGAAGCCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAG
TACACAGCTTGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCC
CTGTCAGTAGCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTG
ATTGATGTTCTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGC
TTCTCAGCAGGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGG
GCCGCTGCGGAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAA
GCCGTGATCAGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCT
TCCCACCATTCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTC
TTAGTGAGCCTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACT
GCGTATATGATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTT
CGCTTCGATGTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTG
ACTCAGCTGAAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAA
TGGCTGGAAGCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGT
CCTCTGCCTTTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTG
TGGCTTCATGTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAG
CTGGCAAATCAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGA
GTTCAGCACAATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAG
AATTTTGGACACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTT
CTCCTGAAGCAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAAT
GTCTTCCAAGCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGC
TATCAGCTTGCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTC
CTTTCTTCCAGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGC
ACCGAGCCCGTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATAT
ACCATTTTCCAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAA
TGTTTATACATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAA
TCCGAGTTCTCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATC
ATAAATGGCAATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCAC
TCAGTAACCAAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTG
GCTACCAGAGCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTG
GTTAAAGACAGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTC
AATAGATTTGAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGG
ACCAATGTTGCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTG
AGGGACAGCGTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCG
ACTCTGGGTGGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGG
AACCAGCTGCAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAG
ATGGCCCACGTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAG
GTGAATGTGTACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATT
CCACGCTTTGCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGAC
TGGATGCACACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAG
GAGGTCATCAGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATT
GATGAGTTCATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAA
CAAGTCCTGTCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCA
AAGGCCAAGGGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGAC
GAGGAGCTGGAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGA
AGCCCCGAGTGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATC
CGCGAATGCATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATT
GACAGGTACATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAA
AAAGAAGCAAGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAG
GCCAGTACCGCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGC
AGCGCCGGCGGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCC
AGCAGAAGTGGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGA
GAGGCTTTGCTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCAC
GCCGACGAGGAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTAT

>In-frame_UNC79_ENST00000555664_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_5604nt
ATGTCCACCAAAGCGGAGCAGTTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCA
TCAGGAACAGATATTGCAAACACCTTGAAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGAT
GCCTCCAATTTGACAGTGCCCATGACCATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATC
AACCCTACTGTTACTCGCTCCCTCCTTTACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCA
GACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGAT
CTTGGACAGTCGATATTTTATACAACTACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCA
ACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCA
AGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCAT
TGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAG
CCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCT
TGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTA
GCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTT
CTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCA
GGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCG
GAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATC
AGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCAT
TCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGC
CTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATG
ATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGAT
GTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTG
AAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAA
GCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCT
TTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCAT
GTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAAT
CAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCAC
AATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGA
CACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAG
CAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAA
GCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTT
GCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCC
AGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCC
GTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTC
CAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATAC
ATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTC
TCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGC
AATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACC
AAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGA
GCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGAC
AGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTT
GAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTT
GCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGC
GTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGT
GGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTG
CAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCAC
GTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTG
TACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTT
GCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCAC
ACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATC
AGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTC
ATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTG
TCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAG
GGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTG
GAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAG
TGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGC
ATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTAC
ATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCA
AGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACC
GCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGC
GGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGT
GGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTG
CTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAG
GAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGAT

>In-frame_UNC79_ENST00000553484_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_5604nt
ATGTCCACCAAAGCGGAGCAGTTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCA
TCAGGAACAGATATTGCAAACACCTTGAAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGAT
GCCTCCAATTTGACAGTGCCCATGACCATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATC
AACCCTACTGTTACTCGCTCCCTCCTTTACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCA
GACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGAT
CTTGGACAGTCGATATTTTATACAACTACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCA
ACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCA
AGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCAT
TGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAG
CCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCT
TGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTA
GCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTT
CTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCA
GGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCG
GAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATC
AGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCAT
TCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGC
CTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATG
ATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGAT
GTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTG
AAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAA
GCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCT
TTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCAT
GTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAAT
CAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCAC
AATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGA
CACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAG
CAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAA
GCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTT
GCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCC
AGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCC
GTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTC
CAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATAC
ATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTC
TCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGC
AATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACC
AAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGA
GCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGAC
AGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTT
GAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTT
GCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGC
GTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGT
GGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTG
CAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCAC
GTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTG
TACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTT
GCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCAC
ACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATC
AGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTC
ATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTG
TCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAG
GGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTG
GAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAG
TGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGC
ATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTAC
ATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCA
AGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACC
GCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGC
GGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGT
GGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTG
CTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAG
GAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGAT

>In-frame_UNC79_ENST00000393151_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_5604nt
ATGTCCACCAAAGCGGAGCAGTTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCA
TCAGGAACAGATATTGCAAACACCTTGAAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGAT
GCCTCCAATTTGACAGTGCCCATGACCATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATC
AACCCTACTGTTACTCGCTCCCTCCTTTACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCA
GACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGAT
CTTGGACAGTCGATATTTTATACAACTACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCA
ACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCA
AGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCAT
TGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAG
CCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCT
TGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTA
GCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTT
CTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCA
GGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCG
GAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATC
AGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCAT
TCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGC
CTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATG
ATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGAT
GTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTG
AAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAA
GCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCT
TTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCAT
GTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAAT
CAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCAC
AATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGA
CACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAG
CAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAA
GCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTT
GCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCC
AGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCC
GTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTC
CAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATAC
ATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTC
TCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGC
AATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACC
AAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGA
GCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGAC
AGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTT
GAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTT
GCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGC
GTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGT
GGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTG
CAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCAC
GTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTG
TACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTT
GCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCAC
ACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATC
AGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTC
ATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTG
TCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAG
GGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTG
GAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAG
TGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGC
ATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTAC
ATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCA
AGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACC
GCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGC
GGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGT
GGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTG
CTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAG
GAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_UNC79_ENST00000256339_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_6993nt
ATTTTTGCTCGTCGGCTGGGAGCCGGGCGTCGGGTCGCTGGGAGTTTGCCTCTTGTGGCAGCATCCTGCTTAGTCCAGCGAATTGTGACA
CATTATTAAATGTATCAGAATATAAGAACTGTGTCACTACTACGTCACCAGATGGCCATTTCCACGAATTCATGTTTCCGTTCGGCGGCC
GGCGTCCCTCGGGTGGTCGCATGCAATGAGTGCATCTTTCTCGAGAACAACTCTTCCGCGGAAAGTCATTGCTGACAGTCCTGGCATTCC
GGTGGCTGCTTCTTGGCAGTGAGCACTTGTCTATCTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACAT
TTATCCTGTACCATCAGGAACAGATATTGCAAACACCTTGAAATACTTTTCTCAGACCTTGTTAAGCGTCCTGCGAGATGCTCCCTCAGA
ACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCAGACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACCCTCCTGGA
TCTAGTTCCTTTACTACAGCACGGCCAACACGATCTTGGACAGTCGATATTTTATACAACTACATGTTTGCTACCTTTTCTCAATGATGA
TATTCTGAGTACTTTGCCCTACACGATGATATCAACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCAC
ATCTTTTCTACCAATGGCTATATTGGGCTCCTCAAGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGAT
TGCAATGCAGTACACATCCAATCCAGTGTATCATTGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTT
GTATGTGATTGCGTATGGGCCTTCACAAGTGAAGCCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGC
AATAAGCGAGTACAGGGGGTTGCAGTACACAGCTTGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGC
TGTGAAGATGTGTATAGACCCTTCCCTGTCAGTAGCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGAT
TGCAGGGGACCACAGTGAGTGGCTGATTGATGTTCTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCA
CGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCAGGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTC
AAATCATCACAGTAATGAAGTGGGGGCCGCTGCGGAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGC
TGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATCAGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCG
GCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCATTCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCT
GCTCAGTCAATTCGGAATATGGTTCTTAGTGAGCCTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCAT
GGTGTTTCAGTGGTTTCACTCCACTGCGTATATGATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAA
ATGGCTGAAGACCGTATGTGATGTTCGCTTCGATGTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTA
CTGGGATAAGTCCTGTAGCACAGTGACTCAGCTGAAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATC
TGTCTGGGAGTGTATTATGCCGGAATGGCTGGAAGCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAG
CAAAATGTTTGACATTGAACTCTGTCCTCTGCCTTTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTC
CTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCATGTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTC
TGATGGAGTTAATTCAGTCAAAGAGCTGGCAAATCAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAG
TGTTGCCTCTGATCCTGGCCGACGAGTTCAGCACAATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCG
TAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGACACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAA
TTGTTTCATCCTCATGTTTGATCTTCTCCTGAAGCAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAA
GGACATTATTTCTATTATAAACAATGTCTTCCAAGCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAA
CTTATGTCAGTCTAGTATCCTCTGCTATCAGCTTGCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCC
CACAGACAGCCTGGAGGATAGCCTCCTTTCTTCCAGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAA
GCATGGGGAGAACCCAGGCAACTGCACCGAGCCCGTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCT
TCCGGTAACATTGAGACTAATATATACCATTTTCCAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCT
GAAGATTCTCTGTCTGCATGGAGAATGTTTATACATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGAT
TGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTCTCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCA
TGGTGCTGACATCTTCTGGACAATCATAAATGGCAATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGT
AATTTGTAGATTTCTGGATATTCACTCAGTAACCAAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGC
AGTGGAGGATGTCAACCCCGCAGTGGCTACCAGAGCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTG
TCTTGACTTCCAGTTTGATACTGTGGTTAAAGACAGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCC
TGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTTGAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTT
TCCTACAACCATCACTGCTGTGAGGACCAATGTTGCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAA
CCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGCGTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTC
CAAAATTCGTGCTGGCAAAACCCCGACTCTGGGTGGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGG
GAGGCGCCACATCCACCACCTGGGGAACCAGCTGCAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAG
CAGGCACCTGACCCGCGGCCGGAAGATGGCCCACGTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCT
CCTGGACCTCAGCGACCTGCTCCAGGTGAATGTGTACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCC
GGCCATAGACCCGTGCCTGTATATTCCACGCTTTGCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAG
GCTCCTACAGAGGATGAAGCGGGACTGGATGCACACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAAT
GCATGACTTCAGGAGGACTGTGAAGGAGGTCATCAGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGA
CACCCCCACCAGTCAGTTGACCATTGATGAGTTCATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAG
GAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTGTCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGA
GATTGAACTAGAAAACAGCCGGCCAAAGGCCAAGGGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTT
GTGTGGCGAGGAGGACACAGAGGACGAGGAGCTGGAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGC
CCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAGTGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGC
CAGCCTGGGCATCTCAGACTCCATCCGCGAATGCATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCT
CAGTGGCATTGATGACCTGGAGATTGACAGGTACATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGC
CGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCAAGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTC
TTGCAAGCGACGGGAGCCAATTCAGGCCAGTACCGCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAA
TTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGCGGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAA
GCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGTGGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCA
GCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTGCTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGT
GGAGAGCGGGCCCGTGTCATACCACGCCGACGAGGAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCT
GCAGATGATGGGCAGCAACGACTATGGCTGTGATGGCGATGAGGACGACGGCTACTGAAGTGTGGCCTCCAGGCAGGTGATGTCCTGGCA
GGGGGCCTCGCGGGTCTCCTCAGCATCAGACGGGCTTCCAGGACCGCAGCAGGCAGGCCCCAGCGCCGAGACTCCTGGTGACAGGTGGCA
CCTGTCCCACAGCCCTCGTCCCATGTGGAACTTACCATTGGGATTGTGTTTCTATTCAGCAAGGGAAACCGGACCAAGCGTCTGCATGTG
TGTGATCAGATGTGGGCCGGGTGTGTGCAGGGCTGGGTCCCGCTGCCTGCCGTCGACTCATCCAAGGACCCTCCAAGGCTGGCAGTGTGG
TGTTGCTACTATTAAGGAAACAGGCTTGGGGCAGCCCCACTGCTGGTCCAAGTGTGTGGAGGGCTGAGTGTGCTGGCCCTGTGACTCAGG
ACCAGCTCTGGAGTCTCCAGCCCACCCTCCGCACCGTCCCCTCCTGAGCAGCACTCGGCGCCAGCAGCCTCTGCCAGAGTGGAAGCCAGA
GCCCTGCAGGTGTCCGGCGCAGCCGTGGGAGCTGAGGATCTGGCACTTGAGAGGCAGCAGCTCCTTGAAGGTCCTCTGCCTCCAGCTGTG
GCCCTGCATCCAGATACCTGCCTCGTCCGAGGCAGACACCCCCACCCCTGCCTCCTCCAGACCCCCCTCCCCGCTGCCTGCACCGCCTGG
AGCAGCATGGGGGTCAGACCCCTGCTCCAGGGCCACTTGAGTTGTGGGCCCAGGAGCCCTGCGGCTGCCGGCAGGTGAACTGAGTGCCCG
ACAGCTGAGACCGGCGCCCACCCGTCCTGAGCATAGCTCTGTAGGCAGTGCGGGCATAGCCTGCATAGTGTCCTGGCGCTGGGAGTTCCC
CGTGGACAGAGCCAGAGGGCAGTGGCGCTCCCTGTCAGAGCTGGATCAGGCCCCCCATCGAGGAGGGAGGGCAGACGGAGGCCCGAGAGC
CTCCCCAGGCCTCTTCGTGGGAAGGCCCCAGTACCACTCGTAGGAGGTCTCAGCTCTGGCATGGCTGCCCCGGATGTGGCCGAGGGGGCT
TCACCCTGTGTCCTTAGGAGGGGGTGGCCTTGAGGCAGAGCCGTGCCTCACTGACCCCCAGGGGCCTCATCCTCCCCATGGAATGGGCTG
TATGTCCTGCCCCAACTTGGCCCGCAGCAGGCCAGACCCCCCTACCCCCGCCCAGAGCTCAGTAGCCAGCCTGGGTCCTGCCAGGGCTTC

>In-frame_UNC79_ENST00000555664_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_7562nt
GGACCGCAGCGCACAGGGAAGCCATGCTGAGGGTTCCTCCTGCATTTTCTTCCTCGCGGTCCTCAGGAACATCCTCGCGCCCTCCGGCCC
CGGCGCTCCAGCCCGCCCCGGATCCGCCTCCCTCTCCTTCCTCCCCGAGGTTGAGACGAAGCGTGGGACGCACCTGGGTCCCTCTCTGGT
CACCCTGCTGAGGCTCCGGGGGCTGCTCCGGGAGCAGGATTTACAGGCCCGGAGAACGCCAATGGGAGATCCAAATGGTCGGGGACTCCG
GCGCTTTAAGAGGCTTTTCTCTGGGAAACACCCGTCCCCTCCGTGCGCCTTATGAATGGAAATACTCCTCCCCCGGTCGAGCCCATTTTC
CCATTTCACCAGGAGCCGCAGCCTGCTCTCTCCTTTCGGTCTCCCCGCCCACATCAACGCGGGCAGCTCCAGGAGGGGACGGACAGGAAG
CCTTTGGCCGCCTATTAAATCCCACCCATTTCTCCGGGGGCGATTTCCTAACCTTCCGGGACCGAATTCTGCAATTTGATGTGCGTTTTG
TCCGAATGGTAGCGACACGGGCCTAAGGGAGGGGGAAAGCGAGGGGGTGGGGGGTGGGGGGTATGCACTCTTTTCCTCGCAACATCGCTG
GCGGAGCGAGGGAGCTCACACGACACAGATTTTGGGGCAAAGCCTTTCCAACTGGACAGCACCATGTCCACCAAAGCGGAGCAGTTTGCT
TCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCATCAGGAACAGATATTGCAAACACCTTG
AAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGATGCCTCCAATTTGACAGTGCCCATGACC
ATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATCAACCCTACTGTTACTCGCTCCCTCCTT
TACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCAGACTACCCTTCTTTGGACTACCAAGGC
CTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGATCTTGGACAGTCGATATTTTATACAACT
ACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCAACGTTGGCTACCTTTCCTCCATTTCTG
CACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCAAGGAGAGAAGGTGTACCTGCCCATGTT
AACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCATTGTCAATTACTGGAATGCCTCATGAAA
TATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAGCCTCCAGCTGTGCAAATGCTTTTCCAC
TACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCTTGGAATCCCATCCACTGCCAGCACATT
GAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTAGCGTTGGGTGATAAACCACCCCCGTTG
TATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTTCTTCTGCCACAAGCTGAAATATCTGCT
ATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCAGGGTGCTGTGGTCGTCACGGAAACAGG
CCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCGGAGACTCACCTCTATCAGACCTCTCCT
CCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATCAGCTTGTTGAAAGAAGCCGAGTTCCAT
GCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCATTCCCTGGATAATGCTGACTTTGATAAC
AAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGCCTCTGCACACCCAGTGAGAACACGCCT
ACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATGATGGATGATGAAGTGGGAAGTCTGGTG
GAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGATGTCATGGTCATGTGCCTTCTTCCTAAA
CCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTGAAGGAAGGTCTCAACCGAATCCTCTGC
CTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAAGCCATCAGAACAGAAGTCCCAGATAAT
CAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCTTTCTCAATGGAGGAGATGTTTGGTTTT
ATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCATGTATTATCGGAGTTAGATATCATGGTT
CCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAATCAAAGAAAATCAAGAGTCAGTGAACTG
GCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCACAATATGCTTAGTCCATTTCATAGTCCT
TTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGACACCCAGGAGGAAGGACTATTGACTTT
GATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAGCAGATGGAGTTACAAGATGATGGAATC
ACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAAGCCCCCTGGGGGGGATCCCACACCTGC
CAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTTGCTTGTGAACTCCTGGAGAGACTAGCT
CCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCCAGACCAGAGTTTATCATAGGCCCTGAA
GGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCCGTGGAACATGCTGCAGTAAAGAATGAT
ACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTCCAGGAAATGGCTAAGTTTGAAGAGCCA
GACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATACATTGCCAGAAAAGATCACCCTCAATTT
TTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTCTCTCAGCTGTCTTCCCTGGCAGTCCCT
CTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGCAATTTCAACAGCAAAGACTGGAAGATG
AGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACCAAAAACCACCTGCTGAAGTACTCCCTG
GCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGAGCTGGTCTCCTGCTTGACACCATAAAG
AGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGACAGACCCACAATTTTGAGCAAGCTTTTA
CTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTTGAGACGCTTTCTTTGGAAGCCCAGCTA
CATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTTGCTAACCTCAGCGATGCAGCCTTATGG
AAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGCGTGAAAGGGCCTGTGGAATCCAAGAGG
GCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGTGGCGGCTTCCACGTGAATCTGGGGAAG
GAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTGCAGCTGAACCAGCACTGCCTGGACACC
GCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCACGTGATTGCTGCCTGCCTCTACCTGGTC
TGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTGTACGTGCTTGGAAAGACGTTTCTTCTC
TTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTTGCGCACCTGCTGGAATTCGGGGAGAAG
AACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCACACAGGCCGGCGCCCCTCGGGCCTCTGC
GGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATCAGTGTGGTCAAAGTGTGTGAGTCCACG
CTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTCATGAAGATCGACCTGGAGGAGGAGTGC
GACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTGTCAAAAAAACTGGAGGAGGTTGAAGGT
GAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAGGGGGGCCTGGCCAGCCTGGCAAAAGAT
GGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTGGAAGCCGCGGCCAGCCACCTGAACAAA
GACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAGTGGGGCGGCAGACCTCCGGCCCTGGGG
TCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGCATCTCCTCTCAGAGCAGCGACCCCAAA
GATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTACATCCTGAATGAGTCGGAAGCCCGCGTG
AAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCAAGAATAGCGAAAGAGAAGGAGCTCGGC
ATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACCGCCAGGGAGGCCATCGAGAAGATGCTG
GAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGCGGGGGCAGTCCGCACAGGGAGGATGCA
CAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGTGGGGCTGACCCTGTGACCAGTGTGGGG
AAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTGCTCCCAAGCTCTCCCACCCTCGGAGCT
GAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAGGAGGCTGACGAGGAGGAGCCTGACGAG
GAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGATGGCGATGAGGACGACGGCTACTGAAGT
GTGGCCTCCAGGCAGGTGATGTCCTGGCAGGGGGCCTCGCGGGTCTCCTCAGCATCAGACGGGCTTCCAGGACCGCAGCAGGCAGGCCCC
AGCGCCGAGACTCCTGGTGACAGGTGGCACCTGTCCCACAGCCCTCGTCCCATGTGGAACTTACCATTGGGATTGTGTTTCTATTCAGCA
AGGGAAACCGGACCAAGCGTCTGCATGTGTGTGATCAGATGTGGGCCGGGTGTGTGCAGGGCTGGGTCCCGCTGCCTGCCGTCGACTCAT
CCAAGGACCCTCCAAGGCTGGCAGTGTGGTGTTGCTACTATTAAGGAAACAGGCTTGGGGCAGCCCCACTGCTGGTCCAAGTGTGTGGAG
GGCTGAGTGTGCTGGCCCTGTGACTCAGGACCAGCTCTGGAGTCTCCAGCCCACCCTCCGCACCGTCCCCTCCTGAGCAGCACTCGGCGC
CAGCAGCCTCTGCCAGAGTGGAAGCCAGAGCCCTGCAGGTGTCCGGCGCAGCCGTGGGAGCTGAGGATCTGGCACTTGAGAGGCAGCAGC
TCCTTGAAGGTCCTCTGCCTCCAGCTGTGGCCCTGCATCCAGATACCTGCCTCGTCCGAGGCAGACACCCCCACCCCTGCCTCCTCCAGA
CCCCCCTCCCCGCTGCCTGCACCGCCTGGAGCAGCATGGGGGTCAGACCCCTGCTCCAGGGCCACTTGAGTTGTGGGCCCAGGAGCCCTG
CGGCTGCCGGCAGGTGAACTGAGTGCCCGACAGCTGAGACCGGCGCCCACCCGTCCTGAGCATAGCTCTGTAGGCAGTGCGGGCATAGCC
TGCATAGTGTCCTGGCGCTGGGAGTTCCCCGTGGACAGAGCCAGAGGGCAGTGGCGCTCCCTGTCAGAGCTGGATCAGGCCCCCCATCGA
GGAGGGAGGGCAGACGGAGGCCCGAGAGCCTCCCCAGGCCTCTTCGTGGGAAGGCCCCAGTACCACTCGTAGGAGGTCTCAGCTCTGGCA
TGGCTGCCCCGGATGTGGCCGAGGGGGCTTCACCCTGTGTCCTTAGGAGGGGGTGGCCTTGAGGCAGAGCCGTGCCTCACTGACCCCCAG
GGGCCTCATCCTCCCCATGGAATGGGCTGTATGTCCTGCCCCAACTTGGCCCGCAGCAGGCCAGACCCCCCTACCCCCGCCCAGAGCTCA
GTAGCCAGCCTGGGTCCTGCCAGGGCTTCTCGAGGGCTTGGGGGAAGAATAGATTTAGTAAAGCAGGAAGATCTGTTGTTACTTAACAGA

>In-frame_UNC79_ENST00000553484_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_7023nt
GTCCGAATGGTAGCGACACGGGCCTAAGGGAGGGGGAAAGCGAGGGGGTGGGGGGTGGGGGGTATGCACTCTTTTCCTCGCAACATCGCT
GGCGGAGCGAGGGAGCTCACACGACACAGATTTTGGGGCAAAGCCTTTCCAACTGGACAGCACCATGTCCACCAAAGCGGAGCAGTTTGC
TTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCATCAGGAACAGATATTGCAAACACCTT
GAAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGATGCCTCCAATTTGACAGTGCCCATGAC
CATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATCAACCCTACTGTTACTCGCTCCCTCCT
TTACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCAGACTACCCTTCTTTGGACTACCAAGG
CCTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGATCTTGGACAGTCGATATTTTATACAAC
TACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCAACGTTGGCTACCTTTCCTCCATTTCT
GCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCAAGGAGAGAAGGTGTACCTGCCCATGT
TAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCATTGTCAATTACTGGAATGCCTCATGAA
ATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAGCCTCCAGCTGTGCAAATGCTTTTCCA
CTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCTTGGAATCCCATCCACTGCCAGCACAT
TGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTAGCGTTGGGTGATAAACCACCCCCGTT
GTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTTCTTCTGCCACAAGCTGAAATATCTGC
TATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCAGGGTGCTGTGGTCGTCACGGAAACAG
GCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCGGAGACTCACCTCTATCAGACCTCTCC
TCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATCAGCTTGTTGAAAGAAGCCGAGTTCCA
TGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCATTCCCTGGATAATGCTGACTTTGATAA
CAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGCCTCTGCACACCCAGTGAGAACACGCC
TACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATGATGGATGATGAAGTGGGAAGTCTGGT
GGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGATGTCATGGTCATGTGCCTTCTTCCTAA
ACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTGAAGGAAGGTCTCAACCGAATCCTCTG
CCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAAGCCATCAGAACAGAAGTCCCAGATAA
TCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCTTTCTCAATGGAGGAGATGTTTGGTTT
TATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCATGTATTATCGGAGTTAGATATCATGGT
TCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAATCAAAGAAAATCAAGAGTCAGTGAACT
GGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCACAATATGCTTAGTCCATTTCATAGTCC
TTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGACACCCAGGAGGAAGGACTATTGACTT
TGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAGCAGATGGAGTTACAAGATGATGGAAT
CACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAAGCCCCCTGGGGGGGATCCCACACCTG
CCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTTGCTTGTGAACTCCTGGAGAGACTAGC
TCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCCAGACCAGAGTTTATCATAGGCCCTGA
AGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCCGTGGAACATGCTGCAGTAAAGAATGA
TACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTCCAGGAAATGGCTAAGTTTGAAGAGCC
AGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATACATTGCCAGAAAAGATCACCCTCAATT
TTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTCTCTCAGCTGTCTTCCCTGGCAGTCCC
TCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGCAATTTCAACAGCAAAGACTGGAAGAT
GAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACCAAAAACCACCTGCTGAAGTACTCCCT
GGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGAGCTGGTCTCCTGCTTGACACCATAAA
GAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGACAGACCCACAATTTTGAGCAAGCTTTT
ACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTTGAGACGCTTTCTTTGGAAGCCCAGCT
ACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTTGCTAACCTCAGCGATGCAGCCTTATG
GAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGCGTGAAAGGGCCTGTGGAATCCAAGAG
GGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGTGGCGGCTTCCACGTGAATCTGGGGAA
GGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTGCAGCTGAACCAGCACTGCCTGGACAC
CGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCACGTGATTGCTGCCTGCCTCTACCTGGT
CTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTGTACGTGCTTGGAAAGACGTTTCTTCT
CTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTTGCGCACCTGCTGGAATTCGGGGAGAA
GAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCACACAGGCCGGCGCCCCTCGGGCCTCTG
CGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATCAGTGTGGTCAAAGTGTGTGAGTCCAC
GCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTCATGAAGATCGACCTGGAGGAGGAGTG
CGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTGTCAAAAAAACTGGAGGAGGTTGAAGG
TGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAGGGGGGCCTGGCCAGCCTGGCAAAAGA
TGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTGGAAGCCGCGGCCAGCCACCTGAACAA
AGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAGTGGGGCGGCAGACCTCCGGCCCTGGG
GTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGCATCTCCTCTCAGAGCAGCGACCCCAA
AGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTACATCCTGAATGAGTCGGAAGCCCGCGT
GAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCAAGAATAGCGAAAGAGAAGGAGCTCGG
CATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACCGCCAGGGAGGCCATCGAGAAGATGCT
GGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGCGGGGGCAGTCCGCACAGGGAGGATGC
ACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGTGGGGCTGACCCTGTGACCAGTGTGGG
GAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTGCTCCCAAGCTCTCCCACCCTCGGAGC
TGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAGGAGGCTGACGAGGAGGAGCCTGACGA
GGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGATGGCGATGAGGACGACGGCTACTGAAG
TGTGGCCTCCAGGCAGGTGATGTCCTGGCAGGGGGCCTCGCGGGTCTCCTCAGCATCAGACGGGCTTCCAGGACCGCAGCAGGCAGGCCC
CAGCGCCGAGACTCCTGGTGACAGGTGGCACCTGTCCCACAGCCCTCGTCCCATGTGGAACTTACCATTGGGATTGTGTTTCTATTCAGC
AAGGGAAACCGGACCAAGCGTCTGCATGTGTGTGATCAGATGTGGGCCGGGTGTGTGCAGGGCTGGGTCCCGCTGCCTGCCGTCGACTCA
TCCAAGGACCCTCCAAGGCTGGCAGTGTGGTGTTGCTACTATTAAGGAAACAGGCTTGGGGCAGCCCCACTGCTGGTCCAAGTGTGTGGA
GGGCTGAGTGTGCTGGCCCTGTGACTCAGGACCAGCTCTGGAGTCTCCAGCCCACCCTCCGCACCGTCCCCTCCTGAGCAGCACTCGGCG
CCAGCAGCCTCTGCCAGAGTGGAAGCCAGAGCCCTGCAGGTGTCCGGCGCAGCCGTGGGAGCTGAGGATCTGGCACTTGAGAGGCAGCAG
CTCCTTGAAGGTCCTCTGCCTCCAGCTGTGGCCCTGCATCCAGATACCTGCCTCGTCCGAGGCAGACACCCCCACCCCTGCCTCCTCCAG
ACCCCCCTCCCCGCTGCCTGCACCGCCTGGAGCAGCATGGGGGTCAGACCCCTGCTCCAGGGCCACTTGAGTTGTGGGCCCAGGAGCCCT
GCGGCTGCCGGCAGGTGAACTGAGTGCCCGACAGCTGAGACCGGCGCCCACCCGTCCTGAGCATAGCTCTGTAGGCAGTGCGGGCATAGC
CTGCATAGTGTCCTGGCGCTGGGAGTTCCCCGTGGACAGAGCCAGAGGGCAGTGGCGCTCCCTGTCAGAGCTGGATCAGGCCCCCCATCG
AGGAGGGAGGGCAGACGGAGGCCCGAGAGCCTCCCCAGGCCTCTTCGTGGGAAGGCCCCAGTACCACTCGTAGGAGGTCTCAGCTCTGGC
ATGGCTGCCCCGGATGTGGCCGAGGGGGCTTCACCCTGTGTCCTTAGGAGGGGGTGGCCTTGAGGCAGAGCCGTGCCTCACTGACCCCCA
GGGGCCTCATCCTCCCCATGGAATGGGCTGTATGTCCTGCCCCAACTTGGCCCGCAGCAGGCCAGACCCCCCTACCCCCGCCCAGAGCTC
AGTAGCCAGCCTGGGTCCTGCCAGGGCTTCTCGAGGGCTTGGGGGAAGAATAGATTTAGTAAAGCAGGAAGATCTGTTGTTACTTAACAG

>In-frame_UNC79_ENST00000393151_chr14_94069764_+_BRF1_ENST00000546474_chr14_105752713_-_6869nt
ATGTCCACCAAAGCGGAGCAGTTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGGGTTCTCCACAACATTTATCCTGTACCA
TCAGGAACAGATATTGCAAACACCTTGAAATACTTTTCTCAGACCTTGTTAAGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGAT
GCCTCCAATTTGACAGTGCCCATGACCATGTGTCTTTTTCCTGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATC
AACCCTACTGTTACTCGCTCCCTCCTTTACAGCGTCCTGCGAGATGCTCCCTCAGAACGCGGCCCGCAAAGTCGTGATGCTCAGTTGTCA
GACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACCCTCCTGGATCTAGTTCCTTTACTACAGCACGGCCAACACGAT
CTTGGACAGTCGATATTTTATACAACTACATGTTTGCTACCTTTTCTCAATGATGATATTCTGAGTACTTTGCCCTACACGATGATATCA
ACGTTGGCTACCTTTCCTCCATTTCTGCACAAGGATATCATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGCTCCTCA
AGGAGAGAAGGTGTACCTGCCCATGTTAACCTCTCTGCATCATCCATGCTAATGATTGCAATGCAGTACACATCCAATCCAGTGTATCAT
TGTCAATTACTGGAATGCCTCATGAAATATAAACAAGAAGTCTGGAAAGATCTTTTGTATGTGATTGCGTATGGGCCTTCACAAGTGAAG
CCTCCAGCTGTGCAAATGCTTTTCCACTACTGGCCCAATTTAAAACCTCCTGGGGCAATAAGCGAGTACAGGGGGTTGCAGTACACAGCT
TGGAATCCCATCCACTGCCAGCACATTGAATGCCACAATGCAATTAACAAACCAGCTGTGAAGATGTGTATAGACCCTTCCCTGTCAGTA
GCGTTGGGTGATAAACCACCCCCGTTGTATCTCTGTGAAGAATGCAGCGAGAGGATTGCAGGGGACCACAGTGAGTGGCTGATTGATGTT
CTTCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAAAGAACTGCAGTTCCCACGTTAGAAGAGCAGTTGTCACCTGCTTCTCAGCA
GGGTGCTGTGGTCGTCACGGAAACAGGCCTGTTCGGTACTGCAAGAGGTGCCACTCAAATCATCACAGTAATGAAGTGGGGGCCGCTGCG
GAGACTCACCTCTATCAGACCTCTCCTCCGCCCATCAACACGCGGGAATGCGGCGCTGAGGAGCTGGTCTGCGCCGTGGAAGCCGTGATC
AGCTTGTTGAAAGAAGCCGAGTTCCATGCTGAGCAGCGAGAACATGAGCTGAACCGGCGGCGGCAGCTGGGCCTCTCCTCTTCCCACCAT
TCCCTGGATAATGCTGACTTTGATAACAAGGACGATGATAAACACGATCAGAGGCTGCTCAGTCAATTCGGAATATGGTTCTTAGTGAGC
CTCTGCACACCCAGTGAGAACACGCCTACAGAAAGCTTGGCCCGGCTGGTGGCCATGGTGTTTCAGTGGTTTCACTCCACTGCGTATATG
ATGGATGATGAAGTGGGAAGTCTGGTGGAAAAGCTGAAGCCTCAGTTTGTCACCAAATGGCTGAAGACCGTATGTGATGTTCGCTTCGAT
GTCATGGTCATGTGCCTTCTTCCTAAACCCATGGAATTTGCCAGGGTTGGTGGCTACTGGGATAAGTCCTGTAGCACAGTGACTCAGCTG
AAGGAAGGTCTCAACCGAATCCTCTGCCTGATCCCCTATAATGTGATCAATCAATCTGTCTGGGAGTGTATTATGCCGGAATGGCTGGAA
GCCATCAGAACAGAAGTCCCAGATAATCAGTTAAAAGAATTCAGGGAAGTATTAAGCAAAATGTTTGACATTGAACTCTGTCCTCTGCCT
TTCTCAATGGAGGAGATGTTTGGTTTTATTAGTTGTCGGTTTACAGGATACCCCTCCTCTGTGCAGGAGCAAGCTTTACTGTGGCTTCAT
GTATTATCGGAGTTAGATATCATGGTTCCACTTCAACTACTAATAAGTATGTTTTCTGATGGAGTTAATTCAGTCAAAGAGCTGGCAAAT
CAAAGAAAATCAAGAGTCAGTGAACTGGCAGGGAACCTTGCATCTCGAAGGGTGAGTGTTGCCTCTGATCCTGGCCGACGAGTTCAGCAC
AATATGCTTAGTCCATTTCATAGTCCTTTCCAGAGTCCGTTTCGGAGTCCTTTGCGTAGTCCGTTTCGTAGCCCTTTCAAGAATTTTGGA
CACCCAGGAGGAAGGACTATTGACTTTGATTGTGAAGATGATGAAATGAATCTAAATTGTTTCATCCTCATGTTTGATCTTCTCCTGAAG
CAGATGGAGTTACAAGATGATGGAATCACGATGGGTTTAGAGCACAGCTTATCAAAGGACATTATTTCTATTATAAACAATGTCTTCCAA
GCCCCCTGGGGGGGATCCCACACCTGCCAGAAGGACGAAAAAGCAATCGAGTGCAACTTATGTCAGTCTAGTATCCTCTGCTATCAGCTT
GCTTGTGAACTCCTGGAGAGACTAGCTCCTAAAGAAGAAAGCCGGCTGGTGGAGCCCACAGACAGCCTGGAGGATAGCCTCCTTTCTTCC
AGACCAGAGTTTATCATAGGCCCTGAAGGGGAGGAGGAGGAGAATCCTGCAAGCAAGCATGGGGAGAACCCAGGCAACTGCACCGAGCCC
GTGGAACATGCTGCAGTAAAGAATGATACCGAAAGAAAATTTTGCTACCAACAGCTTCCGGTAACATTGAGACTAATATATACCATTTTC
CAGGAAATGGCTAAGTTTGAAGAGCCAGACATTCTTTTTAATATGCTCAATTGCCTGAAGATTCTCTGTCTGCATGGAGAATGTTTATAC
ATTGCCAGAAAAGATCACCCTCAATTTTTAGCCTACATTCAGGACCACATGTTGATTGCAAGCCTGTGGAGGGTCGTCAAATCCGAGTTC
TCTCAGCTGTCTTCCCTGGCAGTCCCTCTTCTCCTCCATGCCCTGTCACTTCCTCATGGTGCTGACATCTTCTGGACAATCATAAATGGC
AATTTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTTGCTGTAATTTGTAGATTTCTGGATATTCACTCAGTAACC
AAAAACCACCTGCTGAAGTACTCCCTGGCACATGCCTTCTGCTGCTTCCTGACAGCAGTGGAGGATGTCAACCCCGCAGTGGCTACCAGA
GCTGGTCTCCTGCTTGACACCATAAAGAGGCCAGCATTGCAGGGTCTATGTCTTTGTCTTGACTTCCAGTTTGATACTGTGGTTAAAGAC
AGACCCACAATTTTGAGCAAGCTTTTACTCTTGCACTTTCTTAAGCAGGATATTCCTGCTCTGAGCTGGGAGTTCTTTGTCAATAGATTT
GAGACGCTTTCTTTGGAAGCCCAGCTACATTTGGATTGTAACAAGGAATTTCCTTTTCCTACAACCATCACTGCTGTGAGGACCAATGTT
GCTAACCTCAGCGATGCAGCCTTATGGAAGATCAAGAGAGCTCGCTTTGCAAGAAACCGCCAGAAGAGTGTACGTTCCCTGAGGGACAGC
GTGAAAGGGCCTGTGGAATCCAAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATTCGTGCTGGCAAAACCCCGACTCTGGGT
GGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCCACCACCTGGGGAACCAGCTG
CAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGCCGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCAC
GTGATTGCTGCCTGCCTCTACCTGGTCTGCCGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTG
TACGTGCTTGGAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATATTCCACGCTTT
GCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTCCTACAGAGGATGAAGCGGGACTGGATGCAC
ACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCCTGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATC
AGTGTGGTCAAAGTGTGTGAGTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTC
ATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGAAGCAGCTTGAACAAGTCCTG
TCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGCAATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAG
GGGGGCCTGGCCAGCCTGGCAAAAGATGGCTCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTG
GAAGCCGCGGCCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGGAAGCCCCGAG
TGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGCCTGGGCATCTCAGACTCCATCCGCGAATGC
ATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAGACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTAC
ATCCTGAATGAGTCGGAAGCCCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCA
AGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGGAGCCAATTCAGGCCAGTACC
GCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAAGATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGC
GGGGGCAGTCCGCACAGGGAGGATGCACAGCCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGT
GGGGCTGACCCTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGGAGAGGCTTTG
CTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAGAGCGGGCCCGTGTCATACCACGCCGACGAG
GAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGCCCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGAT
GGCGATGAGGACGACGGCTACTGAAGTGTGGCCTCCAGGCAGGTGATGTCCTGGCAGGGGGCCTCGCGGGTCTCCTCAGCATCAGACGGG
CTTCCAGGACCGCAGCAGGCAGGCCCCAGCGCCGAGACTCCTGGTGACAGGTGGCACCTGTCCCACAGCCCTCGTCCCATGTGGAACTTA
CCATTGGGATTGTGTTTCTATTCAGCAAGGGAAACCGGACCAAGCGTCTGCATGTGTGTGATCAGATGTGGGCCGGGTGTGTGCAGGGCT
GGGTCCCGCTGCCTGCCGTCGACTCATCCAAGGACCCTCCAAGGCTGGCAGTGTGGTGTTGCTACTATTAAGGAAACAGGCTTGGGGCAG
CCCCACTGCTGGTCCAAGTGTGTGGAGGGCTGAGTGTGCTGGCCCTGTGACTCAGGACCAGCTCTGGAGTCTCCAGCCCACCCTCCGCAC
CGTCCCCTCCTGAGCAGCACTCGGCGCCAGCAGCCTCTGCCAGAGTGGAAGCCAGAGCCCTGCAGGTGTCCGGCGCAGCCGTGGGAGCTG
AGGATCTGGCACTTGAGAGGCAGCAGCTCCTTGAAGGTCCTCTGCCTCCAGCTGTGGCCCTGCATCCAGATACCTGCCTCGTCCGAGGCA
GACACCCCCACCCCTGCCTCCTCCAGACCCCCCTCCCCGCTGCCTGCACCGCCTGGAGCAGCATGGGGGTCAGACCCCTGCTCCAGGGCC
ACTTGAGTTGTGGGCCCAGGAGCCCTGCGGCTGCCGGCAGGTGAACTGAGTGCCCGACAGCTGAGACCGGCGCCCACCCGTCCTGAGCAT
AGCTCTGTAGGCAGTGCGGGCATAGCCTGCATAGTGTCCTGGCGCTGGGAGTTCCCCGTGGACAGAGCCAGAGGGCAGTGGCGCTCCCTG
TCAGAGCTGGATCAGGCCCCCCATCGAGGAGGGAGGGCAGACGGAGGCCCGAGAGCCTCCCCAGGCCTCTTCGTGGGAAGGCCCCAGTAC
CACTCGTAGGAGGTCTCAGCTCTGGCATGGCTGCCCCGGATGTGGCCGAGGGGGCTTCACCCTGTGTCCTTAGGAGGGGGTGGCCTTGAG
GCAGAGCCGTGCCTCACTGACCCCCAGGGGCCTCATCCTCCCCATGGAATGGGCTGTATGTCCTGCCCCAACTTGGCCCGCAGCAGGCCA
GACCCCCCTACCCCCGCCCAGAGCTCAGTAGCCAGCCTGGGTCCTGCCAGGGCTTCTCGAGGGCTTGGGGGAAGAATAGATTTAGTAAAG


Top

FusionGenePPI for UNC79_BRF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UNC79YWHAQ, SAE1, UBCBRF1GTF3C5, GTF3C3, RB1, CSNK2A1, CSNK2A2, TP53, TBP, RBL1, RBL2, PCBD2, DTNBP1, APP, UBC, ACSL4, TCF20, CCDC132, POLR3E, RHOU


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UNC79_BRF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UNC79_BRF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneBRF1C4015495CEREBELLOFACIODENTAL SYNDROME1ORPHANET;UNIPROT