FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4082

FusionGeneSummary for BCR_ARVCF

check button Fusion gene summary
Fusion gene informationFusion gene name: BCR_ARVCF
Fusion gene ID: 4082
HgeneTgene
Gene symbol

BCR

ARVCF

Gene ID

613

421

Gene nameBCR, RhoGEF and GTPase activating proteinARVCF, delta catenin family member
SynonymsALL|BCR1|CML|D22S11|D22S662|PHL-
Cytomap

22q11.23

22q11.21

Type of geneprotein-codingprotein-coding
Descriptionbreakpoint cluster region proteinBCR/FGFR1 chimera proteinFGFR1/BCR chimera proteinbreakpoint cluster regionrenal carcinoma antigen NY-REN-26armadillo repeat protein deleted in velo-cardio-facial syndromearmadillo repeat gene deleted in velocardiofacial syndrome
Modification date2018052720180523
UniProtAcc

P11274

O00192

Ensembl transtripts involved in fusion geneENST00000305877, ENST00000359540, 
ENST00000398512, ENST00000436990, 
ENST00000263207, ENST00000344269, 
ENST00000406522, ENST00000401994, 
ENST00000406259, ENST00000487793, 
Fusion gene scores* DoF score17 X 39 X 8=53042 X 2 X 2=8
# samples 703
** MAII scorelog2(70/5304*10)=-2.92165394828026
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/8*10)=1.90689059560852
Context

PubMed: BCR [Title/Abstract] AND ARVCF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-A6-5657-01ABCRchr22

23615961

+ARVCFchr22

19969614

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000305877ENST00000263207BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000305877ENST00000344269BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000305877ENST00000406522BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000305877ENST00000401994BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000305877ENST00000406259BCRchr22

23615961

+ARVCFchr22

19969614

-
5CDS-5UTRENST00000305877ENST00000487793BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000359540ENST00000263207BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000359540ENST00000344269BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000359540ENST00000406522BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000359540ENST00000401994BCRchr22

23615961

+ARVCFchr22

19969614

-
In-frameENST00000359540ENST00000406259BCRchr22

23615961

+ARVCFchr22

19969614

-
5CDS-5UTRENST00000359540ENST00000487793BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000398512ENST00000263207BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000398512ENST00000344269BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000398512ENST00000406522BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000398512ENST00000401994BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000398512ENST00000406259BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-5UTRENST00000398512ENST00000487793BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000436990ENST00000263207BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000436990ENST00000344269BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000436990ENST00000406522BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000436990ENST00000401994BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-3CDSENST00000436990ENST00000406259BCRchr22

23615961

+ARVCFchr22

19969614

-
intron-5UTRENST00000436990ENST00000487793BCRchr22

23615961

+ARVCFchr22

19969614

-

Top

FusionProtFeatures for BCR_ARVCF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCR

P11274

ARVCF

O00192

GTPase-activating protein for RAC1 and CDC42. Promotesthe exchange of RAC or CDC42-bound GDP by GTP, thereby activatingthem. Displays serine/threonine kinase activity.{ECO:0000269|PubMed:1657398, ECO:0000269|PubMed:1903516}. Involved in protein-protein interactions at adherensjunctions.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+823498_6917051272DomainDH
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+822498_6917051228DomainDH
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+823197_3857051272RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+8231_4267051272RegionNote=Kinase
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+822197_3857051228RegionNote=Binding to ABL SH2-domain
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+8221_4267051228RegionNote=Kinase
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-0188_4671162Coiled coilOntology_term=ECO:0000255
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-0178_467900Coiled coilOntology_term=ECO:0000255
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220608_611701194Compositional biasNote=Poly-Arg
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018608_61171162Compositional biasNote=Poly-Arg
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017608_6117900Compositional biasNote=Poly-Arg
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220607_623701194MotifNuclear localization signal
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018607_62371162MotifNuclear localization signal
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017607_6237900MotifNuclear localization signal
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220348_387701194RepeatNote=ARM 1
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220390_429701194RepeatNote=ARM 2
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220433_467701194RepeatNote=ARM 3
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220468_508701194RepeatNote=ARM 4
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220526_565701194RepeatNote=ARM 5
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220575_622701194RepeatNote=ARM 6
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220646_686701194RepeatNote=ARM 7
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220699_738701194RepeatNote=ARM 8
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220739_781701194RepeatNote=ARM 9
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-220782_826701194RepeatNote=ARM 10
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018348_38771162RepeatNote=ARM 1
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018390_42971162RepeatNote=ARM 2
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018433_46771162RepeatNote=ARM 3
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018468_50871162RepeatNote=ARM 4
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018526_56571162RepeatNote=ARM 5
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018575_62271162RepeatNote=ARM 6
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018646_68671162RepeatNote=ARM 7
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018699_73871162RepeatNote=ARM 8
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018739_78171162RepeatNote=ARM 9
TgeneARVCFchr22:23615961chr22:19969614ENST00000344269-018782_82671162RepeatNote=ARM 10
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017348_3877900RepeatNote=ARM 1
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017390_4297900RepeatNote=ARM 2
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017433_4677900RepeatNote=ARM 3
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017468_5087900RepeatNote=ARM 4
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017526_5657900RepeatNote=ARM 5
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017575_6227900RepeatNote=ARM 6
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017646_6867900RepeatNote=ARM 7
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017699_7387900RepeatNote=ARM 8
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017739_7817900RepeatNote=ARM 9
TgeneARVCFchr22:23615961chr22:19969614ENST00000401994-017782_8267900RepeatNote=ARM 10

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+823824_8277051272Compositional biasNote=Poly-Leu
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+822824_8277051228Compositional biasNote=Poly-Leu
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+8231054_12487051272DomainRho-GAP
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+823708_8667051272DomainPH
HgeneBCRchr22:23615961chr22:19969614ENST00000305877+823870_10027051272DomainC2
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+8221054_12487051228DomainRho-GAP
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+822708_8667051228DomainPH
HgeneBCRchr22:23615961chr22:19969614ENST00000359540+822870_10027051228DomainC2
TgeneARVCFchr22:23615961chr22:19969614ENST00000263207-2208_46701194Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for BCR_ARVCF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_1598aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEE
WFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLV
ELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPA
LVALVASSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDA

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_705aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_1592aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGK
KDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSE
TDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPALVALVA
SSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGY

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_1598aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEE
WFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLV
ELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPA
LVALVASSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDA

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_1592aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGK
KDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSE
TDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPALVALVA
SSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGY

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_1598aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEE
WFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLV
ELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPA
LVALVASSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_705aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_1592aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGK
KDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSE
TDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPALVALVA
SSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGY

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_1598aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKEE
WFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLV
ELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPA
LVALVASSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_1592aa
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSTDRQRWGFRRAAQAPDGASEP
RASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPP
WPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGTTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQ
DGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFTDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDA
KDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEEQSPGSQASLATMPE
APDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRTETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPV
ATLSRAYLSSGGGFPEGPEPRDSPSTGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGPEPGPPGGRSLPERFQAEPTGLEDDT
RSLAADDEGGPELEPDTGTATRRRPECGRGLHTRAYEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRW
RDPELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRACGALRNLSTGRDTDNKAAIRDCGGV
PALVRLLRAARDNEVRELVTGTLWNLSSTEPLKMVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAE
ARRRLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPLGSAVGSQRRRRDDASCFGGKKAKGK
KDGEMDRNFDTLDLPKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQSE
TDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPALVALVA
SSQSVREAKAASHVLQTVWSYKELRGTLQKDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_4794nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAG
TGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTT
GAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGC
GCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTG
GAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTC
ATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACC
GTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCG
TTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTG
CGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCT
GGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCG
CTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCC
TTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_2115nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_4776nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAG
AAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCC
GAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGT
GCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAG
ACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATG
GCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAAC
ACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCC
TCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAA
GATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGC
ACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATAC
TCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGC
AGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGG

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_4794nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAG
TGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTT
GAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGC
GCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTG
GAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTC
ATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACC
GTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCG
TTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTG
CGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCT
GGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCG
CTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCC
TTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_4776nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAG
AAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCC
GAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGT
GCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAG
ACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATG
GCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAAC
ACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCC
TCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAA
GATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGC
ACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATAC
TCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGC
AGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_4794nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAG
TGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTT
GAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGC
GCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTG
GAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTC
ATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACC
GTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCG
TTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTG
CGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCT
GGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCG
CTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCC
TTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_2115nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_4776nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAG
AAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCC
GAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGT
GCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAG
ACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATG
GCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAAC
ACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCC
TCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAA
GATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGC
ACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATAC
TCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGC
AGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_4794nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAG
TGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTT
GAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGC
GCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTG
GAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTC
ATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACC
GTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCG
TTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTG
CGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCT
GGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCG
CTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCC
TTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCT

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_4776nt
ATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGAC
ATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAG
ACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCC
CGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAG
GGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGC
GTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTC
GAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATG
GAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGC
GGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCT
TGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAG
AGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCG
GACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTAC
CGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAG
CGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGC
GCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAA
GATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGA
GCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAG
GAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGT
CAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAG
TGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTT
GCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCC
AAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTG
CTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAG
GAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAG
GCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGC
ACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGA
CTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTG
GCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCC
CGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCC
TTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACG
CGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGC
CTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTG
GCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGG
CGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTG
TGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAG
GTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTG
CCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAG
CCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAAC
GAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAG
GCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAAC
AAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCC
GAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAG
AAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCC
GAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGT
GCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAG
ACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATG
GCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAAC
ACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCC
TCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAA
GATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGC
ACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATAC
TCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGC
AGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_6405nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGG
CAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTC
CCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGAC
AGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCG
GCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCC
CCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGG
CTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCA
GGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGC
CACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCG
GCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTC
AGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAA
GGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCT
TGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAA
CAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCAC
TGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGT
GCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTG
CCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCA
GTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGA
GGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAG
CTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCT
GCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCG
GAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGT
GCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAA
CCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCC
GCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCG
CTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGT
GCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTAC
TGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAAC
TGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAG
CTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAG
GCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGGGTCTAGCTTGCATGCCTGGGCCCAGGCCCAGCCTCTTGTTC
TTAGGGCTTGGATCGTGGAAGAAGGGCCACCCTGAGCAGATCGTGCCGTGGAGCTTGGAGCCCCCTGGCGGCAGGGGTTGGCAGCGCCTC
GCCCCAGCCAAGCCTGACTTTGGGGACACCCTCCTGCCCCCCCACCCCACTCCCCCCATCCTACCTAACTCCCTAGGCCTGAGTTAGCTG
TTTACTGACATGGTGCTGTGTGTGAGCGAGTGACAGAAGGCCCGAGGAGGCCGACTGGGCTGCTGGGGCAGGGCCCAGGGAGGTGGCAGG
GAAGGGTGCCTGGCTGGGCTTTGGGGCTGGTGGGATAGGAGGGTGCCCCTGGGAACACAGTGCCCCAGTGGTGCGGGCCAGGTCTGGCGC
CAGGGGCAGGCAGCTAGGCAGGGAGGGGGCTGGGAAAGAACTTGGACTTCTAAAGGCGGAGGGTCTCCCTGGGCACCCTGCAGGCAGGCA
GACCACGGTGTGGGGGGTGCCCCACAAGGCCCAGCCCTGGGCAAGGAAGCTTTGGAAGCAGCAAGGTGGGGGTCAGGCTACAGGTGCCCC
ACCTCCCCAGAGCCCTGCAGTCACGTGAGGCCCCTGTGCAGTAGAGAGCCTTTCTCCAGCCCATGCTGGCTGGGGCCGGGGCTGCCGCAT
CTGCCTGGAGCCTGGGCAGCACCTCCGGGACTGACCTTCGGCAGTGGCTGGGGGACTGCTTTCAGTGCCTGCTGTTCGTGACTCAGAAAC
AGAAGAAAAACACTGAGAAAAAGCATTAAAAATAAGCCAAAATAAGACTATTGGTAAACACCTAAATTTTTGTAAGAAAATTTAAAAATT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_6403nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGG
CAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTC
CCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGAC
AGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCG
GCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCC
CCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGG
CTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCA
GGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGC
CACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCG
GCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTC
AGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAA
GGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCT
TGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAA
CAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCAC
TGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGT
GCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTG
CCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCA
GTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGA
GGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAG
CTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCT
GCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCG
GAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGT
GCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAA
CCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCC
GCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCG
CTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGT
GCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTAC
TGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAAC
TGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAG
CTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAG
GCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGGGTCTAGCTTGCATGCCTGGGCCCAGGCCCAGCCTCTTGTTC
TTAGGGCTTGGATCGTGGAAGAAGGGCCACCCTGAGCAGATCGTGCCGTGGAGCTTGGAGCCCCCTGGCGGCAGGGGTTGGCAGCGCCTC
GCCCCAGCCAAGCCTGACTTTGGGGACACCCTCCTGCCCCCCCACCCCACTCCCCCCATCCTACCTAACTCCCTAGGCCTGAGTTAGCTG
TTTACTGACATGGTGCTGTGTGTGAGCGAGTGACAGAAGGCCCGAGGAGGCCGACTGGGCTGCTGGGGCAGGGCCCAGGGAGGTGGCAGG
GAAGGGTGCCTGGCTGGGCTTTGGGGCTGGTGGGATAGGAGGGTGCCCCTGGGAACACAGTGCCCCAGTGGTGCGGGCCAGGTCTGGCGC
CAGGGGCAGGCAGCTAGGCAGGGAGGGGGCTGGGAAAGAACTTGGACTTCTAAAGGCGGAGGGTCTCCCTGGGCACCCTGCAGGCAGGCA
GACCACGGTGTGGGGGGTGCCCCACAAGGCCCAGCCCTGGGCAAGGAAGCTTTGGAAGCAGCAAGGTGGGGGTCAGGCTACAGGTGCCCC
ACCTCCCCAGAGCCCTGCAGTCACGTGAGGCCCCTGTGCAGTAGAGAGCCTTTCTCCAGCCCATGCTGGCTGGGGCCGGGGCTGCCGCAT
CTGCCTGGAGCCTGGGCAGCACCTCCGGGACTGACCTTCGGCAGTGGCTGGGGGACTGCTTTCAGTGCCTGCTGTTCGTGACTCAGAAAC
AGAAGAAAAACACTGAGAAAAAGCATTAAAAATAAGCCAAAATAAGACTATTGGTAAACACCTAAATTTTTGTAAGAAAATTTAAAAATT

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_5527nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGG
CAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTC
CCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGAC
AGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCG
GCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCC
CCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGG
CTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCA
GGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGC
CACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCG
GCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTC
AGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAA
GGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCT
TGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAA
CAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCAC
TGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGT
GCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTG
CCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCA
GTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGA
GGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAG
CTGCTTTGGAGGCAAGAAGGCCAAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGC
CGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGA
GGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCT
GCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCG
CAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCT
GGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACG
CGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAG
CTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGG
AGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGAT
CCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTC
TGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGG

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_5545nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGG
CAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTC
CCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGAC
AGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCG
GCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCC
CCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGG
CTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCA
GGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGC
CACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCG
GCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTC
AGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAA
GGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCT
TGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAA
CAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCAC
TGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGT
GCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTG
CCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCA
GTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGA
GGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAG
CTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCT
GCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCG
GAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGT
GCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAA
CCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCC
GCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCG
CTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGT
GCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTAC
TGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAAC
TGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAG
CTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAG

>In-frame_BCR_ENST00000305877_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_5527nt
TTCCAGGACTGCAGAACTGGCCCAGACCTCTGTATTGGAAAGGTCTTTATGGACCAGGGAGTCCGGTGTCTTTTTTACGGGGGACCCCTG
GGCTGCGAGTTGCACAGTCCAATTCGCTGTTGTTAGGGCCTCAGTTTCCCAAAAGGCACAGGGACGGGGGGAGGGTGGCGGCTCGATGGG
GGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCA
CCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCCGGCTGGCTGAGCTTAGCGTCCGAGG
AGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAG
TCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCACACAATAGCGGCGCGCGCAGCCCGCG
CCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCC
GCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCCGCCGCTGAGACGGGCCCCGCGCGCA
GCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCC
CCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTCGGCGCCTGGAGCAGGAGGTGAA
CCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGC
GGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCGCCGACGGAGCCGACCCGCCGCCCGC
CGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGG
GGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCCGCAAGGGCCATGGCCAGCCCGGGGC
GGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCAT
CAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGAGCGTGGGGGATGCATCCAGGCCCCC
TTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCT
GATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCATCTACGTCGGGGGCATGATGGAAGG
GGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAG
TTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCGAGGAGGACTTCTCCTCTGGCCAGTC
CAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAG
CAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGGCCACCATCGTGGGCGTCCGCAAGAC
CGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGC
AGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCTCATCGCCCCACCTCAGCAGCAAGGG
CAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAA
ATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGCTGCCCATGAAGCCTTTGAAAGCCGC
TGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTT
CTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCCAGAAGCTGGCCAGCCAGCTGGGTGT
GTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGA
GAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTCTGCTCTACAAGCCTGTGGACCGTGT
GACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCAT
CTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGAAGAAGGGAGAGGAGCAGAGCCCAGG
CAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGGAGGAGGACCCCGGCACACCCACTTC
CCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGACTGTCAAGACGGTGACCACTCGGAC
AGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCCCTTTTGCAGATGGTGCCCTGGACCG
GCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGGGTGGCTTTCCCGAAGGCCCCGAGCC
CCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCCCCCTTGGCCCAGGCCCTGGTGATGG
CTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTGGCCGCTCCCTGCCCGAGCGCTTCCA
GGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTGAGCTGGAGCCTGACTATGGCACGGC
CACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATGATGGCGGCGAGCTGGCGGACGAGCG
GCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGGACCGGCTGGTGCGGCGCTCGCCCTC
AGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGCTGCGGCACCCCGTGGACCCCGTGAA
GGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTACGGCAGTTGCGGGGGCTGCCGCTGCT
TGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACCTCTCCTATGGCCGCGACACTGACAA
CAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGGACAACGAGGTCCGTGAGCTTGTCAC
TGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGCAGACGCTGACCCACGAGGTGATCGT
GCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAACTGTCTTCAAGAACACGTCGGGCTG
CCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGGTGGACGCGCTCCTGCATGCCCTGCA
GTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGAACCTGTCCTACCACGTGCACAAGGA
GGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCCAGCGCCGGAGGCGGGATGATGCCAG
CTGCTTTGGAGGCAAGAAGGCCAAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGC
CGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGA
GGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCT
GCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCG
CAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCT
GGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACG
CGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAG
CTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGG
AGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGAT
CCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTC
TGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000263207_chr22_19969614_-_6250nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGG
AGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGA
CTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCC
CTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGG
GTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCC
CCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTG
GCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTG
AGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATG
ATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGG
ACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGC
TGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTAC
GGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACC
TCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGG
ACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGC
AGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAA
CTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGG
TGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGA
ACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCC
AGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGG
ACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCT
ACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGT
GGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGC
GCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGA
ATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCG
TGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTAC
GCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGG
CGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGG
ACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGA
GGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCC
CCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGGGTCTAGCTTGCATGCC
TGGGCCCAGGCCCAGCCTCTTGTTCTTAGGGCTTGGATCGTGGAAGAAGGGCCACCCTGAGCAGATCGTGCCGTGGAGCTTGGAGCCCCC
TGGCGGCAGGGGTTGGCAGCGCCTCGCCCCAGCCAAGCCTGACTTTGGGGACACCCTCCTGCCCCCCCACCCCACTCCCCCCATCCTACC
TAACTCCCTAGGCCTGAGTTAGCTGTTTACTGACATGGTGCTGTGTGTGAGCGAGTGACAGAAGGCCCGAGGAGGCCGACTGGGCTGCTG
GGGCAGGGCCCAGGGAGGTGGCAGGGAAGGGTGCCTGGCTGGGCTTTGGGGCTGGTGGGATAGGAGGGTGCCCCTGGGAACACAGTGCCC
CAGTGGTGCGGGCCAGGTCTGGCGCCAGGGGCAGGCAGCTAGGCAGGGAGGGGGCTGGGAAAGAACTTGGACTTCTAAAGGCGGAGGGTC
TCCCTGGGCACCCTGCAGGCAGGCAGACCACGGTGTGGGGGGTGCCCCACAAGGCCCAGCCCTGGGCAAGGAAGCTTTGGAAGCAGCAAG
GTGGGGGTCAGGCTACAGGTGCCCCACCTCCCCAGAGCCCTGCAGTCACGTGAGGCCCCTGTGCAGTAGAGAGCCTTTCTCCAGCCCATG
CTGGCTGGGGCCGGGGCTGCCGCATCTGCCTGGAGCCTGGGCAGCACCTCCGGGACTGACCTTCGGCAGTGGCTGGGGGACTGCTTTCAG
TGCCTGCTGTTCGTGACTCAGAAACAGAAGAAAAACACTGAGAAAAAGCATTAAAAATAAGCCAAAATAAGACTATTGGTAAACACCTAA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000344269_chr22_19969614_-_6248nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGG
AGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGA
CTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCC
CTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGG
GTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCC
CCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTG
GCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTG
AGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATG
ATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGG
ACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGC
TGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTAC
GGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACC
TCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGG
ACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGC
AGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAA
CTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGG
TGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGA
ACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCC
AGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGG
ACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCT
ACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGT
GGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGC
GCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGA
ATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCG
TGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTAC
GCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGG
CGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGG
ACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGA
GGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCC
CCGGGCCCAGCAGGCCCGCGGTCAGGCTGGTGGACGCCGTAGGGGACGCTAAGCCTCAGCCCGTTGATTCCTGGGTCTAGCTTGCATGCC
TGGGCCCAGGCCCAGCCTCTTGTTCTTAGGGCTTGGATCGTGGAAGAAGGGCCACCCTGAGCAGATCGTGCCGTGGAGCTTGGAGCCCCC
TGGCGGCAGGGGTTGGCAGCGCCTCGCCCCAGCCAAGCCTGACTTTGGGGACACCCTCCTGCCCCCCCACCCCACTCCCCCCATCCTACC
TAACTCCCTAGGCCTGAGTTAGCTGTTTACTGACATGGTGCTGTGTGTGAGCGAGTGACAGAAGGCCCGAGGAGGCCGACTGGGCTGCTG
GGGCAGGGCCCAGGGAGGTGGCAGGGAAGGGTGCCTGGCTGGGCTTTGGGGCTGGTGGGATAGGAGGGTGCCCCTGGGAACACAGTGCCC
CAGTGGTGCGGGCCAGGTCTGGCGCCAGGGGCAGGCAGCTAGGCAGGGAGGGGGCTGGGAAAGAACTTGGACTTCTAAAGGCGGAGGGTC
TCCCTGGGCACCCTGCAGGCAGGCAGACCACGGTGTGGGGGGTGCCCCACAAGGCCCAGCCCTGGGCAAGGAAGCTTTGGAAGCAGCAAG
GTGGGGGTCAGGCTACAGGTGCCCCACCTCCCCAGAGCCCTGCAGTCACGTGAGGCCCCTGTGCAGTAGAGAGCCTTTCTCCAGCCCATG
CTGGCTGGGGCCGGGGCTGCCGCATCTGCCTGGAGCCTGGGCAGCACCTCCGGGACTGACCTTCGGCAGTGGCTGGGGGACTGCTTTCAG
TGCCTGCTGTTCGTGACTCAGAAACAGAAGAAAAACACTGAGAAAAAGCATTAAAAATAAGCCAAAATAAGACTATTGGTAAACACCTAA

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406522_chr22_19969614_-_5372nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGG
AGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGA
CTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCC
CTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGG
GTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCC
CCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTG
GCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTG
AGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATG
ATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGG
ACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGC
TGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTAC
GGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACC
TCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGG
ACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGC
AGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAA
CTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGG
TGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGA
ACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCC
AGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGC
TAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGG
AGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCG
CCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTC
TGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGG
CTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATA
ACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGT
CACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTG
CTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCG
AGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGG
GCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCG

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000401994_chr22_19969614_-_5390nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGG
AGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGA
CTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCC
CTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGG
GTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCC
CCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTG
GCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTG
AGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATG
ATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGG
ACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGC
TGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTAC
GGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACC
TCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGG
ACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGC
AGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAA
CTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGG
TGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGA
ACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCC
AGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGAGGAGTGGTTCCACCAAGGAAAGAAGGATGGTGAGATGG
ACCGGAACTTTGACACGCTAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCT
ACCTCTCCCTCCTCACGGAGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGT
GGGCCACGTACATCCGCGCCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGC
GCGCCGTCGCCATCGCTCTGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGA
ATGTGCGCAATGCACAGGCTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCG
TGTCCGACAGCCTGGATAACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTAC
GCGAAGCGAAGGCGGCGTCACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGG
CGCGCTTCCAGTCAGCTGCTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGG
ACAAGAGCCTTGAGGGCGAGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGA
GGGAGCGGAGGCCACGGGGCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCC

>In-frame_BCR_ENST00000359540_chr22_23615961_+_ARVCF_ENST00000406259_chr22_19969614_-_5372nt
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCCCACGGCGCGGCCCCTTTAAGAGGCCCGCCT
GGCTCCGTCATCCGCGCCGCGGCCACCTCCCCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGGGGCTGTGGGGCGGTGCGGAAGCGAGAGGCG
AGGAGCGCGCGGGCCGTGGCCAGAGTCTGGCGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGAGCGCCCCGCTCCGCCTCACCTGCCACCAGG
GAGTGGGCGGGCATTGTTCGCCGCCGCCGCCGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGGTGGACCCGGTGGGCTTCGCGGAGGCGTGGA
AGGCGCAGTTCCCGGACTCAGAGCCCCCGCGCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGTTGCTGGCCAAGGAAAAGAAGAGCTATGACC
GGCAGCGATGGGGCTTCCGGCGCGCGGCGCAGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTTCTCCGGGTAAGGCCAGGCCCGGGACCGCCC
GCAGGCCCGGGGCAGCCGCGTCGGGGGAACGGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTTCACCACGAGCGCGGCCTGGTGAAGGTCA
ACGACAAAGAGGTGTCGGACCGCATCAGCTCCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCGTCGACGGCGACTACGAGGACGCCGAGTTGA
ACCCCCGCTTCCTGAAGGACAACCTGATCGACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCACCTCTGAGCAGGAGAAGCGCCTTACCTGGC
CCCGCAGGTCCTACTCCCCCCGGAGTTTTGAGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCATGTTCCGGGACAAAAGCCGCTCTCCCTCGC
AGAACTCGCAACAGTCCTTCGACAGCAGCAGTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCTTCCATGGAGACGCAGATGGCTCGTTCGGAA
CACCACCTGGATACGGCTGCGCTGCAGACCGGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCCTGGAGTCCACTAAAGCGAGTGAGCTGGACT
TGGAAAAGGGCTTGGAGATGAGAAAATGGGTCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGCAGATCGAGACCATCTTCTTCAAAGTGCCTG
AGCTCTACGAGATCCACAAGGAGTTCTATGATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCATGGAAATGGCTGAGAAGTGCTGTCAGGCCA
ATGCTCAGTTTGCAGAAATCTCCGAGAACCTGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGAAGCACACTCCTGCCAGCCACCCTGACCACC
CCTTGCTGCAGGACGCCCTCCGCATCTCACAGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGGAGCAGAGCCCAGGCAGCCAGGCCTCACTGGCCACGATGCCGGAGGCACCTGATGTGCTGGAGGAGACCGTGACGGTGG
AGGAGGACCCCGGCACACCCACTTCCCATGTGTCTATTGTCACATCCGAAGATGGCACAACCCGGCGCACCGAGACCAAGGTCACCAAGA
CTGTCAAGACGGTGACCACTCGGACAGTACGCCAGGTGCCCGTGGGCCCAGATGGACTCCCCCTGCTGGATGGCGGCCCCCCACTAGGCC
CTTTTGCAGATGGTGCCCTGGACCGGCATTTCCTGCTGCGTGGTGGTGGCCCAGTGGCCACACTCTCTCGAGCCTACCTCAGCAGTGGGG
GTGGCTTTCCCGAAGGCCCCGAGCCCCGGGACAGCCCCAGCTATGGCAGCCTGTCCCGAGGGCTGGGCATGCGGCCCCCACGTGCTGGCC
CCCTTGGCCCAGGCCCTGGTGATGGCTGCTTCACACTGCCTGGCCACCGGGAAGCCTTCCCGGTGGGTCCTGAGCCTGGGCCACCAGGTG
GCCGCTCCCTGCCCGAGCGCTTCCAGGCAGAGCCGTATGGCTTGGAGGATGACACGCGCAGCCTGGCCGCTGATGACGAGGGTGGCCCTG
AGCTGGAGCCTGACTATGGCACGGCCACAAGGAGGAGGCCTGAGTGTGGGCGGGGCCTTCATACCAGGGCCTACGAGGACACAGCAGATG
ATGGCGGCGAGCTGGCGGACGAGCGGCCTGCGTTCCCAATGGTGACGGCGCCCCTGGCCCAGCCTGAACGGGGCAGCATGGGCAGCCTGG
ACCGGCTGGTGCGGCGCTCGCCCTCAGTGGATAGCGCCCGCAAGGAGCCGCGCTGGCGGGACCCTGAGCTGCCTGAGGTGCTGGCCATGC
TGCGGCACCCCGTGGACCCCGTGAAGGCCAATGCGGCCGCCTACCTGCAGCATCTGTGCTTTGAGAACGAGGGTGTCAAGCGGCGTGTAC
GGCAGTTGCGGGGGCTGCCGCTGCTTGTGGCACTGCTGGACCACCCGCGGGCTGAGGTGCGGCGCCGGGCCTGTGGGGCACTGCGCAACC
TCTCCTATGGCCGCGACACTGACAACAAGGCCGCCATCCGGGACTGCGGTGGTGTGCCTGCCCTGGTGCGCCTGCTGAGGGCTGCCCGGG
ACAACGAGGTCCGTGAGCTTGTCACTGGCACCCTGTGGAACCTGTCATCCTATGAGCCCCTGAAGATGGTCATCATTGACCATGGCCTGC
AGACGCTGACCCACGAGGTGATCGTGCCCCACTCAGGATGGGAGCGTGAGCCCAACGAGGACTCCAAGCCACGGGACGCCGAGTGGACAA
CTGTCTTCAAGAACACGTCGGGCTGCCTGAGGAATGTGAGCTCCGATGGTGCTGAGGCCCGGCGGCGACTCCGGGAGTGTGAAGGGCTGG
TGGACGCGCTCCTGCATGCCCTGCAGTCGGCTGTGGGCCGGAAGGACACTGACAACAAGTCGGTGGAGAACTGCGTGTGCATCATGCGGA
ACCTGTCCTACCACGTGCACAAGGAGGTGCCCGGGGCCGACAGGTACCAGGAGGCCGAGCCCGGGCCCCTGGGCAGTGCTGTAGGCTCCC
AGCGCCGGAGGCGGGATGATGCCAGCTGCTTTGGAGGCAAGAAGGCCAAAGGAAAGAAGGATGGTGAGATGGACCGGAACTTTGACACGC
TAGACCTGCCCAAGCGAACTGAGGCCGCCAAAGGCTTTGAGCTGCTGTACCAGCCCGAGGTGGTACGTCTCTACCTCTCCCTCCTCACGG
AGAGCCGGAACTTCAACACCCTGGAGGCTGCCGCCGGCGCTCTGCAGAACCTCAGTGCCGGCAACTGGATGTGGGCCACGTACATCCGCG
CCACAGTGCGCAAAGAGCGCGGGCTGCCGGTGCTTGTGGAACTGCTGCAGTCTGAGACCGACAAGGTGGTGCGCGCCGTCGCCATCGCTC
TGCGCAACCTCTCGCTGGACCGGCGCAACAAAGACCTCATCGGGAGCTACGCCATGGCTGAGCTTGTGCGGAATGTGCGCAATGCACAGG
CTCCGCCGCGACCGGGGGCCTGCCTGGAGGAAGACACCGTGGTGGCGGTGCTCAACACCATCCACGAAATCGTGTCCGACAGCCTGGATA
ACGCGCGCTCGCTCCTGCAGGCACGCGGGGTGCCAGCGTTGGTGGCTCTCGTGGCCTCCAGCCAATCGGTACGCGAAGCGAAGGCGGCGT
CACACGTGCTGCAGACAGTGTGGAGCTACAAGGAGCTGCGTGGTACCTTGCAGAAAGATGGTTGGACCAAGGCGCGCTTCCAGTCAGCTG
CTGCTACTGCCAAGGGGCCTAAGGGAGCACTGAGTCCTGGGGGCTTCGATGACAGCACGCTGCCACTGGTGGACAAGAGCCTTGAGGGCG
AGAAAACTGGCAGCCGGGATGTGATCCCCATGGATGCGCTGGGCCCAGACGGATACTCCACGGTGGACCGGAGGGAGCGGAGGCCACGGG
GCGCCAGCTCTGCAGGAGAGGCCTCTGAGAAGGAACCCTTGAAACTCGACCCCAGCAGGAAGGCCCCTCCCCCCGGGCCCAGCAGGCCCG


Top

FusionGenePPI for BCR_ARVCF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCRMLLT4, HCK, PTPN6, FES, RB1, ERCC3, GRB2, ABL1, GAB2, HOXA9, CRKL, KIT, PIK3CG, IGSF21, TP53, UNC119, SOS1, PXN, RAC1, CDC42, RHOA, IL3, WDR48, TSG101, VPS28, INPP5D, MYC, HSP90AA1, HSPA8, HIF1A, CRK, GABRR1, CBL, LNX1, LRRK1, GRK5, UBASH3B, PIK3R2, SHC1, AP2M1, CFTR, ERBB2IP, DOK1, PTGES3, HSPA4, HSPD1, UBC, CSNK2A2, STUB1, CCDC183, RSPH9, SEC13, NTRK1, CEP128, NINL, XPO1, PIK3R1, PDZK1, COMMD1, TULP3, JPH4, NAGK, USP15, SPAG9, MCM2, MCM4, WEE1, CSNK1A1, MCM6, TRIM25, RAD51ARVCFCDH15, ERBB2IP, LNX1, NTRK1, CDH1, CTDSPL, CDH8, CDH5, CTNNA3, TACR1, SDC1, CYP2S1, GJB7, S1PR2, CPA5, P4HA2, PROZ


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCR_ARVCF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneBCRP11274DB06616BosutinibBreakpoint cluster region proteinsmall moleculeapproved
HgeneBCRP11274DB01254DasatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational
HgeneBCRP11274DB08901PonatinibBreakpoint cluster region proteinsmall moleculeapproved|investigational

Top

RelatedDiseases for BCR_ARVCF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBCRC0005586Bipolar Disorder4PSYGENET
HgeneBCRC0023473Myeloid Leukemia, Chronic3CTD_human;HPO;ORPHANET
HgeneBCRC0005699Blast Phase1CTD_human
HgeneBCRC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneBCRC0027022Myeloproliferative disease1CTD_human;HPO
HgeneBCRC0027540Necrosis1CTD_human
HgeneBCRC0027659Neoplasms, Experimental1CTD_human
HgeneBCRC0041696Unipolar Depression1PSYGENET
HgeneBCRC1269683Major Depressive Disorder1PSYGENET
TgeneARVCFC0036341Schizophrenia4PSYGENET
TgeneARVCFC0809983Schizophrenia and related disorders1PSYGENET