FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40801

FusionGeneSummary for UNC45A_BLM

check button Fusion gene summary
Fusion gene informationFusion gene name: UNC45A_BLM
Fusion gene ID: 40801
HgeneTgene
Gene symbol

UNC45A

BLM

Gene ID

55898

641

Gene nameunc-45 myosin chaperone ABloom syndrome RecQ like helicase
SynonymsGC-UNC45|GCUNC-45|GCUNC45|IRO039700|SMAP-1|SMAP1|UNC-45ABS|RECQ2|RECQL2|RECQL3
Cytomap

15q26.1

15q26.1

Type of geneprotein-codingprotein-coding
Descriptionprotein unc-45 homolog Ageneral cell UNC45smooth muscle cell associated protein-1unc-45 homolog ABloom syndrome proteinBloom syndrome, RecQ helicase-likeDNA helicase, RecQ-like type 2recQ protein-like 3
Modification date2018052320180527
UniProtAcc

Q9H3U1

P54132

Ensembl transtripts involved in fusion geneENST00000394275, ENST00000418476, 
ENST00000553671, 
ENST00000355112, 
ENST00000560509, ENST00000560136, 
Fusion gene scores* DoF score5 X 3 X 5=754 X 5 X 2=40
# samples 64
** MAII scorelog2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/40*10)=0
Context

PubMed: UNC45A [Title/Abstract] AND BLM [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBLM

GO:0000729

DNA double-strand break processing

21325134

TgeneBLM

GO:0006974

cellular response to DNA damage stimulus

23509288

TgeneBLM

GO:0007095

mitotic G2 DNA damage checkpoint

11309417

TgeneBLM

GO:0010165

response to X-ray

11309417

TgeneBLM

GO:0031297

replication fork processing

17115688

TgeneBLM

GO:0032508

DNA duplex unwinding

11735402|24816114|25901030

TgeneBLM

GO:0044806

G-quadruplex DNA unwinding

11735402

TgeneBLM

GO:0045893

positive regulation of transcription, DNA-templated

11781842

TgeneBLM

GO:0051259

protein complex oligomerization

10359700|28228481

TgeneBLM

GO:0051260

protein homooligomerization

28228481

TgeneBLM

GO:0061820

telomeric D-loop disassembly

19734539

TgeneBLM

GO:0071479

cellular response to ionizing radiation

23509288

TgeneBLM

GO:0072711

cellular response to hydroxyurea

23509288

TgeneBLM

GO:0072757

cellular response to camptothecin

23509288


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-49-AAQV-01AUNC45Achr15

91483703

+BLMchr15

91358332

+
TCGALDLUADTCGA-38-4630-01AUNC45Achr15

91493845

+BLMchr15

91298041

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394275ENST00000355112UNC45Achr15

91483703

+BLMchr15

91358332

+
In-frameENST00000394275ENST00000560509UNC45Achr15

91483703

+BLMchr15

91358332

+
5CDS-intronENST00000394275ENST00000560136UNC45Achr15

91483703

+BLMchr15

91358332

+
In-frameENST00000418476ENST00000355112UNC45Achr15

91483703

+BLMchr15

91358332

+
In-frameENST00000418476ENST00000560509UNC45Achr15

91483703

+BLMchr15

91358332

+
5CDS-intronENST00000418476ENST00000560136UNC45Achr15

91483703

+BLMchr15

91358332

+
3UTR-3CDSENST00000553671ENST00000355112UNC45Achr15

91483703

+BLMchr15

91358332

+
3UTR-3CDSENST00000553671ENST00000560509UNC45Achr15

91483703

+BLMchr15

91358332

+
3UTR-intronENST00000553671ENST00000560136UNC45Achr15

91483703

+BLMchr15

91358332

+
In-frameENST00000394275ENST00000355112UNC45Achr15

91493845

+BLMchr15

91298041

+
In-frameENST00000394275ENST00000560509UNC45Achr15

91493845

+BLMchr15

91298041

+
5CDS-intronENST00000394275ENST00000560136UNC45Achr15

91493845

+BLMchr15

91298041

+
In-frameENST00000418476ENST00000355112UNC45Achr15

91493845

+BLMchr15

91298041

+
In-frameENST00000418476ENST00000560509UNC45Achr15

91493845

+BLMchr15

91298041

+
5CDS-intronENST00000418476ENST00000560136UNC45Achr15

91493845

+BLMchr15

91298041

+
intron-3CDSENST00000553671ENST00000355112UNC45Achr15

91493845

+BLMchr15

91298041

+
intron-3CDSENST00000553671ENST00000560509UNC45Achr15

91493845

+BLMchr15

91298041

+
intron-intronENST00000553671ENST00000560136UNC45Achr15

91493845

+BLMchr15

91298041

+

Top

FusionProtFeatures for UNC45A_BLM


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UNC45A

Q9H3U1

BLM

P54132

Acts as co-chaperone for HSP90. Prevents the stimulationof HSP90AB1 ATPase activity by AHSA1. Positive factor in promotingPGR function in the cell. May be necessary for proper folding ofmyosin (Potential). Necessary for normal cell proliferation.Necessary for normal myotube formation and myosin accumulationduring muscle cell development. May play a role in erythropoiesisin stroma cells in the spleen (By similarity). {ECO:0000250,ECO:0000269|PubMed:12119110, ECO:0000269|PubMed:16478993,ECO:0000305}. ATP-dependent DNA helicase that unwinds single- anddouble-stranded DNA in a 3'-5' direction (PubMed:9388193,PubMed:24816114, PubMed:25901030). Participates in DNA replicationand repair (PubMed:12019152, PubMed:21325134, PubMed:23509288).Involved in 5'-end resection of DNA during double-strand break(DSB) repair: unwinds DNA and recruits DNA2 which mediates thecleavage of 5'-ssDNA (PubMed:21325134). Negatively regulatessister chromatid exchange (SCE) (PubMed:25901030). Stimulates DNA4-way junction branch migration and DNA Holliday junctiondissolution (PubMed:25901030). Binds single-stranded DNA (ssDNA),forked duplex DNA and DNA Holliday junction (PubMed:20639533,PubMed:24257077, PubMed:25901030). {ECO:0000269|PubMed:12019152,ECO:0000269|PubMed:20639533, ECO:0000269|PubMed:21325134,ECO:0000269|PubMed:23509288, ECO:0000269|PubMed:24257077,ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030,ECO:0000269|PubMed:9388193}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUNC45Achr15:91483703chr15:91358332ENST00000394275+92321_54214930RepeatNote=TPR 1
HgeneUNC45Achr15:91483703chr15:91358332ENST00000394275+92358_91214930RepeatNote=TPR 2
HgeneUNC45Achr15:91483703chr15:91358332ENST00000394275+92392_125214930RepeatNote=TPR 3
HgeneUNC45Achr15:91483703chr15:91358332ENST00000418476+62021_54229945RepeatNote=TPR 1
HgeneUNC45Achr15:91483703chr15:91358332ENST00000418476+62058_91229945RepeatNote=TPR 2
HgeneUNC45Achr15:91483703chr15:91358332ENST00000418476+62092_125229945RepeatNote=TPR 3
HgeneUNC45Achr15:91493845chr15:91298041ENST00000394275+202321_54752930RepeatNote=TPR 1
HgeneUNC45Achr15:91493845chr15:91298041ENST00000394275+202358_91752930RepeatNote=TPR 2
HgeneUNC45Achr15:91493845chr15:91298041ENST00000394275+202392_125752930RepeatNote=TPR 3
HgeneUNC45Achr15:91493845chr15:91298041ENST00000418476+172021_54767945RepeatNote=TPR 1
HgeneUNC45Achr15:91493845chr15:91298041ENST00000418476+172058_91767945RepeatNote=TPR 2
HgeneUNC45Achr15:91493845chr15:91298041ENST00000418476+172092_125767945RepeatNote=TPR 3
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322557_5663191418Compositional biasNote=Poly-Asp
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221212_12923191418DomainHRDC
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322676_8513191418DomainHelicase ATP-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322877_10243191418DomainHelicase C-terminal
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221334_13493191418MotifNuclear localization signal
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322795_7983191418MotifNote=DEAH box
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322668_6723191418Nucleotide bindingATP
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322692_6963191418Nucleotide bindingATP
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221000_10033191418Region3' overhang DNA-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221094_11393191418RegionDNA Holliday junction binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221110_11123191418Region3' overhang DNA-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221121_11253191418Region3' overhang DNA-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221160_11663191418Region3' overhang DNA-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+3221227_12443191418RegionNecessary for ssDNA and DNA Holliday junction binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322362_4143191418RegionNecessary for dimerization and homooligomerization
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322870_8733191418Region3' overhang DNA-binding
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322897_8993191418Region3' overhang DNA-binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022292_29913581418Compositional biasNote=Poly-Asp
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022310_31613581418Compositional biasNote=Poly-Ser
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022557_56613581418Compositional biasNote=Poly-Asp
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322292_2993191418Compositional biasNote=Poly-Asp
TgeneBLMchr15:91493845chr15:91298041ENST00000355112+322310_3163191418Compositional biasNote=Poly-Ser
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221212_129213581418DomainHRDC
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022676_85113581418DomainHelicase ATP-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022877_102413581418DomainHelicase C-terminal
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221334_134913581418MotifNuclear localization signal
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022795_79813581418MotifNote=DEAH box
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022668_67213581418Nucleotide bindingATP
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022692_69613581418Nucleotide bindingATP
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221000_100313581418Region3' overhang DNA-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221094_113913581418RegionDNA Holliday junction binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221110_111213581418Region3' overhang DNA-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221121_112513581418Region3' overhang DNA-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221160_116613581418Region3' overhang DNA-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+20221227_124413581418RegionNecessary for ssDNA and DNA Holliday junction binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022362_41413581418RegionNecessary for dimerization and homooligomerization
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022870_87313581418Region3' overhang DNA-binding
TgeneBLMchr15:91483703chr15:91358332ENST00000355112+2022897_89913581418Region3' overhang DNA-binding


Top

FusionGeneSequence for UNC45A_BLM


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_273aa
MTASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKL
GRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSN
GVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRGVCHMXKDIFQNEILQHHWIQFSLTYFSSDIRSQXQIGDYGSTEAYKXTVSXAFIC

>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_273aa
MTASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKL
GRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSN
GVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRGVCHMXKDIFQNEILQHHWIQFSLTYFSSDIRSQXQIGDYGSTEAYKXTVSXAFIC

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_288aa
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGG
DVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRGVCHMXKDIFQNEILQHHWIQFSLTYFSSDIRSQXQIGDYG

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_288aa
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGG
DVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRGVCHMXKDIFQNEILQHHWIQFSLTYFSSDIRSQXQIGDYG

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_1851aa
MTASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKL
GRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSN
GVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIV
DPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGELAVTANSRMSASILL
SKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAA
GKAKRASFITANGVSLLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLT
FDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVV
SAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVR
PLVSLLHLNCSGLQNFEALMALTNLAGISERLRTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVME
HICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGD
CLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFD
IDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSL
SFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYL
TGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVM
ALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALA
YHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMM
EKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGM
RNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKV
DFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAE
VISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKI

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_1720aa
MTASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKL
GRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSN
GVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIV
DPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGELAVTANSRMSASILL
SKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAA
GKAKRASFITANGVSLLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLT
FDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVV
SAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVR
PLVSLLHLNCSGLQNFEALMALTNLAGISERLRTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVME
HICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGD
CLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFD
IDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSL
SFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYL
TGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVM
ALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALA
YHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMM
EKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGM
RNIKHVGPSGRFTMNMLVDIFLESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEE
IPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRP

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_1866aa
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGG
DVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKE
GVKKGFRGKEGAIIVDPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGE
LAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQ
EEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQID
AGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPS
FVRARVKKLLAAGVVSAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSN
PEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCD
ARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKE
LNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASIND
LERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQ
NLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVD
QVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYK
RMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECD
TMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLF
YTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVK
SIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVM
LGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQ
IDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTAS

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_1735aa
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGG
DVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKE
GVKKGFRGKEGAIIVDPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGE
LAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQ
EEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQID
AGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPS
FVRARVKKLLAAGVVSAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSN
PEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCD
ARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKE
LNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASIND
LERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQ
NLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVD
QVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYK
RMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECD
TMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLF
YTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVK
SIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSS
SRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGAN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_820nt
ATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACT
CAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGAC
AAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTG
GGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATC
GGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAG
AAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAAT
GGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAG
CATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATAC
TTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGC

>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_820nt
ATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACT
CAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGAC
AAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTG
GGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATC
GGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAG
AAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAAT
GGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAG
CATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATAC
TTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGC

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_865nt
ATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGGGGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAG
CTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTG
CACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGG
GATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGC
TTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGAT
GCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTG
CTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGAC
CTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAA
AACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGC

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_865nt
ATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGGGGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAG
CTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTG
CACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGG
GATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGC
TTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGAT
GCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTG
CTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGAC
CTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAA
AACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGC

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_5553nt
ATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACT
CAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGAC
AAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTG
GGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATC
GGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAG
AAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAAT
GGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAG
CATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTG
GCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTG
GATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCC
CTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAA
AAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTC
AGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGC
CAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTG
AGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCC
GGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGC
ATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAA
CTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACC
TTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTG
CTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTAT
GCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTG
TCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTG
GAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAG
ACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGG
CCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAG
AGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAA
ATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAG
CACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGA
AGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGC
CCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGAC
TGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAG
AAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGC
ACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGAC
ATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATC
AAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATA
AACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTT
AGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAAT
GCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCT
GGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTG
ACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCA
GAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCA
CATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATG
GCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTT
AACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCA
TATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCT
TACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATT
GCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCT
GGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATG
GAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGG
AGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGT
AAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATG
AGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTTGGGGAGTAAGAGTGCAAAAATCCAG
TCAGGTATATTTGGAAAAGGATCTGCTTATTCACGACACAATGCCGAAAGACTTTTTAAAAAGCTGATACTTGACAAGATTTTGGATGAA
GACTTATATATCAATGCCAATGACCAGGCGATCGCTTATGTGATGCTCGGAAATAAAGCCCAAACTGTACTAAATGGCAATTTAAAGGTA
GACTTTATGGAAACAGAAAATTCCAGCAGTGTGAAAAAACAAAAAGCGTTAGTAGCAAAAGTGTCTCAGAGGGAAGAGATGGTTAAAAAA
TGTCTTGGAGAACTTACAGAAGTCTGCAAATCTCTGGGGAAAGTTTTTGGTGTCCATTACTTCAATATTTTTAATACCGTCACTCTCAAG
AAGCTTGCAGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAA
GTGATTTCAGTATTACAGAAATACTCTGAATGGACATCGCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCC
GGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAA
AAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATA
TCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGG

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_5160nt
ATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACT
CAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGAC
AAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTG
GGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATC
GGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAG
AAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAAT
GGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAG
CATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTG
GCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTG
GATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCC
CTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAA
AAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTC
AGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGC
CAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTG
AGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCC
GGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGC
ATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAA
CTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACC
TTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTG
CTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTAT
GCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTG
TCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTG
GAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAG
ACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGG
CCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAG
AGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAA
ATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAG
CACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGA
AGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGC
CCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGAC
TGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAG
AAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGC
ACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGAC
ATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATC
AAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATA
AACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTT
AGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAAT
GCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCT
GGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTG
ACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCA
GAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCA
CATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATG
GCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTT
AACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCA
TATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCT
TACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATT
GCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCT
GGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATG
GAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGG
AGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGT
AAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATG
AGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTTGGAATCTTTATCTTCTGATCCTGAG
GTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGATTTCAGTATTACAGAAATACTCTGAATGG
ACATCGCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCCGGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAA
ATACCCGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAAAAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGA
AAAACTGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGA
TCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCG

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_5598nt
ATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGGGGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAG
CTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTG
CACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGG
GATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGC
TTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGAT
GCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTG
CTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGAC
CTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGG
CGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTGGCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAA
GGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTGGATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGAT
CTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCCCTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGAC
CCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAAAAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAG
CTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTCAGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAAT
TTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGCCAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGC
CTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTGAGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAG
GAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCCGGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCG
CTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGCATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGG
ACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAACTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGAC
GCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACCTTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCT
CTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTGCTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTAT
GACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTATGCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGC
TTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTGTCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACC
AGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTGGAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGC
AGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAGACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAAC
CCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGGCCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAAC
TTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAGAGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAG
GATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAAATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGAC
GCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAGCACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAA
CTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGAAGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGT
CTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGCCCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAG
TTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGACTGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACC
AGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAGAAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGA
AAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGCACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGAC
TTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGACATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCAT
AATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATCAAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCA
GCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATAAACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAA
AATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTTAGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAA
TTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAATGCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGA
GGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCTGGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGAT
CAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTGACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAG
TTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCAGAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAAT
CTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCACATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAA
AGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATGGCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTG
ACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTTAACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAA
AAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCATATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGAC
ACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCTTACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAG
AAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATTGCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATT
CATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCTGGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTC
TATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATGGAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAAT
TTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGGAGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCT
GATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGTAAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAA
AGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATGAGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAAT
ATGCTGGTCGACATTTTCTTGGGGAGTAAGAGTGCAAAAATCCAGTCAGGTATATTTGGAAAAGGATCTGCTTATTCACGACACAATGCC
GAAAGACTTTTTAAAAAGCTGATACTTGACAAGATTTTGGATGAAGACTTATATATCAATGCCAATGACCAGGCGATCGCTTATGTGATG
CTCGGAAATAAAGCCCAAACTGTACTAAATGGCAATTTAAAGGTAGACTTTATGGAAACAGAAAATTCCAGCAGTGTGAAAAAACAAAAA
GCGTTAGTAGCAAAAGTGTCTCAGAGGGAAGAGATGGTTAAAAAATGTCTTGGAGAACTTACAGAAGTCTGCAAATCTCTGGGGAAAGTT
TTTGGTGTCCATTACTTCAATATTTTTAATACCGTCACTCTCAAGAAGCTTGCAGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAA
ATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGATTTCAGTATTACAGAAATACTCTGAATGGACATCGCCAGCT
GAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCCGGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCT
TCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAAAAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCC
AGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCC
TCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCT

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_5205nt
ATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGGGGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAG
CTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTG
CACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGG
GATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGC
TTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGAT
GCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTG
CTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGAC
CTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGG
CGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTGGCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAA
GGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTGGATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGAT
CTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCCCTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGAC
CCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAAAAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAG
CTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTCAGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAAT
TTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGCCAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGC
CTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTGAGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAG
GAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCCGGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCG
CTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGCATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGG
ACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAACTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGAC
GCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACCTTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCT
CTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTGCTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTAT
GACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTATGCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGC
TTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTGTCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACC
AGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTGGAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGC
AGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAGACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAAC
CCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGGCCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAAC
TTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAGAGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAG
GATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAAATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGAC
GCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAGCACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAA
CTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGAAGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGT
CTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGCCCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAG
TTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGACTGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACC
AGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAGAAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGA
AAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGCACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGAC
TTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGACATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCAT
AATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATCAAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCA
GCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATAAACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAA
AATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTTAGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAA
TTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAATGCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGA
GGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCTGGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGAT
CAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTGACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAG
TTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCAGAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAAT
CTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCACATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAA
AGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATGGCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTG
ACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTTAACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAA
AAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCATATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGAC
ACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCTTACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAG
AAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATTGCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATT
CATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCTGGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTC
TATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATGGAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAAT
TTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGGAGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCT
GATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGTAAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAA
AGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATGAGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAAT
ATGCTGGTCGACATTTTCTTGGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAA
TATGGTGCGGAAGTGATTTCAGTATTACAGAAATACTCTGAATGGACATCGCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGC
AGCAGAGGCCCCGGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAA
AGGAAGAGGAAAAAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACA
TGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_1838nt
ACTTAACAACCGAAGTAACCCGCAATGCGGAAGGGCGAGGGGATTGCGAGTCACCGAGTTTCCCGCGCGGCTTGAGTCACGGCCTAGAAA
GAGAGATGTTGGGGTTCCCAGGACCAGGACAGAGGTGGTAGTGAACTCTCATGGGCATCCAGAGAAGGTCAGGCCCCTTGCTGACAGGCC
TATCTGTGGGGCTACTGCTGCTCTTCAGCTGGGTGACCCTTGTCCAGCCAACCTCTCTCTCAGCTCTGGTCCACCACCCTCACTTGTGCC
AGACCACCCGGGATGTCCATGGCCGTCACTACCCTGGTTTCTTTTGCCCTCGTCTGTCTGATTCTCCAGAGGAAGCCTACTGCTGCCACC
TGCAGGCTGCAGGGGGCTCCTGCTGCACCCGGGCTGAATTTGAGGCCCTGTACCAAGTCAATCTGTCCGCTCTTCCGCCCCCGCCCATCC
TCAGGGGCCCAGGCCCGCTCCTAGTGCTGGGCCTCTACAACCTACTGGTTGTGACCCTGATGACCGTAGACCTCGTGCACTTCTGCTGCG
GTCGGGGCCGGAGTCTGGGCTGGAGCCACCGCAGGCCTCCCTCTGGGTCCTCCGCCGCGAGCTCCCTGCAGGTCTCTGCGGGGACAGCTT
AGGTGCGCCCGGAGCTTGCCTGCACCTGCGATCCAGAGCCAAGCGCCCCGCCCCTGCCCGGGCGCGCTCCCTCCTTAGCCCTGCCCCTCT
CTGACCCCACCTCCGACGCAAGAGTGGGGCGGGGCAGCTGCCGGTGGCGTCCCGAACCCAGACTCGCCCCGCCCCAGAGACTGCGCCTGC
GCGGGCACGAGACAACCTCTCCGCGATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTA
CGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTG
CCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCG
GCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGT
TTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTT
TCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGG
AGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCG
TACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCA
TTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATA
GACCGTTTCTTAAGCCTTCATATGCATTCTCATAACAACCGAATCTCAATGTACATAGACCCTCTTTCTTGTTTGTCAGCATCTGACCAT
CTGTGACTATAAAGCTGTTATTCTTGTTATACCATTTGAAGTTTTTACTCGTCTCTATTAATATTTAAATAAATGCTGGGGGGTGATAGT

>In-frame_UNC45A_ENST00000394275_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_1709nt
ACTTAACAACCGAAGTAACCCGCAATGCGGAAGGGCGAGGGGATTGCGAGTCACCGAGTTTCCCGCGCGGCTTGAGTCACGGCCTAGAAA
GAGAGATGTTGGGGTTCCCAGGACCAGGACAGAGGTGGTAGTGAACTCTCATGGGCATCCAGAGAAGGTCAGGCCCCTTGCTGACAGGCC
TATCTGTGGGGCTACTGCTGCTCTTCAGCTGGGTGACCCTTGTCCAGCCAACCTCTCTCTCAGCTCTGGTCCACCACCCTCACTTGTGCC
AGACCACCCGGGATGTCCATGGCCGTCACTACCCTGGTTTCTTTTGCCCTCGTCTGTCTGATTCTCCAGAGGAAGCCTACTGCTGCCACC
TGCAGGCTGCAGGGGGCTCCTGCTGCACCCGGGCTGAATTTGAGGCCCTGTACCAAGTCAATCTGTCCGCTCTTCCGCCCCCGCCCATCC
TCAGGGGCCCAGGCCCGCTCCTAGTGCTGGGCCTCTACAACCTACTGGTTGTGACCCTGATGACCGTAGACCTCGTGCACTTCTGCTGCG
GTCGGGGCCGGAGTCTGGGCTGGAGCCACCGCAGGCCTCCCTCTGGGTCCTCCGCCGCGAGCTCCCTGCAGGTCTCTGCGGGGACAGCTT
AGGTGCGCCCGGAGCTTGCCTGCACCTGCGATCCAGAGCCAAGCGCCCCGCCCCTGCCCGGGCGCGCTCCCTCCTTAGCCCTGCCCCTCT
CTGACCCCACCTCCGACGCAAGAGTGGGGCGGGGCAGCTGCCGGTGGCGTCCCGAACCCAGACTCGCCCCGCCCCAGAGACTGCGCCTGC
GCGGGCACGAGACAACCTCTCCGCGATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTA
CGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTG
CCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCG
GCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGT
TTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTT
TCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGG
AGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCG
TACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCA
TTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATA

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000355112_chr15_91358332_+_1088nt
AGAGACTGCGCCTGCGCGGGCACGAGACAACCTCTCCGCGATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGG
GGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGC
CCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGC
AGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCG
CCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGG
CCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGG
CACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGT
TCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCA
GTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTC
AAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGCATTCT
CATAACAACCGAATCTCAATGTACATAGACCCTCTTTCTTGTTTGTCAGCATCTGACCATCTGTGACTATAAAGCTGTTATTCTTGTTAT
ACCATTTGAAGTTTTTACTCGTCTCTATTAATATTTAAATAAATGCTGGGGGGTGATAGTTCTTCTTTTTAAAATAAACATTTTCTTTTG

>In-frame_UNC45A_ENST00000418476_chr15_91483703_+_BLM_ENST00000560509_chr15_91358332_+_959nt
AGAGACTGCGCCTGCGCGGGCACGAGACAACCTCTCCGCGATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGG
GGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGC
CCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGC
AGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCG
CCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGG
CCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGG
CACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGT
TCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCA
GTCACGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTC
AAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGCATTCT

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_6571nt
ACTTAACAACCGAAGTAACCCGCAATGCGGAAGGGCGAGGGGATTGCGAGTCACCGAGTTTCCCGCGCGGCTTGAGTCACGGCCTAGAAA
GAGAGATGTTGGGGTTCCCAGGACCAGGACAGAGGTGGTAGTGAACTCTCATGGGCATCCAGAGAAGGTCAGGCCCCTTGCTGACAGGCC
TATCTGTGGGGCTACTGCTGCTCTTCAGCTGGGTGACCCTTGTCCAGCCAACCTCTCTCTCAGCTCTGGTCCACCACCCTCACTTGTGCC
AGACCACCCGGGATGTCCATGGCCGTCACTACCCTGGTTTCTTTTGCCCTCGTCTGTCTGATTCTCCAGAGGAAGCCTACTGCTGCCACC
TGCAGGCTGCAGGGGGCTCCTGCTGCACCCGGGCTGAATTTGAGGCCCTGTACCAAGTCAATCTGTCCGCTCTTCCGCCCCCGCCCATCC
TCAGGGGCCCAGGCCCGCTCCTAGTGCTGGGCCTCTACAACCTACTGGTTGTGACCCTGATGACCGTAGACCTCGTGCACTTCTGCTGCG
GTCGGGGCCGGAGTCTGGGCTGGAGCCACCGCAGGCCTCCCTCTGGGTCCTCCGCCGCGAGCTCCCTGCAGGTCTCTGCGGGGACAGCTT
AGGTGCGCCCGGAGCTTGCCTGCACCTGCGATCCAGAGCCAAGCGCCCCGCCCCTGCCCGGGCGCGCTCCCTCCTTAGCCCTGCCCCTCT
CTGACCCCACCTCCGACGCAAGAGTGGGGCGGGGCAGCTGCCGGTGGCGTCCCGAACCCAGACTCGCCCCGCCCCAGAGACTGCGCCTGC
GCGGGCACGAGACAACCTCTCCGCGATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTA
CGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTG
CCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCG
GCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGT
TTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTT
TCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGG
AGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCG
TACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGG
CGTGGAAAGCCAGGCTGTGTCCCTGGCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCG
AGGCAAAGAAGGTGCCATCATTGTGGATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGT
CTCTGGCCAAGGCCGAGACAATGCCCTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCT
CTGGGTCATCGACCAAGGTCTGAAAAAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAG
CCGCATGAGCGCCTCTATTCTCCTCAGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAA
CTACATCAAGAGCTGGTTTGAGGGCCAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGA
CGCTGGCAACCGGGCCTTGGAGCTGAGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGC
CGTGGAGGCTCTGATCCATGCAGCCGGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAA
GTGCAGCGAGAAGGACAGCATCCGCATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCA
GTTTGCTGAAGGCTCCACTCTCAAACTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGC
AGTGGAGGGCCTGGCTTACCTGACCTTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCT
CAGCAGGTTGGAGGAGAGGTCAGTGCTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCC
CAAGATGGTGGAGCTGGCCAAGTATGCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAA
GAAGCTGCTGGCAGCGGGTGTGGTGTCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCT
CTCCAGGGTCTTCTTGGCTTTAGTGGAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGC
CCTGGAAGGCACGGACGTGGGGCAGACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGG
CGAGCGGATCTATGAGGTGGTCCGGCCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCT
AACAAACCTGGCTGGGATCAGCGAGAGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAA
AGATCTTTTGTCAAAACCTGAGAAAATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACA
GCAGCAGCTTATTCATGTGATGGAGCACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGA
ACTGCTTCAGCAGCGGAACATAAGAAGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAG
ATACAGGCCTGATTCACTTGATGGCCCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCC
CTCAAATTCTGTTTCTCCTGGGGACTGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAG
GCCTTTATTCAATACCCATTTACAGAAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTA
TTTCCCAGGAAATGTTCTCACAAGCACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACC
TTCCTATGATATTGATAATTTTGACATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATC
TTCCACAGCTGCCTATCAACCCATCAAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCC
AGTGTCATCTACTGCTCAAAATATAAACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCT
GAAACATGAGCGTTTCCAAAGTCTTAGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAG
AACTAATCAGCTAGAGGCGATCAATGCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTA
CCAGCTCCCTGCCTGTGTTTCTCCTGGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTC
CTTGGATATTCCAGCTACATATCTGACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAAT
CATAAAACTTCTATATGTCACTCCAGAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTT
GGCACGTTTTGTTATTGATGAAGCACATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCA
GAAGTTTCCTTCTGTTCCGGTGATGGCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAG
ACCTCAGGTGTTTAGCATGAGCTTTAACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCT
AGAATGGATCAGAAAGCACCACCCATATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACA
GAGAGATGGGCTCGCTGCTCTTGCTTACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGG
CTGTCAGGTTATCTGTGCTACAATTGCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATC
TGTGGAGGGTTACTACCAAGAATCTGGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGAC
CAGACTGAAAAGACTTATAATGATGGAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTA
CTGTGAAAATATAACGGAATGCAGGAGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCC
AGATGTTTCTTGTGATAATTGCTGTAAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCA
AGAACATAGTTCATCACAAGGAATGAGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTT
GGGGAGTAAGAGTGCAAAAATCCAGTCAGGTATATTTGGAAAAGGATCTGCTTATTCACGACACAATGCCGAAAGACTTTTTAAAAAGCT
GATACTTGACAAGATTTTGGATGAAGACTTATATATCAATGCCAATGACCAGGCGATCGCTTATGTGATGCTCGGAAATAAAGCCCAAAC
TGTACTAAATGGCAATTTAAAGGTAGACTTTATGGAAACAGAAAATTCCAGCAGTGTGAAAAAACAAAAAGCGTTAGTAGCAAAAGTGTC
TCAGAGGGAAGAGATGGTTAAAAAATGTCTTGGAGAACTTACAGAAGTCTGCAAATCTCTGGGGAAAGTTTTTGGTGTCCATTACTTCAA
TATTTTTAATACCGTCACTCTCAAGAAGCTTGCAGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGA
CAAACTGGAAAAATATGGTGCGGAAGTGATTTCAGTATTACAGAAATACTCTGAATGGACATCGCCAGCTGAAGACAGTTCCCCAGGGAT
AAGCCTGTCCAGCAGCAGAGGCCCCGGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCTTCCCACTACTTTGCAAGTAA
AACCAGAAATGAAAGGAAGAGGAAAAAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCCAGTGGTTCCAAGGCAAAGGG
GGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGAC
ATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGCATTCTCATAACA
ACCGAATCTCAATGTACATAGACCCTCTTTCTTGTTTGTCAGCATCTGACCATCTGTGACTATAAAGCTGTTATTCTTGTTATACCATTT
GAAGTTTTTACTCGTCTCTATTAATATTTAAATAAATGCTGGGGGGTGATAGTTCTTCTTTTTAAAATAAACATTTTCTTTTGAATAAGC

>In-frame_UNC45A_ENST00000394275_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_6049nt
ACTTAACAACCGAAGTAACCCGCAATGCGGAAGGGCGAGGGGATTGCGAGTCACCGAGTTTCCCGCGCGGCTTGAGTCACGGCCTAGAAA
GAGAGATGTTGGGGTTCCCAGGACCAGGACAGAGGTGGTAGTGAACTCTCATGGGCATCCAGAGAAGGTCAGGCCCCTTGCTGACAGGCC
TATCTGTGGGGCTACTGCTGCTCTTCAGCTGGGTGACCCTTGTCCAGCCAACCTCTCTCTCAGCTCTGGTCCACCACCCTCACTTGTGCC
AGACCACCCGGGATGTCCATGGCCGTCACTACCCTGGTTTCTTTTGCCCTCGTCTGTCTGATTCTCCAGAGGAAGCCTACTGCTGCCACC
TGCAGGCTGCAGGGGGCTCCTGCTGCACCCGGGCTGAATTTGAGGCCCTGTACCAAGTCAATCTGTCCGCTCTTCCGCCCCCGCCCATCC
TCAGGGGCCCAGGCCCGCTCCTAGTGCTGGGCCTCTACAACCTACTGGTTGTGACCCTGATGACCGTAGACCTCGTGCACTTCTGCTGCG
GTCGGGGCCGGAGTCTGGGCTGGAGCCACCGCAGGCCTCCCTCTGGGTCCTCCGCCGCGAGCTCCCTGCAGGTCTCTGCGGGGACAGCTT
AGGTGCGCCCGGAGCTTGCCTGCACCTGCGATCCAGAGCCAAGCGCCCCGCCCCTGCCCGGGCGCGCTCCCTCCTTAGCCCTGCCCCTCT
CTGACCCCACCTCCGACGCAAGAGTGGGGCGGGGCAGCTGCCGGTGGCGTCCCGAACCCAGACTCGCCCCGCCCCAGAGACTGCGCCTGC
GCGGGCACGAGACAACCTCTCCGCGATGACTGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTA
CGGGGGCGCCCTGGCGGCCTACACTCAGGCCCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTG
CCACCTCAAGCTGGAAGATTACGACAAAGCAGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCG
GCGGAGCCAAGCCCTAGAGAAGCTGGGCCGCCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGT
TTTCCAGGAGGCCTTGCGGAACATCGGGGGCCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTT
TCAGATACTGTTGGACCCAGAAGAGAAGGGCACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGG
AGCGGAGAAGATCTTCCGGAGTAATGGGGTTCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCG
TACGCTGGTTGGCATTTGCTCTGAGCATCAGTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGG
CGTGGAAAGCCAGGCTGTGTCCCTGGCTGCCTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCG
AGGCAAAGAAGGTGCCATCATTGTGGATCCTGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGT
CTCTGGCCAAGGCCGAGACAATGCCCTGACCCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCT
CTGGGTCATCGACCAAGGTCTGAAAAAGATTTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAG
CCGCATGAGCGCCTCTATTCTCCTCAGCAAGCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAA
CTACATCAAGAGCTGGTTTGAGGGCCAAGGGCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGA
CGCTGGCAACCGGGCCTTGGAGCTGAGCGGTGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGC
CGTGGAGGCTCTGATCCATGCAGCCGGCAAGGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAA
GTGCAGCGAGAAGGACAGCATCCGCATCCGGGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCA
GTTTGCTGAAGGCTCCACTCTCAAACTGGCTAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGC
AGTGGAGGGCCTGGCTTACCTGACCTTTGATGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCT
CAGCAGGTTGGAGGAGAGGTCAGTGCTCTTTGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCC
CAAGATGGTGGAGCTGGCCAAGTATGCCAAGCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAA
GAAGCTGCTGGCAGCGGGTGTGGTGTCGGCCATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCT
CTCCAGGGTCTTCTTGGCTTTAGTGGAAGAGGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGC
CCTGGAAGGCACGGACGTGGGGCAGACAAAGGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGG
CGAGCGGATCTATGAGGTGGTCCGGCCCCTCGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCT
AACAAACCTGGCTGGGATCAGCGAGAGGCTCCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAA
AGATCTTTTGTCAAAACCTGAGAAAATGAGTATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACA
GCAGCAGCTTATTCATGTGATGGAGCACATCTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGA
ACTGCTTCAGCAGCGGAACATAAGAAGGAAACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAG
ATACAGGCCTGATTCACTTGATGGCCCTATGGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCC
CTCAAATTCTGTTTCTCCTGGGGACTGTTTACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAG
GCCTTTATTCAATACCCATTTACAGAAGTCCTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTA
TTTCCCAGGAAATGTTCTCACAAGCACTGCTGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACC
TTCCTATGATATTGATAATTTTGACATAGATGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATC
TTCCACAGCTGCCTATCAACCCATCAAGGAAGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCC
AGTGTCATCTACTGCTCAAAATATAAACTTCTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCT
GAAACATGAGCGTTTCCAAAGTCTTAGTTTTCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAG
AACTAATCAGCTAGAGGCGATCAATGCTGCACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTA
CCAGCTCCCTGCCTGTGTTTCTCCTGGGGTCACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTC
CTTGGATATTCCAGCTACATATCTGACAGGTGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAAT
CATAAAACTTCTATATGTCACTCCAGAAAAGATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTT
GGCACGTTTTGTTATTGATGAAGCACATTGTGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCA
GAAGTTTCCTTCTGTTCCGGTGATGGCTCTTACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAG
ACCTCAGGTGTTTAGCATGAGCTTTAACAGACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCT
AGAATGGATCAGAAAGCACCACCCATATGATTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACA
GAGAGATGGGCTCGCTGCTCTTGCTTACCATGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGG
CTGTCAGGTTATCTGTGCTACAATTGCATTTGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATC
TGTGGAGGGTTACTACCAAGAATCTGGCAGAGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGAC
CAGACTGAAAAGACTTATAATGATGGAAAAAGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTA
CTGTGAAAATATAACGGAATGCAGGAGAATACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCC
AGATGTTTCTTGTGATAATTGCTGTAAAACAAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCA
AGAACATAGTTCATCACAAGGAATGAGAAATATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTT
GGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGATTTC
AGTATTACAGAAATACTCTGAATGGACATCGCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCCGGAAGAAG
TGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAAAAGATGCC
AGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAA
AACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGC
TCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGCATTCTCATAACAACCGAATCTCAATGTACATAGACCCTCTTTCTT

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000355112_chr15_91298041_+_5821nt
AGAGACTGCGCCTGCGCGGGCACGAGACAACCTCTCCGCGATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGG
GGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGC
CCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGC
AGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCG
CCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGG
CCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGG
CACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGT
TCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCA
GTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTGGCTGC
CTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTGGATCC
TGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCCCTGAC
CCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAAAAGAT
TTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTCAGCAA
GCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGCCAAGG
GCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTGAGCGG
TGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCCGGCAA
GGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGCATCCG
GGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAACTGGC
TAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACCTTTGA
TGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTGCTCTT
TGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTATGCCAA
GCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTGTCGGC
CATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTGGAAGA
GGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAGACAAA
GGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGGCCCCT
CGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAGAGGCT
CCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAAATGAG
TATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAGCACAT
CTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGAAGGAA
ACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGCCCTAT
GGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGACTGTTT
ACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAGAAGTC
CTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGCACTGC
TGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGACATAGA
TGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATCAAGGA
AGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATAAACTT
CTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTTAGTTT
TCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAATGCTGC
ACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCTGGGGT
CACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTGACAGG
TGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCAGAAAA
GATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCACATTG
TGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATGGCTCT
TACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTTAACAG
ACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCATATGA
TTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCTTACCA
TGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATTGCATT
TGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCTGGCAG
AGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATGGAAAA
AGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGGAGAAT
ACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGTAAAAC
AAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATGAGAAA
TATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTTGGGGAGTAAGAGTGCAAAAATCCAGTCAGG
TATATTTGGAAAAGGATCTGCTTATTCACGACACAATGCCGAAAGACTTTTTAAAAAGCTGATACTTGACAAGATTTTGGATGAAGACTT
ATATATCAATGCCAATGACCAGGCGATCGCTTATGTGATGCTCGGAAATAAAGCCCAAACTGTACTAAATGGCAATTTAAAGGTAGACTT
TATGGAAACAGAAAATTCCAGCAGTGTGAAAAAACAAAAAGCGTTAGTAGCAAAAGTGTCTCAGAGGGAAGAGATGGTTAAAAAATGTCT
TGGAGAACTTACAGAAGTCTGCAAATCTCTGGGGAAAGTTTTTGGTGTCCATTACTTCAATATTTTTAATACCGTCACTCTCAAGAAGCT
TGCAGAATCTTTATCTTCTGATCCTGAGGTTTTGCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGAT
TTCAGTATTACAGAAATACTCTGAATGGACATCGCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCCGGAAG
AAGTGCCGCTGAGGAGCTCGACGAGGAAATACCCGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAAAAGAT
GCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAACTGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATATCTTC
CAAAACGAAATCCTCCAGCATCATTGGATCCAGTTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTAT
GGCTCCACCGAAGCCTATAAATAGACCGTTTCTTAAGCCTTCATATGCATTCTCATAACAACCGAATCTCAATGTACATAGACCCTCTTT
CTTGTTTGTCAGCATCTGACCATCTGTGACTATAAAGCTGTTATTCTTGTTATACCATTTGAAGTTTTTACTCGTCTCTATTAATATTTA

>In-frame_UNC45A_ENST00000418476_chr15_91493845_+_BLM_ENST00000560509_chr15_91298041_+_5299nt
AGAGACTGCGCCTGCGCGGGCACGAGACAACCTCTCCGCGATGACTGTGAGTGGTCCAGGGACCCCCGAGCCCCGGCCGGCCACCCCCGG
GGCCAGCTCAGTGGAGCAGCTGCGGAAGGAGGGCAATGAGCTGTTCAAATGTGGAGACTACGGGGGCGCCCTGGCGGCCTACACTCAGGC
CCTGGGTCTGGACGCGACGCCCCAGGACCAGGCCGTTCTGCACCGGAACCGGGCCGCCTGCCACCTCAAGCTGGAAGATTACGACAAAGC
AGAAACAGAGGCATCCAAAGCCATTGAAAAGGATGGTGGGGATGTCAAAGCACTCTACCGGCGGAGCCAAGCCCTAGAGAAGCTGGGCCG
CCTGGACCAGGCTGTCCTTGACCTGCAGAGATGTGTGAGCTTGGAGCCCAAGAACAAAGTTTTCCAGGAGGCCTTGCGGAACATCGGGGG
CCAGATTCAGGAGAAGGTGCGATACATGTCCTCGACGGATGCCAAAGTGGAACAGATGTTTCAGATACTGTTGGACCCAGAAGAGAAGGG
CACTGAGAAAAAGCAAAAGGCTTCTCAGAACCTGGTGGTGCTGGCCAGGGAGGATGCTGGAGCGGAGAAGATCTTCCGGAGTAATGGGGT
TCAGCTCTTGCAACGTTTACTGGACATGGGAGAGACTGACCTCATGCTGGCGGCTCTGCGTACGCTGGTTGGCATTTGCTCTGAGCATCA
GTCACGGACAGTGGCAACCCTGAGCATACTGGGAACTCGGCGAGTAGTCTCCATCCTGGGCGTGGAAAGCCAGGCTGTGTCCCTGGCTGC
CTGCCACCTGCTGCAGGTTATGTTTGATGCCCTCAAGGAAGGTGTCAAAAAAGGCTTCCGAGGCAAAGAAGGTGCCATCATTGTGGATCC
TGCCCGGGAGCTGAAGGTCCTCATCAGTAACCTCTTAGATCTGCTGACAGAGGTGGGGGTCTCTGGCCAAGGCCGAGACAATGCCCTGAC
CCTCCTGATTAAAGCGGTGCCCCGGAAGTCTCTCAAGGACCCCAACAACAGCCTCACCCTCTGGGTCATCGACCAAGGTCTGAAAAAGAT
TTTGGAAGTGGGGGGCTCTCTACAGGACCCTCCTGGGGAGCTCGCAGTGACCGCAAACAGCCGCATGAGCGCCTCTATTCTCCTCAGCAA
GCTCTTTGATGACCTCAAGTGTGATGCGGAGAGGGAGAATTTCCACAGACTTTGTGAAAACTACATCAAGAGCTGGTTTGAGGGCCAAGG
GCTGGCCGGGAAGCTACGGGCCATCCAGACGGTGTCCTGCCTCCTGCAGGGCCCATGTGACGCTGGCAACCGGGCCTTGGAGCTGAGCGG
TGTCATGGAGAGTGTGATTGCTCTGTGTGCCTCTGAGCAGGAGGAGGAGCAGCTGGTGGCCGTGGAGGCTCTGATCCATGCAGCCGGCAA
GGCTAAGCGGGCCTCATTCATCACTGCCAATGGTGTCTCGCTGCTGAAGGACCTATATAAGTGCAGCGAGAAGGACAGCATCCGCATCCG
GGCGCTAGTGGGACTCTGTAAGCTCGGTTCGGCTGGAGGGACTGACTTCAGCATGAAGCAGTTTGCTGAAGGCTCCACTCTCAAACTGGC
TAAGCAGTGTCGAAAGTGGCTGTGCAATGACCAGATCGACGCAGGCACTCGGCGCTGGGCAGTGGAGGGCCTGGCTTACCTGACCTTTGA
TGCCGACGTGAAGGAAGAGTTTGTGGAGGATGCGGCTGCTCTGAAAGCTCTGTTCCAGCTCAGCAGGTTGGAGGAGAGGTCAGTGCTCTT
TGCGGTGGCCTCAGCGCTGGTGAACTGCACCAACAGCTATGACTACGAGGAGCCCGACCCCAAGATGGTGGAGCTGGCCAAGTATGCCAA
GCAGCATGTGCCCGAGCAGCACCCCAAGGACAAGCCAAGCTTCGTGCGGGCTCGGGTGAAGAAGCTGCTGGCAGCGGGTGTGGTGTCGGC
CATGGTGTGCATGGTGAAGACGGAGAGCCCTGTGCTGACCAGTTCCTGCAGAGAGCTGCTCTCCAGGGTCTTCTTGGCTTTAGTGGAAGA
GGTAGAGGACCGAGGCACTGTGGTTGCCCAGGGAGGCGGCAGGGCGCTGATCCCGCTGGCCCTGGAAGGCACGGACGTGGGGCAGACAAA
GGCAGCCCAGGCCCTTGCCAAGCTCACCATCACCTCCAACCCGGAGATGACCTTCCCTGGCGAGCGGATCTATGAGGTGGTCCGGCCCCT
CGTCTCCCTGTTGCACCTCAACTGCTCAGGCCTGCAGAACTTCGAGGCGCTCATGGCCCTAACAAACCTGGCTGGGATCAGCGAGAGGCT
CCGTACGTTAAAGGACCTTGACACCTCTGACAGAAAAGAGGATGTTCTTAGCACATCAAAAGATCTTTTGTCAAAACCTGAGAAAATGAG
TATGCAGGAGCTGAATCCAGAAACCAGCACAGACTGTGACGCTAGACAGATAAGTTTACAGCAGCAGCTTATTCATGTGATGGAGCACAT
CTGTAAATTAATTGATACTATTCCTGATGATAAACTGAAACTTTTGGATTGTGGGAACGAACTGCTTCAGCAGCGGAACATAAGAAGGAA
ACTTCTAACGGAAGTAGATTTTAATAAAAGTGATGCCAGTCTTCTTGGCTCATTGTGGAGATACAGGCCTGATTCACTTGATGGCCCTAT
GGAGGGTGATTCCTGCCCTACAGGGAATTCTATGAAGGAGTTAAATTTTTCACACCTTCCCTCAAATTCTGTTTCTCCTGGGGACTGTTT
ACTGACTACCACCCTAGGAAAGACAGGATTCTCTGCCACCAGGAAGAATCTTTTTGAAAGGCCTTTATTCAATACCCATTTACAGAAGTC
CTTTGTAAGTAGCAACTGGGCTGAAACACCAAGACTAGGAAAAAAAAATGAAAGCTCTTATTTCCCAGGAAATGTTCTCACAAGCACTGC
TGTGAAAGATCAGAATAAACATACTGCTTCAATAAATGACTTAGAAAGAGAAACCCAACCTTCCTATGATATTGATAATTTTGACATAGA
TGACTTTGATGATGATGATGACTGGGAAGACATAATGCATAATTTAGCAGCCAGCAAATCTTCCACAGCTGCCTATCAACCCATCAAGGA
AGGTCGGCCAATTAAATCAGTATCAGAAAGACTTTCCTCAGCCAAGACAGACTGTCTTCCAGTGTCATCTACTGCTCAAAATATAAACTT
CTCAGAGTCAATTCAGAATTATACTGACAAGTCAGCACAAAATTTAGCATCCAGAAATCTGAAACATGAGCGTTTCCAAAGTCTTAGTTT
TCCTCATACAAAGGAAATGATGAAGATTTTTCATAAAAAATTTGGCCTGCATAATTTTAGAACTAATCAGCTAGAGGCGATCAATGCTGC
ACTGCTTGGTGAAGACTGTTTTATCCTGATGCCGACTGGAGGTGGTAAGAGTTTGTGTTACCAGCTCCCTGCCTGTGTTTCTCCTGGGGT
CACTGTTGTCATTTCTCCCTTGAGATCACTTATCGTAGATCAAGTCCAAAAGCTGACTTCCTTGGATATTCCAGCTACATATCTGACAGG
TGATAAGACTGACTCAGAAGCTACAAATATTTACCTCCAGTTATCAAAAAAAGACCCAATCATAAAACTTCTATATGTCACTCCAGAAAA
GATCTGTGCAAGTAACAGACTCATTTCTACTCTGGAGAATCTCTATGAGAGGAAGCTCTTGGCACGTTTTGTTATTGATGAAGCACATTG
TGTCAGTCAGTGGGGACATGATTTTCGTCAAGATTACAAAAGAATGAATATGCTTCGCCAGAAGTTTCCTTCTGTTCCGGTGATGGCTCT
TACGGCCACAGCTAATCCCAGGGTACAGAAGGACATCCTGACTCAGCTGAAGATTCTCAGACCTCAGGTGTTTAGCATGAGCTTTAACAG
ACATAATCTGAAATACTATGTATTACCGAAAAAGCCTAAAAAGGTGGCATTTGATTGCCTAGAATGGATCAGAAAGCACCACCCATATGA
TTCAGGGATAATTTACTGCCTCTCCAGGCGAGAATGTGACACCATGGCTGACACGTTACAGAGAGATGGGCTCGCTGCTCTTGCTTACCA
TGCTGGCCTCAGTGATTCTGCCAGAGATGAAGTGCAGCAGAAGTGGATTAATCAGGATGGCTGTCAGGTTATCTGTGCTACAATTGCATT
TGGAATGGGGATTGACAAACCGGACGTGCGATTTGTGATTCATGCATCTCTCCCTAAATCTGTGGAGGGTTACTACCAAGAATCTGGCAG
AGCTGGAAGAGATGGGGAAATATCTCACTGCCTGCTTTTCTATACCTATCATGATGTGACCAGACTGAAAAGACTTATAATGATGGAAAA
AGATGGAAACCATCATACAAGAGAAACTCACTTCAATAATTTGTATAGCATGGTACATTACTGTGAAAATATAACGGAATGCAGGAGAAT
ACAGCTTTTGGCCTACTTTGGTGAAAATGGATTTAATCCTGATTTTTGTAAGAAACACCCAGATGTTTCTTGTGATAATTGCTGTAAAAC
AAAGGATTATAAAACAAGAGATGTGACTGACGATGTGAAAAGTATTGTAAGATTTGTTCAAGAACATAGTTCATCACAAGGAATGAGAAA
TATAAAACATGTAGGTCCTTCTGGAAGATTTACTATGAATATGCTGGTCGACATTTTCTTGGAATCTTTATCTTCTGATCCTGAGGTTTT
GCTTCAAATTGATGGTGTTACTGAAGACAAACTGGAAAAATATGGTGCGGAAGTGATTTCAGTATTACAGAAATACTCTGAATGGACATC
GCCAGCTGAAGACAGTTCCCCAGGGATAAGCCTGTCCAGCAGCAGAGGCCCCGGAAGAAGTGCCGCTGAGGAGCTCGACGAGGAAATACC
CGTATCTTCCCACTACTTTGCAAGTAAAACCAGAAATGAAAGGAAGAGGAAAAAGATGCCAGCCTCCCAAAGGTCTAAGAGGAGAAAAAC
TGCTTCCAGTGGTTCCAAGGCAAAGGGGGGGTCTGCCACATGTAGAAAGATATCTTCCAAAACGAAATCCTCCAGCATCATTGGATCCAG
TTCAGCCTCACATACTTCTCAAGCGACATCAGGAGCCAATAGCAAATTGGGGATTATGGCTCCACCGAAGCCTATAAATAGACCGTTTCT


Top

FusionGenePPI for UNC45A_BLM


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UNC45AUSP19, CLN3, FBXO25, USP14, UBXN1, TWF1, CSE1L, UBE3A, USP1, TXNDC5, WDR5, PSMD13, UFD1L, RPA3, UCHL5, ESR1, HSP90AA1, SMAD9, UGGT1, ACBD3, CSNK1A1, CSNK1E, CDC37, FAM83H, HUWE1, MAX, MEOX2, MID2, MARCH10, KRTAP10-3, ATP6V1A, NAPA, PPME1, RAP1GDS1, RNF20, PLCG1, NTRK1, NUP85, AHI1, OFD1, MKS1, CC2D2A, CCP110, CEP170, KIAA0753, CEP162, CEP120, FGFR1OP, CEP128, CEP89, FBF1, NIN, NPHP1, SCLT1, CEP19, EVC2, NEK8, SASS6, POC1A, POC1B, RPGRIP1, RPGR, STIL, CENPJ, CAPZA2, MYH9, MYO1C, XRCC3, MYO19, SNW1, CDC5L, FAF2, HSP90AB1, ZNF746, CDH1, CDK17, MYH14, SLC27A2, MYO1E, CYLD, LMNA, TESBLMTOP3A, FANCD2, TP53, TP53BP1, H2AFX, FEN1, ATM, BRCA1, MLH1, MRE11A, MSH2, MSH6, NBN, RAD50, CASP3, CHAF1A, RAD51D, XRCC2, RAD51, RPA1, CHEK1, TERF2, WRN, FANCA, RFC1, MX1, EXO1, FANCM, UBE2I, SYN1, MCRS1, PSMD3, BRIP1, APITD1, RMI1, ATR, PAXIP1, RPA2, RPA3, FANCG, SIRT7, COPS5, CAND1, ATRX, TEP1, BLM, HSP90AA1, TOP2A, SF3B2, MAGOH, EIF4A3, TERF1, RNF8, TRIM49, UIMC1, SUMO1, SUMO2, UPF2, TOPBP1, PARP1, MIB1, PWP1, STRA13, FAN1, EGFR, NEK11, C17orf70, RMI2, AQR, VCP, MMS22L, ELK4, RPS14, ICK, XIAP, SNRNP200, POU3F3, SUPT5H, RPS27A, ACTR5, RPL37, RAD23B, TRIM15, TRIM8, TREX2, RPL14, RREB1, RPL7, ALDH3B1, RPS19, MORF4L2, HIST1H2AI, NDUFA13, KLF16, CSNK2B, CARS2, AKR1B1, RAMP1, PSMD1, HES5, RPL23A, URI1, CEBPD, DYNLT1, CASP8, MCM3AP, HPS5, CORO7, FAM192A, FOXP1, SNW1, APBB1, PHF8, PPM1H, MECP2, ZNF512, AIPL1, MIOS, FGFR1OP, PDE5A, NEK4, CHEK2, ADA, WEE1, MAP2K1, RABGGTB, FNTA, TUBA1A, COX15, MYC, JUN, FBXW7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UNC45A_BLM


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UNC45A_BLM


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneBLMC0005859Bloom Syndrome4CTD_human;ORPHANET;UNIPROT