FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40787

FusionGeneSummary for UNC13B_DNER

check button Fusion gene summary
Fusion gene informationFusion gene name: UNC13B_DNER
Fusion gene ID: 40787
HgeneTgene
Gene symbol

UNC13B

DNER

Gene ID

10497

92737

Gene nameunc-13 homolog Bdelta/notch like EGF repeat containing
SynonymsMUNC13|UNC13|Unc13h2UNQ26|bet
Cytomap

9p13.3

2q36.3

Type of geneprotein-codingprotein-coding
Descriptionprotein unc-13 homolog Bhomolog of rat Munc13 (diacylglycerol-binding)munc13-2unc-13-likedelta and Notch-like epidermal growth factor-related receptorH_NH0150O02.1WUGSC:H_NH0150O02.1delta-notch-like EGF repeat-containing transmembrane
Modification date2018052320180519
UniProtAcc

O14795

Q8NFT8

Ensembl transtripts involved in fusion geneENST00000396787, ENST00000378495, 
ENST00000378496, ENST00000481299, 
ENST00000341772, ENST00000482831, 
Fusion gene scores* DoF score9 X 6 X 6=3243 X 3 X 3=27
# samples 93
** MAII scorelog2(9/324*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: UNC13B [Title/Abstract] AND DNER [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneUNC13B

GO:0043065

positive regulation of apoptotic process

10233166

HgeneUNC13B

GO:0050714

positive regulation of protein secretion

19641095

HgeneUNC13B

GO:0071333

cellular response to glucose stimulus

19641095


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AO-A03V-01AUNC13Bchr9

35162302

+DNERchr2

230282946

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000396787ENST00000341772UNC13Bchr9

35162302

+DNERchr2

230282946

-
5CDS-intronENST00000396787ENST00000482831UNC13Bchr9

35162302

+DNERchr2

230282946

-
In-frameENST00000378495ENST00000341772UNC13Bchr9

35162302

+DNERchr2

230282946

-
5CDS-intronENST00000378495ENST00000482831UNC13Bchr9

35162302

+DNERchr2

230282946

-
In-frameENST00000378496ENST00000341772UNC13Bchr9

35162302

+DNERchr2

230282946

-
5CDS-intronENST00000378496ENST00000482831UNC13Bchr9

35162302

+DNERchr2

230282946

-
intron-3CDSENST00000481299ENST00000341772UNC13Bchr9

35162302

+DNERchr2

230282946

-
intron-intronENST00000481299ENST00000482831UNC13Bchr9

35162302

+DNERchr2

230282946

-

Top

FusionProtFeatures for UNC13B_DNER


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UNC13B

O14795

DNER

Q8NFT8

Plays a role in vesicle maturation during exocytosis asa target of the diacylglycerol second messenger pathway. Isinvolved in neurotransmitter release by acting in synaptic vesiclepriming prior to vesicle fusion and participates in the activity-depending refilling of readily releasable vesicle pool (RRP).Essential for synaptic vesicle maturation in a subset ofexcitatory/glutamatergic but not inhibitory/GABA-mediated synapses(By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713505_541495738DomainEGF-like 8%3B calcium-binding
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713543_579495738DomainEGF-like 9
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713546_568495738DomainNote=Follistatin-like
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713581_617495738DomainEGF-like 10%3B calcium-binding
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713662_737495738Topological domainCytoplasmic
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713641_661495738TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+1391172_120271592Coiled coilOntology_term=ECO:0000255
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+1391013_115671592DomainMHD1
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+1391263_140571592DomainMHD2
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+1391425_153071592DomainC2 3
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+1391_7971592DomainC2 1
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+139587_69371592DomainC2 2
HgeneUNC13Bchr9:35162302chr2:230282946ENST00000378495+139477_52771592Zinc fingerPhorbol-ester/DAG-type
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713309_348495738DomainEGF-like 3
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713349_390495738DomainEGF-like 4
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713392_428495738DomainEGF-like 5
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713430_466495738DomainEGF-like 6
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-71344_92495738DomainEGF-like 1
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713468_503495738DomainEGF-like 7
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-71394_133495738DomainEGF-like 2
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-71335_640495738Topological domainExtracellular


Top

FusionGeneSequence for UNC13B_DNER


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UNC13B_ENST00000396787_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_250aa
MSLLCVRGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEEC
DIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIE

>In-frame_UNC13B_ENST00000378495_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_250aa
MSLLCVRGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEEC
DIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIE

>In-frame_UNC13B_ENST00000378496_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_250aa
MSLLCVRGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHCELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEEC
DIDINECDSNPCHHGGSCLDQPNGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UNC13B_ENST00000396787_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_750nt
ATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAGGAATATAATGAGTGCCTCTCCGCTCCATGCCTGAATGCAGCC
ACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAATACAAAGGAACACACTGTGAATTGTACAAGGATCCCTGCGCT
AACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAATGGCACGTGCATCTGTGCACCCGGGTTTACAGGTGAAGAGTGC
GACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGGAGCTGCCTGGACCAGCCCAATGGTTATAACTGCCACTGCCCG
CATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCCGGGCACATGGCGGAGAGCCTCACCAACATGCCACGGCACTCC
CTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTGATCATCCTGATCGTGGGGATTTGCCGCATCAGCCGCATTGAA
TACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGCAGCATCGACAGCGAGTTCAGCAATGCCATTGCATCCATCCGG
CATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGCCCCATCGCCTATGAAGATTACAGTCCTGATGACAAACCCTTG

>In-frame_UNC13B_ENST00000378495_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_750nt
ATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAGGAATATAATGAGTGCCTCTCCGCTCCATGCCTGAATGCAGCC
ACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAATACAAAGGAACACACTGTGAATTGTACAAGGATCCCTGCGCT
AACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAATGGCACGTGCATCTGTGCACCCGGGTTTACAGGTGAAGAGTGC
GACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGGAGCTGCCTGGACCAGCCCAATGGTTATAACTGCCACTGCCCG
CATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCCGGGCACATGGCGGAGAGCCTCACCAACATGCCACGGCACTCC
CTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTGATCATCCTGATCGTGGGGATTTGCCGCATCAGCCGCATTGAA
TACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGCAGCATCGACAGCGAGTTCAGCAATGCCATTGCATCCATCCGG
CATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGCCCCATCGCCTATGAAGATTACAGTCCTGATGACAAACCCTTG

>In-frame_UNC13B_ENST00000378496_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_750nt
ATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAGGAATATAATGAGTGCCTCTCCGCTCCATGCCTGAATGCAGCC
ACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAATACAAAGGAACACACTGTGAATTGTACAAGGATCCCTGCGCT
AACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAATGGCACGTGCATCTGTGCACCCGGGTTTACAGGTGAAGAGTGC
GACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGGAGCTGCCTGGACCAGCCCAATGGTTATAACTGCCACTGCCCG
CATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCCGGGCACATGGCGGAGAGCCTCACCAACATGCCACGGCACTCC
CTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTGATCATCCTGATCGTGGGGATTTGCCGCATCAGCCGCATTGAA
TACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGCAGCATCGACAGCGAGTTCAGCAATGCCATTGCATCCATCCGG
CATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGCCCCATCGCCTATGAAGATTACAGTCCTGATGACAAACCCTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_UNC13B_ENST00000396787_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_1943nt
GGGAGGGAGTCCCGGCAGCTCCTACCTCCCAGCGATGGCGTCGCTGTGCCGCGCCCAGTCCCCAGCCTGCCGGCCGGTACTCACCGCTAC
CCGGAGTTCGCTCAGACGGTGAGATTTGGGGCGGGTCCGAGGCAGCGGCGGGACGCTACCTGCGACCGGGACCATGAGGAGCTGCCAGAC
CCGTGGGGCCGGTAACGAGAGCAGTCGCGGCACCTGCTGAGAGGAAAGAGGGAGCGGTCCGGCGCGGCTGGGGCGCGGCAGAGGCTTGCC
CGATCCTCGGCCATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAGGAATATAATGAGTGCCTCTCCGCTCCATGC
CTGAATGCAGCCACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAATACAAAGGAACACACTGTGAATTGTACAAG
GATCCCTGCGCTAACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAATGGCACGTGCATCTGTGCACCCGGGTTTACA
GGTGAAGAGTGCGACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGGAGCTGCCTGGACCAGCCCAATGGTTATAAC
TGCCACTGCCCGCATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCCGGGCACATGGCGGAGAGCCTCACCAACATG
CCACGGCACTCCCTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTGATCATCCTGATCGTGGGGATTTGCCGCATC
AGCCGCATTGAATACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGCAGCATCGACAGCGAGTTCAGCAATGCCATT
GCATCCATCCGGCATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGCCCCATCGCCTATGAAGATTACAGTCCTGAT
GACAAACCCTTGGTCACACTGATTAAAACTAAAGATTTGTAATCTTTTTTTGGATTATTTTTCAAAAAGATGAGATACTACACTCATTTA
AATATTTTTAAGAAAATAAAAAGCTTAAGAAATTTAAAATGCTAGCTGCTCAAGAGTTTTCAGTAGAATATTTAAGAACTAATTTTCTGC
AGCTTTTAGTTTGGAAAAAATATTTTAAAAACAAAATTTGTGAAACCTATAGACGATGTTTTAATGTACCTTCAGCTCTCTAAACTGTGT
GCTTCTACTAGTGTGTGCTCTTTTCACTGTAGACACTATCACGAGACCCAGATTAATTTCTGTGGTTGTTACAGAATAAGTCTAATCAAG
GAGAAGTTTCTGTTTGACGTTTGAGTGCCGGCTTTCTGAGTAGAGTTAGGAAAACCACGTAACGTAGCATATGATGTATAATAGAGTATA
CCCGTTACTTAAAAAGAAGTCTGAAATGTTCGTTTTGTGGAAAAGAAACTAGTTAAATTTACTATTCCTAACCCGAATGAAATTAGCCTT
TGCCTTATTCTGTGCATGGGTAAGTAACTTATTTCTGCACTGTTTTGTTGAACTTTGTGGAAACATTCTTTCGAGTTTGTTTTTGTCATT
TTCGTAACAGTCGTCGAACTAGGCCTCAAAAACATACGTAACGAAAAGGCCTAGCGAGGCAAATTCTGATTGATTTGAATCTATATTTTT
CTTTAAAAAGTCAAGGGTTCTATATTGTGAGTAAATTAAATTTACATTTGAGTTGTTTGTTGCTAAGAGGTAGTAAATGTAAGAGAGTAC
TGGTTCCTTCAGTAGTGAGTATTTCTCATAGTGCAGCTTTATTTATCTCCAGGATGTTTTTGTGGCTGTATTTGATTGATATGTGCTTCT

>In-frame_UNC13B_ENST00000378495_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_1883nt
CCCAGCCTGCCGGCCGGTACTCACCGCTACCCGGAGTTCGCTCAGACGGTGAGATTTGGGGCGGGTCCGAGGCAGCGGCGGGACGCTACC
TGCGACCGGGACCATGAGGAGCTGCCAGACCCGTGGGGCCGGTAACGAGAGCAGTCGCGGCACCTGCTGAGAGGAAAGAGGGAGCGGTCC
GGCGCGGCTGGGGCGCGGCAGAGGCTTGCCCGATCCTCGGCCATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAG
GAATATAATGAGTGCCTCTCCGCTCCATGCCTGAATGCAGCCACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAA
TACAAAGGAACACACTGTGAATTGTACAAGGATCCCTGCGCTAACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAAT
GGCACGTGCATCTGTGCACCCGGGTTTACAGGTGAAGAGTGCGACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGG
AGCTGCCTGGACCAGCCCAATGGTTATAACTGCCACTGCCCGCATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCC
GGGCACATGGCGGAGAGCCTCACCAACATGCCACGGCACTCCCTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTG
ATCATCCTGATCGTGGGGATTTGCCGCATCAGCCGCATTGAATACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGC
AGCATCGACAGCGAGTTCAGCAATGCCATTGCATCCATCCGGCATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGC
CCCATCGCCTATGAAGATTACAGTCCTGATGACAAACCCTTGGTCACACTGATTAAAACTAAAGATTTGTAATCTTTTTTTGGATTATTT
TTCAAAAAGATGAGATACTACACTCATTTAAATATTTTTAAGAAAATAAAAAGCTTAAGAAATTTAAAATGCTAGCTGCTCAAGAGTTTT
CAGTAGAATATTTAAGAACTAATTTTCTGCAGCTTTTAGTTTGGAAAAAATATTTTAAAAACAAAATTTGTGAAACCTATAGACGATGTT
TTAATGTACCTTCAGCTCTCTAAACTGTGTGCTTCTACTAGTGTGTGCTCTTTTCACTGTAGACACTATCACGAGACCCAGATTAATTTC
TGTGGTTGTTACAGAATAAGTCTAATCAAGGAGAAGTTTCTGTTTGACGTTTGAGTGCCGGCTTTCTGAGTAGAGTTAGGAAAACCACGT
AACGTAGCATATGATGTATAATAGAGTATACCCGTTACTTAAAAAGAAGTCTGAAATGTTCGTTTTGTGGAAAAGAAACTAGTTAAATTT
ACTATTCCTAACCCGAATGAAATTAGCCTTTGCCTTATTCTGTGCATGGGTAAGTAACTTATTTCTGCACTGTTTTGTTGAACTTTGTGG
AAACATTCTTTCGAGTTTGTTTTTGTCATTTTCGTAACAGTCGTCGAACTAGGCCTCAAAAACATACGTAACGAAAAGGCCTAGCGAGGC
AAATTCTGATTGATTTGAATCTATATTTTTCTTTAAAAAGTCAAGGGTTCTATATTGTGAGTAAATTAAATTTACATTTGAGTTGTTTGT
TGCTAAGAGGTAGTAAATGTAAGAGAGTACTGGTTCCTTCAGTAGTGAGTATTTCTCATAGTGCAGCTTTATTTATCTCCAGGATGTTTT

>In-frame_UNC13B_ENST00000378496_chr9_35162302_+_DNER_ENST00000341772_chr2_230282946_-_1841nt
CAGACGGTGAGATTTGGGGCGGGTCCGAGGCAGCGGCGGGACGCTACCTGCGACCGGGACCATGAGGAGCTGCCAGACCCGTGGGGCCGG
TAACGAGAGCAGTCGCGGCACCTGCTGAGAGGAAAGAGGGAGCGGTCCGGCGCGGCTGGGGCGCGGCAGAGGCTTGCCCGATCCTCGGCC
ATGTCACTGCTCTGCGTGCGCGGTTACCATGGCCTCTACTGTGAGGAGGAATATAATGAGTGCCTCTCCGCTCCATGCCTGAATGCAGCC
ACCTGCAGGGACCTCGTTAATGGCTATGAGTGTGTGTGCCTGGCAGAATACAAAGGAACACACTGTGAATTGTACAAGGATCCCTGCGCT
AACGTCAGCTGTCTGAACGGAGCCACCTGTGACAGCGACGGCCTGAATGGCACGTGCATCTGTGCACCCGGGTTTACAGGTGAAGAGTGC
GACATTGACATAAATGAATGTGACAGTAACCCCTGCCACCATGGTGGGAGCTGCCTGGACCAGCCCAATGGTTATAACTGCCACTGCCCG
CATGGTTGGGTGGGAGCAAACTGTGAGATCCACCTCCAATGGAAGTCCGGGCACATGGCGGAGAGCCTCACCAACATGCCACGGCACTCC
CTCTACATCATCATTGGAGCCCTCTGCGTGGCCTTCATCCTTATGCTGATCATCCTGATCGTGGGGATTTGCCGCATCAGCCGCATTGAA
TACCAGGGTTCTTCCAGGCCAGCCTATGAGGAGTTCTACAACTGCCGCAGCATCGACAGCGAGTTCAGCAATGCCATTGCATCCATCCGG
CATGCCAGGTTTGGAAAGAAATCCCGGCCTGCAATGTATGATGTGAGCCCCATCGCCTATGAAGATTACAGTCCTGATGACAAACCCTTG
GTCACACTGATTAAAACTAAAGATTTGTAATCTTTTTTTGGATTATTTTTCAAAAAGATGAGATACTACACTCATTTAAATATTTTTAAG
AAAATAAAAAGCTTAAGAAATTTAAAATGCTAGCTGCTCAAGAGTTTTCAGTAGAATATTTAAGAACTAATTTTCTGCAGCTTTTAGTTT
GGAAAAAATATTTTAAAAACAAAATTTGTGAAACCTATAGACGATGTTTTAATGTACCTTCAGCTCTCTAAACTGTGTGCTTCTACTAGT
GTGTGCTCTTTTCACTGTAGACACTATCACGAGACCCAGATTAATTTCTGTGGTTGTTACAGAATAAGTCTAATCAAGGAGAAGTTTCTG
TTTGACGTTTGAGTGCCGGCTTTCTGAGTAGAGTTAGGAAAACCACGTAACGTAGCATATGATGTATAATAGAGTATACCCGTTACTTAA
AAAGAAGTCTGAAATGTTCGTTTTGTGGAAAAGAAACTAGTTAAATTTACTATTCCTAACCCGAATGAAATTAGCCTTTGCCTTATTCTG
TGCATGGGTAAGTAACTTATTTCTGCACTGTTTTGTTGAACTTTGTGGAAACATTCTTTCGAGTTTGTTTTTGTCATTTTCGTAACAGTC
GTCGAACTAGGCCTCAAAAACATACGTAACGAAAAGGCCTAGCGAGGCAAATTCTGATTGATTTGAATCTATATTTTTCTTTAAAAAGTC
AAGGGTTCTATATTGTGAGTAAATTAAATTTACATTTGAGTTGTTTGTTGCTAAGAGGTAGTAAATGTAAGAGAGTACTGGTTCCTTCAG
TAGTGAGTATTTCTCATAGTGCAGCTTTATTTATCTCCAGGATGTTTTTGTGGCTGTATTTGATTGATATGTGCTTCTTCTGATTCTTGC


Top

FusionGenePPI for UNC13B_DNER


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UNC13BSTX1A, SPTBN2, RPH3AL, STX1B, RIMS1, DOC2A, VAMP2, SNAP25, WDR48, BARD1, ECT2, RAB27A, CLK1, UBXN10, CCDC40, DIRAS2, PTPN4DNERTRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-713677_680495738AP1G1 and somatodendritic targeting


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneDNERchr9:35162302chr2:230282946ENST00000341772-71344_133495738NOTCH1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UNC13B_DNER


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UNC13B_DNER


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource