FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40625

FusionGeneSummary for UBTD2_STK10

check button Fusion gene summary
Fusion gene informationFusion gene name: UBTD2_STK10
Fusion gene ID: 40625
HgeneTgene
Gene symbol

UBTD2

STK10

Gene ID

92181

6793

Gene nameubiquitin domain containing 2serine/threonine kinase 10
SynonymsDCUBPLOK|PRO2729
Cytomap

5q35.1

5q35.1

Type of geneprotein-codingprotein-coding
Descriptionubiquitin domain-containing protein 2ubiquitin-like protein SB72serine/threonine-protein kinase 10lymphocyte-oriented kinase
Modification date2018052220180523
UniProtAcc

Q8WUN7

O94804

Ensembl transtripts involved in fusion geneENST00000393792, ENST00000176763, 
ENST00000517775, 
Fusion gene scores* DoF score7 X 4 X 6=16810 X 10 X 4=400
# samples 810
** MAII scorelog2(8/168*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/400*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: UBTD2 [Title/Abstract] AND STK10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSTK10

GO:0046777

protein autophosphorylation

12639966|18239682


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-CC-A3MB-01AUBTD2chr5

171710600

-STK10chr5

171554425

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393792ENST00000176763UBTD2chr5

171710600

-STK10chr5

171554425

-
5CDS-intronENST00000393792ENST00000517775UBTD2chr5

171710600

-STK10chr5

171554425

-

Top

FusionProtFeatures for UBTD2_STK10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UBTD2

Q8WUN7

STK10

O94804

Serine/threonine-protein kinase involved in regulationof lymphocyte migration. Phosphorylates MSN, and possibly PLK1.Involved in regulation of lymphocyte migration by mediatingphosphorylation of ERM proteins such as MSN. Acts as a negativeregulator of MAP3K1/MEKK1. May also act as a cell cycle regulatorby acting as a polo kinase kinase: mediates phosphorylation ofPLK1 in vitro; however such data require additional evidences invivo. {ECO:0000269|PubMed:11903060, ECO:0000269|PubMed:12639966,ECO:0000269|PubMed:19255442}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSTK10chr5:171710600chr5:171554425ENST00000176763-119573_947107969Coiled coilOntology_term=ECO:0000255
TgeneSTK10chr5:171710600chr5:171554425ENST00000176763-119750_884107969Compositional biasNote=Gln-rich
TgeneSTK10chr5:171710600chr5:171554425ENST00000176763-119175_224107969RegionNote=Activation segment

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBTD2chr5:171710600chr5:171554425ENST00000393792-13152_22723235DomainUbiquitin-like
TgeneSTK10chr5:171710600chr5:171554425ENST00000176763-11936_294107969DomainProtein kinase
TgeneSTK10chr5:171710600chr5:171554425ENST00000176763-11942_50107969Nucleotide bindingATP


Top

FusionGeneSequence for UBTD2_STK10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UBTD2_ENST00000393792_chr5_171710600_-_STK10_ENST00000176763_chr5_171554425_-_885aa
MGGCVGAQHDSSGSLNENSEGTGDHDXVLSRGSRGRHHAGAGQRPHGAPDTGGLPPDARSPQLPAQQEDHPPRSESWQRADDPRGRHQAG
XLWCVCQESEDSTETRFLHRHALLDGPRGGHVXDHERHALRLQSRHLVPGHHADXDGPDRAATPRAQPHAGPAKDRQVGPSHAAHALXVV
CRVPXLPEDSPGXEPRNPTQCRAAAGASLRQQHHQXQGSAGAGGXGQGRGDGRDRRRPGXGGRGGRRGCRLHPGEPYSELLXGESAKPQC
XQASRGVTFHPAGTQPVSGQCEXALQPALWGQIPPNHQSPSRGPWKXERPGSACAPAEVPTRVNGCQNSGSPGEASCXAGWGPQPSSQQI
SKGQPEPAQQQRPGDLGWGEAGQWQPGATCPGSSRAFQEGLGLQQPLHLXEHGLWYQSLHXPVAEQRDGLSVHQGPETVQKNPQADTQIC
GGWCGGEHHHLQDHQRRXEEGXGDEISQAPGTPRASAAPERRASEPDPAEXQAXAAAGANAXTFXTGNQRQEEVLXHGIREPGASAKAAS
GEDGARPCRAPPGGGQADPPGAGSGLHQVPRAAQTDEERGEERGGEAPPTAAEGKHEAEDGGAHAEKAASXPGLCSQAEGGPGAGHEEAH
HRQQAGDLXQGARVPHEEAGAPSRPGSSPVGDGRAPAAGEAPAGEAAAQRPVLPPAARAAAQAXEGAGADAALQPAHDRAAEGAAATGKG
AAAQDPEEXGQDAHGHVQEEPPHQRRGQRSXAAXEDQAVLPAGGEEAEVGAAAATAETREPDAGHAGAVXEQHERAAAAAEXKVPPPGRA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UBTD2_ENST00000393792_chr5_171710600_-_STK10_ENST00000176763_chr5_171554425_-_2656nt
ATGGGCGGGTGTGTGGGCGCCCAGCACGACTCCTCGGGCAGCCTCAACGAGAACTCGGAGGGCACCGGAGATCATGATTGAGTTCTGTCC
AGGGGGAGCCGTGGACGCCATCATGCTGGAGCTGGACAGAGGCCTCACGGAGCCCCAGATACAGGTGGTTTGCCGCCAGATGCTAGAAGC
CCTCAACTTCCTGCACAGCAAGAGGATCATCCACCGAGATCTGAAAGCTGGCAACGTGCTGATGACCCTCGAGGGAGACATCAGGCTGGC
TGACTTTGGTGTGTCTGCCAAGAATCTGAAGACTCTACAGAAACGAGATTCCTTCATCGGCACGCCTTACTGGATGGCCCCCGAGGTGGT
CATGTGTGAGACCATGAAAGACACGCCCTACGACTACAAAGCCGACATCTGGTCCCTGGGCATCACGCTGATTGAGATGGCCCAGATCGA
GCCGCCACACCACGAGCTCAACCCCATGCGGGTCCTGCTAAAGATCGCCAAGTCGGACCCTCCCACGCTGCTCACGCCCTCTAAGTGGTC
TGTAGAGTTCCGTGACTTCCTGAAGATAGCCCTGGATAAGAACCCAGAAACCCGACCCAGTGCCGCGCAGCTGCTGGAGCATCCCTTCGT
CAGCAGCATCACCAGTAACAAGGCTCTGCGGGAGCTGGTGGCTGAGGCCAAGGCCGAGGTGATGGAAGAGATCGAAGACGGCCGGGATGA
GGGGGAAGAGGAGGACGCCGTGGATGCCGCCTCCACCCTGGAGAACCATACTCAGAACTCCTCTGAGGTGAGTCCGCCAAGCCTCAATGC
TGACAAGCCTCTCGAGGAGTCACCTTCCACCCCGCTGGCACCCAGCCAGTCTCAGGACAGTGTGAATGAGCCCTGCAGCCAGCCCTCTGG
GGACAGATCCCTCCAAACCACCAGTCCCCCAGTCGTGGCCCCTGGAAATGAGAACGGCCTGGCAGTGCCTGTGCCCCTGCGGAAGTCCCG
ACCCGTGTCAATGGATGCCAGAATTCAGGTAGCCCAGGAGAAGCAAGTTGCTGAGCAGGGTGGGGACCTCAGCCCAGCAGCCAACAGATC
TCAAAAGGCCAGCCAGAGCCGGCCCAACAGCAGCGCCCTGGAGACCTTGGGTGGGGAGAAGCTGGCCAATGGCAGCCTGGAGCCACCTGC
CCAGGCAGCTCCAGGGCCTTCCAAGAGGGACTCGGACTGCAGCAGCCTCTGCACCTCTGAGAGCATGGACTATGGTACCAATCTCTCCAC
TGACCTGTCGCTGAACAAAGAGATGGGCTCTCTGTCCATCAAGGACCCGAAACTGTACAAAAAAACCCTCAAGCGGACACGCAAATTTGT
GGTGGATGGTGTGGAGGTGAGCATCACCACCTCCAAGATCATCAGCGAAGATGAGAAGAAGGATGAGGAGATGAGATTTCTCAGGCGCCA
GGAACTCCGAGAGCTTCGGCTGCTCCAGAAAGAAGAGCATCGGAACCAGACCCAGCTGAGTAACAAGCATGAGCTGCAGCTGGAGCAAAT
GCATAAACGTTTTGAACAGGAAATCAACGCCAAGAAGAAGTTCTTTGACACGGAATTAGAGAACCTGGAGCGTCAGCAAAAGCAGCAAGT
GGAGAAGATGGAGCAAGACCATGCCGTGCGCCGCCGGGAGGAGGCCAGGCGGATCCGCCTGGAGCAGGATCGGGACTACACCAGGTTCCA
AGAGCAGCTCAAACTGATGAAGAAAGAGGTGAAGAACGAGGTGGAGAAGCTCCCCCGACAGCAGCGGAAGGAAAGCATGAAGCAGAAGAT
GGAGGAGCACACGCAGAAAAAGCAGCTTCTTGACCGGGACTTTGTAGCCAAGCAGAAGGAGGACCTGGAGCTGGCCATGAAGAGGCTCAC
CACCGACAACAGGCGGGAGATCTGTGACAAGGAGCGCGAGTGCCTCATGAAGAAGCAGGAGCTCCTTCGAGACCGGGAAGCAGCCCTGTG
GGAGATGGAAGAGCACCAGCTGCAGGAGAGGCACCAGCTGGTGAAGCAGCAGCTCAAAGACCAGTACTTCCTCCAGCGGCACGAGCTGCT
GCGCAAGCATGAGAAGGAGCGGGAGCAGATGCAGCGCTACAACCAGCGCATGATAGAGCAGCTGAAGGTGCGGCAGCAACAGGAAAAGGC
GCGGCTGCCCAAGATCCAGAGGAGTGAGGGCAAGACGCGCATGGCCATGTACAAGAAGAGCCTCCACATCAACGGCGGGGGCAGCGCAGC
TGAGCAGCGTGAGAAGATCAAGCAGTTCTCCCAGCAGGAGGAGAAGAGGCAGAAGTCGGAGCGGCTGCAGCAACAGCAGAAACACGAGAA
CCAGATGCGGGACATGCTGGCGCAGTGTGAGAGCAACATGAGCGAGCTGCAGCAGCTGCAGAATGAAAAGTGCCACCTCCTGGTAGAGCA
CGAAACCCAGAAACTGAAGGCCCTGGATGAGAGCCATAACCAGAACCTGAAGGAATGGCGGGACAAGCTTCGGCCGCGCAAGAAGGCTCT
GGAAGAGGATCTGAACCAGAAGAAGCGGGAGCAGGAGATGTTCTTCAAGCTGAGCGAGGAGGCGGAGTGCCCAAACCCCTCCACCCCAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_UBTD2_ENST00000393792_chr5_171710600_-_STK10_ENST00000176763_chr5_171554425_-_5871nt
GGCGCCGCGGGCCGGGGGCCGATGGGTCCTGGCGGACGCGAGGCGCCGGCGCGGGGCTCGCCTGGACTCGGGTGTGCGGGGCTGTGAGGG
GGCGAGGCGGGCGCTGCGGCCCGCCCGGGATGGGCCAGCCCTGGCCTGGCGGGGCTGAGCCGAAGGCGAGGGCGGCGCGCGGGCCAGGCC
TGCCGGGCGGGCGGCCCGGGGGTTGAGGTAGAAGTGGGCGCGGAGGAAGGGGCCGAGCCAAGGCGGTGGGTGGAGCGGCGAGGGGGGCGG
AGGCTGGGCCGCGGCGGGCGAGCGGAGCGGCGCGCCTGTCCGGAGCTCGGCGGTGGCGCCGGAGGAGGCTGCAGCGGCGGCGGCGGCGGG
CCCGGACGAGCGTCCGGAGGTGGCGGACGAGGCGCCGGGGGCCCCCATGGGCGGGTGTGTGGGCGCCCAGCACGACTCCTCGGGCAGCCT
CAACGAGAACTCGGAGGGCACCGGAGATCATGATTGAGTTCTGTCCAGGGGGAGCCGTGGACGCCATCATGCTGGAGCTGGACAGAGGCC
TCACGGAGCCCCAGATACAGGTGGTTTGCCGCCAGATGCTAGAAGCCCTCAACTTCCTGCACAGCAAGAGGATCATCCACCGAGATCTGA
AAGCTGGCAACGTGCTGATGACCCTCGAGGGAGACATCAGGCTGGCTGACTTTGGTGTGTCTGCCAAGAATCTGAAGACTCTACAGAAAC
GAGATTCCTTCATCGGCACGCCTTACTGGATGGCCCCCGAGGTGGTCATGTGTGAGACCATGAAAGACACGCCCTACGACTACAAAGCCG
ACATCTGGTCCCTGGGCATCACGCTGATTGAGATGGCCCAGATCGAGCCGCCACACCACGAGCTCAACCCCATGCGGGTCCTGCTAAAGA
TCGCCAAGTCGGACCCTCCCACGCTGCTCACGCCCTCTAAGTGGTCTGTAGAGTTCCGTGACTTCCTGAAGATAGCCCTGGATAAGAACC
CAGAAACCCGACCCAGTGCCGCGCAGCTGCTGGAGCATCCCTTCGTCAGCAGCATCACCAGTAACAAGGCTCTGCGGGAGCTGGTGGCTG
AGGCCAAGGCCGAGGTGATGGAAGAGATCGAAGACGGCCGGGATGAGGGGGAAGAGGAGGACGCCGTGGATGCCGCCTCCACCCTGGAGA
ACCATACTCAGAACTCCTCTGAGGTGAGTCCGCCAAGCCTCAATGCTGACAAGCCTCTCGAGGAGTCACCTTCCACCCCGCTGGCACCCA
GCCAGTCTCAGGACAGTGTGAATGAGCCCTGCAGCCAGCCCTCTGGGGACAGATCCCTCCAAACCACCAGTCCCCCAGTCGTGGCCCCTG
GAAATGAGAACGGCCTGGCAGTGCCTGTGCCCCTGCGGAAGTCCCGACCCGTGTCAATGGATGCCAGAATTCAGGTAGCCCAGGAGAAGC
AAGTTGCTGAGCAGGGTGGGGACCTCAGCCCAGCAGCCAACAGATCTCAAAAGGCCAGCCAGAGCCGGCCCAACAGCAGCGCCCTGGAGA
CCTTGGGTGGGGAGAAGCTGGCCAATGGCAGCCTGGAGCCACCTGCCCAGGCAGCTCCAGGGCCTTCCAAGAGGGACTCGGACTGCAGCA
GCCTCTGCACCTCTGAGAGCATGGACTATGGTACCAATCTCTCCACTGACCTGTCGCTGAACAAAGAGATGGGCTCTCTGTCCATCAAGG
ACCCGAAACTGTACAAAAAAACCCTCAAGCGGACACGCAAATTTGTGGTGGATGGTGTGGAGGTGAGCATCACCACCTCCAAGATCATCA
GCGAAGATGAGAAGAAGGATGAGGAGATGAGATTTCTCAGGCGCCAGGAACTCCGAGAGCTTCGGCTGCTCCAGAAAGAAGAGCATCGGA
ACCAGACCCAGCTGAGTAACAAGCATGAGCTGCAGCTGGAGCAAATGCATAAACGTTTTGAACAGGAAATCAACGCCAAGAAGAAGTTCT
TTGACACGGAATTAGAGAACCTGGAGCGTCAGCAAAAGCAGCAAGTGGAGAAGATGGAGCAAGACCATGCCGTGCGCCGCCGGGAGGAGG
CCAGGCGGATCCGCCTGGAGCAGGATCGGGACTACACCAGGTTCCAAGAGCAGCTCAAACTGATGAAGAAAGAGGTGAAGAACGAGGTGG
AGAAGCTCCCCCGACAGCAGCGGAAGGAAAGCATGAAGCAGAAGATGGAGGAGCACACGCAGAAAAAGCAGCTTCTTGACCGGGACTTTG
TAGCCAAGCAGAAGGAGGACCTGGAGCTGGCCATGAAGAGGCTCACCACCGACAACAGGCGGGAGATCTGTGACAAGGAGCGCGAGTGCC
TCATGAAGAAGCAGGAGCTCCTTCGAGACCGGGAAGCAGCCCTGTGGGAGATGGAAGAGCACCAGCTGCAGGAGAGGCACCAGCTGGTGA
AGCAGCAGCTCAAAGACCAGTACTTCCTCCAGCGGCACGAGCTGCTGCGCAAGCATGAGAAGGAGCGGGAGCAGATGCAGCGCTACAACC
AGCGCATGATAGAGCAGCTGAAGGTGCGGCAGCAACAGGAAAAGGCGCGGCTGCCCAAGATCCAGAGGAGTGAGGGCAAGACGCGCATGG
CCATGTACAAGAAGAGCCTCCACATCAACGGCGGGGGCAGCGCAGCTGAGCAGCGTGAGAAGATCAAGCAGTTCTCCCAGCAGGAGGAGA
AGAGGCAGAAGTCGGAGCGGCTGCAGCAACAGCAGAAACACGAGAACCAGATGCGGGACATGCTGGCGCAGTGTGAGAGCAACATGAGCG
AGCTGCAGCAGCTGCAGAATGAAAAGTGCCACCTCCTGGTAGAGCACGAAACCCAGAAACTGAAGGCCCTGGATGAGAGCCATAACCAGA
ACCTGAAGGAATGGCGGGACAAGCTTCGGCCGCGCAAGAAGGCTCTGGAAGAGGATCTGAACCAGAAGAAGCGGGAGCAGGAGATGTTCT
TCAAGCTGAGCGAGGAGGCGGAGTGCCCAAACCCCTCCACCCCAAGCAAGGCCGCCAAGTTCTTCCCCTACAGTTCTGCGGATGCTTCTT
AACAACCGCCCGGGGCTGTGGCTGGCAGCTTGGTGGGCCCCAGGGCCTTCTCCTTCATTCTCTGTGAACATGTAACTCAGGACCCCTTTT
CCCTCTTGCGTCTGTGCCAGCTCAAATCCAGCCCCTCGCCCTGTGCCACCCCAACTGTGCCTGATAGACCTGCCCCAGCGTTCCTGACTT
CTTGCTGGCCTGTGGAGGGTGAGGTGTAATTATTTGTCACCTGAACCTAATGTATATTCTCCTTGAGCCCCAGATCCCTTCAAGCTGGAA
GGGATGGGGCTGTTGGTGGGGTCAGGGTCCAAGAGGAATGGGTGTTCTGTGGCCTCGAGTCCTCTCCTGTTTGCGAAAATACCAGTTTTG
CTCTCTGTGGGACAAAGCACTGCTGATGAAGTCCCCGTGGGCTCATCCGGGCTGGAATTCTTGGTTTTTCAGCCATTCCCTGCAGAGTCA
CTCAATCATCAAGTCCCTCACAGCCATTTCTGTTCCCAGAGGAGCCAGGCCTGCAGCTGGCTGCTCAGGAGATGGCCTCATTCCTCCTGT
TCTCCCAGTTTGCTTTCCACTTAAGACAAAGCCTTGTCTATGTGGGGGGCGGGGACCGGGGAAAGAGGGAGGCTGAAATGTTTATTCTGC
TTCTCCCGTGTTTCATGCCATCTCGCGTCCCCCTTCCTGCACATGGGTGTGAATGCACACACATACGCGTACACACAGGACTTGGTCTGC
TGGCCTGGCCTCTTCTGCCCAGGTGGGTTGGAACACGTTTGCTGCCTGAGCCTGTGCCACTGAGCATGTTAGGTGGAGCAGTTGGTGTGG
CACGTGCGGGGTGTTGGCACCGGAGGCATGGAAAAGCACAGGCTGTACTGCCAGGCTGCGATGCGTGCTGGCCCCCGCACAGGCTCCTGT
GTGCAGGGACTGATTCCTCAGCACACGAGGCTTCCACAACCCAGTCTGCTCCATAGCACTCTGGCCCACCCTGTCTGCAGGTGAAACAGG
AGGGCTGTTTGCCTCTGCCCCATCCCCCCGACTGTGTTCAGGAGTCCCACCTTGCATTTCAGACCTGGGCTGGCAGTCTGTTGGACTTCT
CTTCAGGAAGAAAAAGCATCAGGGGGAAATGGAATGCCCCTGCCCCAGGAACATGGCAGAAGCACAGGTTCTGTACCTCAGATGGACTCC
TGCTGGGCCTTCGGGGTCTCAGTTGGCTTCCCCCAGATTCTGATTCTACAGCTGCAGAATGTATATAACGCAATAAAAGCAAATGTTTGA
ACCAGTATGCGGGTTTACTTACAAGGAAACCTTTTTTCACCCTGATTTCTAATTATTTTATTGAAACAACTATAAAATGTATGGTTTCTC
CAGGAAGATATCTGCTTTTTAAAACAACAAACAAGAACAACAACACAAAACTGGTAATGATTTGGAGTAATCATGCGGGCATATTGAGTC
TGGGTAGTGTTTCGCTGGTGGTAGAGTGGTTGAGACTTCCTGGGAGGACTTTTTCCGCCTTCACTCCTACAGATTTAAGATTCTTTATTT
TTAGGCCGGGCATGGTGACTCACCTGAGGTGAGGAGTTCGAGACTAGCCTGGCCAACATGGCAAAACCCTGTCTCTACTAAAAGTACAAA
AATTAGCCAGGCGTGGTGGTGCATGCCTATAATCCCAGCTACTCGGGAGGCTGAGGCAGGAGAATCGCTTGAACCCAGGAGGCAGAGGTT
GCAGTAAGCCAAGGTCACACCACTGCACTCCAGCCTAGGTGACAGGGCGAGACTCTGTCTCTCAAAAAAAAAAAAAAAAAAAATTCTTTG
AGACAGGGTCTCTAATATGTTGCCCAAGCTGATCTCAAACTCGTGGCTCAACTGATTCTCCCGCTTCAACCTTGAGTAGCTGGGACGACA
GATACATGCTACTGCACCCAGCTAGGTTAAGGTTCTGTATACTCTGTCTTTCTAAAGCAATTCCCTGGAAATTTTCTCAACATTGGTTAT
AACTGAATGCTTGGGAAGGGAGGGGCAGCCCTTCAACAGGAAAAGGGGACTGCCCAAATCTTAAATGCACAGTCAAGATTCTCTTGGAGC
TAGCAATGGTTCTCAGGTTAGTGAGCATTTAGCTTGCCTGCTGCAGAATTTGACCCAGATGGGGGTGTTTTTTAGGTCTCTCACAAATGA
GACAAGCGAAACAATTGTCTCCTTTTATTCTCTTTGGTGCATTGGTGCTGGGGAAACATGAACTAGCGGCAGTGTAACTGCAGAACATAG
ACCCAGTTCTACCAGGCCAGGCCAGCGTTGGGAACCACCAGACAGGGCTGCTTTGGGCTTTGCTTACAGTATTTCCATGTGTAGCCTGGC
GTGTGAGAAAGTATTAGGTGAAATGCCAGTTTCATGGTTCAGGTGAAAGTCTGTGATCATTCCCCTCGTGGCTCGTCCTTCACATCACTT
TTGCCCTTCAAGGAGTTGCCGCGTCCCCGCTCAGTGCCGCCTGAGCCCTCAGAGCTCCCCTGTGCTTTTCTGGATGGGGACTGGCGGGGT
CACCTAGCCTCACCGTGGAGCCACCGTGCAATGCCCATCTCTGAGAGGCCCACGCGGTATTCCTCGTGCCCTGTGTTAGTGCTTTCTGTA
TAAGGGACAGACAGAACTGGGTTTTTTTCCTCTGTCTGGTTTTAGAGTAAATGTAACTAACTTTTATTTTCCCTTTATGAAAGATAGAAA
TTATTTTTATGTAGTTTCCAGACTTTATACAAAATTTTTGTAAAATGTTCTCTGGAAAGTTAACTACAAGAATGTAAATATGCTTCTAAT


Top

FusionGenePPI for UBTD2_STK10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UBTD2UBC, UBA1, USP5, TRIM39, GALT, CST1, CST4, SMR3B, DUSP22, TMEM185A, PCDHGC3, GJB7, HOXB5STK10CD81, ENO1, SHMT2, MOV10, NXF1, KIFC1, XPO1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UBTD2_STK10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UBTD2_STK10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSTK10C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneSTK10C1336708Testicular Germ Cell Tumor1UNIPROT