FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40577

FusionGeneSummary for UBQLN1_NLRP5

check button Fusion gene summary
Fusion gene informationFusion gene name: UBQLN1_NLRP5
Fusion gene ID: 40577
HgeneTgene
Gene symbol

UBQLN1

NLRP5

Gene ID

29979

126206

Gene nameubiquilin 1NLR family pyrin domain containing 5
SynonymsDA41|DSK2|PLIC-1|UBQN|XDRP1CLR19.8|MATER|NALP5|PAN11|PYPAF8
Cytomap

9q21.32|9q21.2-q21.3

19q13.43

Type of geneprotein-codingprotein-coding
Descriptionubiquilin-1hPLIC-1protein linking IAP with cytoskeleton 1testicular tissue protein Li 219NACHT, LRR and PYD domains-containing protein 5NACHT, leucine rich repeat and PYD containing 5mater protein homologmaternal antigen that embryos requirenucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 5
Modification date2018052220180522
UniProtAcc

Q9UMX0

P59047

Ensembl transtripts involved in fusion geneENST00000376395, ENST00000257468, 
ENST00000390649, 
Fusion gene scores* DoF score6 X 7 X 3=1263 X 3 X 2=18
# samples 73
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: UBQLN1 [Title/Abstract] AND NLRP5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneUBQLN1

GO:0031396

regulation of protein ubiquitination

12634373

HgeneUBQLN1

GO:0031398

positive regulation of protein ubiquitination

23307288

HgeneUBQLN1

GO:0035973

aggrephagy

21143716


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A6YR-01AUBQLN1chr9

86292642

-NLRP5chr19

56531741

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376395ENST00000390649UBQLN1chr9

86292642

-NLRP5chr19

56531741

+
In-frameENST00000257468ENST00000390649UBQLN1chr9

86292642

-NLRP5chr19

56531741

+

Top

FusionProtFeatures for UBQLN1_NLRP5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UBQLN1

Q9UMX0

NLRP5

P59047

As a member of the subcortical maternal complex (SCMC),plays an essential role for zygotes to progress beyond the firstembryonic cell divisions. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610182_210368562DomainSTI1 1
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610212_251368562DomainSTI1 2
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-61037_111368562DomainUbiquitin-like
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611182_210368590DomainSTI1 1
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611212_251368590DomainSTI1 2
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-61137_111368590DomainUbiquitin-like
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415280_6022071201DomainNACHT
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415286_2932071201Nucleotide bindingATP
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+4151007_10342071201RepeatNote=LRR 10
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+4151036_10592071201RepeatNote=LRR 11
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+4151064_10922071201RepeatNote=LRR 12
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+4151121_11422071201RepeatNote=LRR 13
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415704_7272071201RepeatNote=LRR 1
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415730_7532071201RepeatNote=LRR 2
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415780_8032071201RepeatNote=LRR 3
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415809_8322071201RepeatNote=LRR 4
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415836_8632071201RepeatNote=LRR 5
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415865_8922071201RepeatNote=LRR 6
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415893_9162071201RepeatNote=LRR 7
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415950_9732071201RepeatNote=LRR 8
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+415979_10022071201RepeatNote=LRR 9

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610387_434368562DomainSTI1 3
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610438_470368562DomainSTI1 4
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610546_586368562DomainUBA
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611387_434368590DomainSTI1 3
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611438_470368590DomainSTI1 4
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611546_586368590DomainUBA
TgeneNLRP5chr9:86292642chr19:56531741ENST00000390649+41557_1482071201DomainPyrin


Top

FusionGeneSequence for UBQLN1_NLRP5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UBQLN1_ENST00000376395_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_1362aa
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDT
LSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYN
ALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENTAADWPEMQTLAGAFDSDRWGFRPRTVVLHGKSG
IGKSALARRIVLCWAQGGLYQGMFSYVFFLPVREMQRKKESSVTEFISREWPDSQAPVTEIMSRPERLLFIIDGFDDLGSVLNNDTKLCK
DWAEKQPPFTLIRSLLRKVLLPESFLIVTVRDVGTEKLKSEVVSPRYLLVRGISGEQRIHLLLERGIGEHQKTQGLRAIMNNRELLDQCQ
VPAVGSLICVALQLQDVVGESVAPFNQTLTGLHAAFVFHQLTPRGVVRRCLNLEERVVLKRFCRMAVEGVWNRKSVFDGDDLMVQGLGES
ELRALFHMNILLPDSHCEEYYTFFHLSLQDFCAALYYVLEGLEIEPALCPLYVEKTKRSMELKQAGFHIHSLWMKRFLFGLVSEDVRRPL
EVLLGCPVPLGVKQKLLHWVSLLGQQPNATTPGDTLDAFHCLFETQDKEFVRLALNSFQEVWLPINQNLDLIASSFCLQHCPYLRKIRVD
VKGIFPRDESAEACPVVPLWMRDKTLIEEQWEDFCSMLGTHPHLRQLDLGSSILTERAMKTLCAKLRHPTCKIQTLMFRNAQITPGVQHL
WRIVMANRNLRSLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTSPSLKSLSLAGNKVTDQGVMPLSDALR
VSQCALQKLILEDCGITATGCQSLASALVSNRSLTHLCLSNNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGNSW
LTHLSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESLSCVISRSRHLKSLDLTDNALGDGGVAALCEGLKQKNSVLARL
GLKACGLTSDCCEALSLALSCNRHLTSLNLVQNNFSPKGMMKLCSAFACPTSNLQIIGLWKWQYPVQIRKLLEEVQLLKPRVVIDGSWHS

>In-frame_UBQLN1_ENST00000257468_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_1362aa
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDT
LSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYN
ALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENTAADWPEMQTLAGAFDSDRWGFRPRTVVLHGKSG
IGKSALARRIVLCWAQGGLYQGMFSYVFFLPVREMQRKKESSVTEFISREWPDSQAPVTEIMSRPERLLFIIDGFDDLGSVLNNDTKLCK
DWAEKQPPFTLIRSLLRKVLLPESFLIVTVRDVGTEKLKSEVVSPRYLLVRGISGEQRIHLLLERGIGEHQKTQGLRAIMNNRELLDQCQ
VPAVGSLICVALQLQDVVGESVAPFNQTLTGLHAAFVFHQLTPRGVVRRCLNLEERVVLKRFCRMAVEGVWNRKSVFDGDDLMVQGLGES
ELRALFHMNILLPDSHCEEYYTFFHLSLQDFCAALYYVLEGLEIEPALCPLYVEKTKRSMELKQAGFHIHSLWMKRFLFGLVSEDVRRPL
EVLLGCPVPLGVKQKLLHWVSLLGQQPNATTPGDTLDAFHCLFETQDKEFVRLALNSFQEVWLPINQNLDLIASSFCLQHCPYLRKIRVD
VKGIFPRDESAEACPVVPLWMRDKTLIEEQWEDFCSMLGTHPHLRQLDLGSSILTERAMKTLCAKLRHPTCKIQTLMFRNAQITPGVQHL
WRIVMANRNLRSLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTSPSLKSLSLAGNKVTDQGVMPLSDALR
VSQCALQKLILEDCGITATGCQSLASALVSNRSLTHLCLSNNSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGNSW
LTHLSLSMNPVEDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESLSCVISRSRHLKSLDLTDNALGDGGVAALCEGLKQKNSVLARL
GLKACGLTSDCCEALSLALSCNRHLTSLNLVQNNFSPKGMMKLCSAFACPTSNLQIIGLWKWQYPVQIRKLLEEVQLLKPRVVIDGSWHS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UBQLN1_ENST00000376395_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_4086nt
ATGGCCGAGAGTGGTGAAAGCGGCGGTCCTCCGGGCTCCCAGGATAGCGCCGCCGGAGCCGAAGGTGCTGGCGCCCCCGCGGCCGCTGCC
TCCGCGGAGCCCAAAATCATGAAAGTCACCGTGAAGACCCCGAAGGAAAAGGAGGAATTCGCCGTGCCCGAGAATAGCTCCGTCCAGCAG
TTTAAGGAAGAAATCTCTAAACGTTTTAAATCACATACTGACCAACTTGTGTTGATATTTGCTGGAAAAATTTTGAAAGATCAAGATACC
TTGAGTCAGCATGGAATTCATGATGGACTTACTGTTCACCTTGTCATTAAAACACAAAACAGGCCTCAGGATCATTCAGCTCAGCAAACA
AATACAGCTGGAAGCAATGTTACTACATCATCAACTCCTAATAGTAACTCTACATCTGGTTCTGCTACTAGCAACCCTTTTGGTTTAGGT
GGCCTTGGGGGACTTGCAGGTCTGAGTAGCTTGGGTTTGAATACTACCAACTTCTCTGAACTACAGAGTCAGATGCAGCGACAACTTTTG
TCTAACCCTGAAATGATGGTCCAGATCATGGAAAATCCCTTTGTTCAGAGCATGCTCTCAAATCCTGACCTGATGAGACAGTTAATTATG
GCCAATCCACAAATGCAGCAGTTGATACAGAGAAATCCAGAAATTAGTCATATGTTGAATAATCCAGATATAATGAGACAAACGTTGGAA
CTTGCCAGGAATCCAGCAATGATGCAGGAGATGATGAGGAACCAGGACCGAGCTTTGAGCAACCTAGAAAGCATCCCAGGGGGATATAAT
GCTTTAAGGCGCATGTACACAGATATTCAGGAACCAATGCTGAGTGCTGCACAAGAGCAGTTTGGTGGTAATCCATTTGCTTCCTTGGTG
AGCAATACATCCTCTGGTGAAGGTAGTCAACCTTCCCGTACAGAAAATAGAGATCCACTACCCAATCCATGGGCTCCACAGACTTCCCAG
AGTTCATCAGCTTCCAGCGGCACTGCCAGCACTGTGGGTGGCACTACTGGTAGTACTGCCAGTGGCACTTCTGGGCAGAGTACTACTGCG
CCAAATTTGGTGCCTGGAGTAGGAGAAATTTCACAAGCTATGGAACAAGAAGGTGCCACAGCAGCAGAGACAGAAGAACAAGGACATGGA
GGTGACACATGGGACTACAAGAGTCACGTGATGACCAAATTCGCTGAGGAGGAGGATGTACGTCGTAGTTTTGAAAACACTGCTGCTGAC
TGGCCGGAAATGCAAACGTTGGCTGGTGCTTTTGATTCAGACCGGTGGGGCTTCCGGCCTCGCACGGTGGTTCTGCACGGAAAGTCAGGA
ATTGGGAAATCGGCTCTAGCCAGAAGGATCGTGCTGTGCTGGGCGCAAGGTGGACTCTACCAGGGAATGTTCTCCTACGTCTTCTTCCTC
CCCGTTAGAGAGATGCAGCGGAAGAAGGAGAGCAGTGTCACAGAGTTCATCTCCAGGGAGTGGCCAGACTCCCAGGCTCCGGTGACGGAG
ATCATGTCCCGACCAGAAAGGCTGTTGTTCATCATTGACGGTTTCGATGACCTGGGCTCTGTCCTCAACAATGACACAAAGCTCTGCAAA
GACTGGGCTGAGAAGCAGCCTCCGTTCACCCTCATACGCAGTCTGCTGAGGAAGGTCCTGCTCCCTGAGTCCTTCCTGATCGTCACCGTC
AGAGACGTGGGCACAGAGAAGCTCAAGTCAGAGGTCGTGTCTCCCCGTTACCTGTTAGTTAGAGGAATCTCCGGGGAACAAAGAATCCAC
TTGCTCCTTGAGCGCGGGATTGGTGAGCATCAGAAGACACAAGGGTTGCGTGCGATCATGAACAACCGTGAGCTGCTCGACCAGTGCCAG
GTGCCCGCCGTGGGCTCTCTCATCTGCGTGGCCCTGCAGCTGCAGGACGTGGTGGGGGAGAGCGTCGCCCCCTTCAACCAAACGCTCACA
GGCCTGCACGCCGCTTTTGTGTTTCATCAGCTCACCCCTCGAGGCGTGGTCCGGCGCTGTCTCAATCTGGAGGAAAGAGTTGTCCTGAAG
CGCTTCTGCCGTATGGCTGTGGAGGGAGTGTGGAATAGGAAGTCAGTGTTTGACGGTGACGACCTCATGGTTCAAGGACTCGGGGAGTCT
GAGCTCCGTGCTCTGTTTCACATGAACATCCTTCTCCCAGACAGCCACTGTGAGGAGTACTACACCTTCTTCCACCTCAGTCTCCAGGAC
TTCTGTGCCGCCTTGTACTACGTGTTAGAGGGCCTGGAAATCGAGCCAGCTCTCTGCCCTCTGTACGTTGAGAAGACAAAGAGGTCCATG
GAGCTTAAACAGGCAGGCTTCCATATCCACTCGCTTTGGATGAAGCGTTTCTTGTTTGGCCTCGTGAGCGAAGACGTAAGGAGGCCACTG
GAGGTCCTGCTGGGCTGTCCCGTTCCCCTGGGGGTGAAGCAGAAGCTTCTGCACTGGGTCTCTCTGTTGGGTCAGCAGCCTAATGCCACC
ACCCCAGGAGACACCCTGGACGCCTTCCACTGTCTTTTCGAGACTCAAGACAAAGAGTTTGTTCGCTTGGCATTAAACAGCTTCCAAGAA
GTGTGGCTTCCGATTAACCAGAACCTGGACTTGATAGCATCTTCCTTCTGCCTCCAGCACTGTCCGTATTTGCGGAAAATTCGGGTGGAT
GTCAAAGGGATCTTCCCAAGAGATGAGTCCGCTGAGGCATGTCCTGTGGTCCCTCTATGGATGCGGGATAAGACCCTCATTGAGGAGCAG
TGGGAAGATTTCTGCTCCATGCTTGGCACCCACCCACACCTGCGGCAGCTGGACCTGGGCAGCAGCATCCTGACAGAGCGGGCCATGAAG
ACCCTGTGTGCCAAGCTGAGGCATCCCACCTGCAAGATACAGACCCTGATGTTTAGAAATGCACAGATTACCCCTGGTGTGCAGCACCTC
TGGAGAATCGTCATGGCCAACCGTAACCTAAGATCCCTCAACTTGGGAGGCACCCACCTGAAGGAAGAGGATGTAAGGATGGCGTGTGAA
GCCTTAAAACACCCAAAATGTTTGTTGGAGTCTTTGAGGCTGGATTGCTGTGGATTGACCCATGCCTGTTACCTGAAGATCTCCCAAATC
CTTACGACCTCCCCCAGCCTGAAATCTCTGAGCCTGGCAGGAAACAAGGTGACAGACCAGGGAGTAATGCCTCTCAGTGATGCCTTGAGA
GTCTCCCAGTGCGCCCTGCAGAAGCTGATACTGGAGGACTGTGGCATCACAGCCACGGGTTGCCAGAGTCTGGCCTCAGCCCTCGTCAGC
AACCGGAGCTTGACACACCTGTGCCTATCCAACAACAGCCTGGGGAACGAAGGTGTAAATCTACTGTGTCGATCCATGAGGCTTCCCCAC
TGTAGTCTGCAGAGGCTGATGCTGAATCAGTGCCACCTGGACACGGCTGGCTGTGGTTTTCTTGCACTTGCGCTTATGGGTAACTCATGG
CTGACGCACCTGAGCCTTAGCATGAACCCTGTGGAAGACAATGGCGTGAAGCTTCTGTGCGAGGTCATGAGAGAACCATCTTGTCATCTC
CAGGACCTGGAGTTGGTAAAGTGTCATCTCACCGCCGCGTGCTGTGAGAGTCTGTCCTGTGTGATCTCGAGGAGCAGACACCTGAAGAGC
CTGGATCTCACGGACAATGCCCTGGGTGACGGTGGGGTTGCTGCGCTGTGCGAGGGACTGAAGCAAAAGAACAGTGTTCTGGCGAGACTC
GGGTTGAAGGCATGTGGACTGACTTCTGATTGCTGTGAGGCACTCTCCTTGGCCCTTTCCTGCAACCGGCATCTGACCAGTCTAAACCTG
GTGCAGAATAACTTCAGTCCCAAAGGAATGATGAAGCTGTGTTCGGCCTTTGCCTGTCCCACGTCTAACTTACAGATAATTGGGCTGTGG
AAATGGCAGTACCCTGTGCAAATAAGGAAGCTGCTGGAGGAAGTGCAGCTACTCAAGCCCCGAGTCGTAATTGACGGTAGTTGGCATTCT

>In-frame_UBQLN1_ENST00000257468_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_4086nt
ATGGCCGAGAGTGGTGAAAGCGGCGGTCCTCCGGGCTCCCAGGATAGCGCCGCCGGAGCCGAAGGTGCTGGCGCCCCCGCGGCCGCTGCC
TCCGCGGAGCCCAAAATCATGAAAGTCACCGTGAAGACCCCGAAGGAAAAGGAGGAATTCGCCGTGCCCGAGAATAGCTCCGTCCAGCAG
TTTAAGGAAGAAATCTCTAAACGTTTTAAATCACATACTGACCAACTTGTGTTGATATTTGCTGGAAAAATTTTGAAAGATCAAGATACC
TTGAGTCAGCATGGAATTCATGATGGACTTACTGTTCACCTTGTCATTAAAACACAAAACAGGCCTCAGGATCATTCAGCTCAGCAAACA
AATACAGCTGGAAGCAATGTTACTACATCATCAACTCCTAATAGTAACTCTACATCTGGTTCTGCTACTAGCAACCCTTTTGGTTTAGGT
GGCCTTGGGGGACTTGCAGGTCTGAGTAGCTTGGGTTTGAATACTACCAACTTCTCTGAACTACAGAGTCAGATGCAGCGACAACTTTTG
TCTAACCCTGAAATGATGGTCCAGATCATGGAAAATCCCTTTGTTCAGAGCATGCTCTCAAATCCTGACCTGATGAGACAGTTAATTATG
GCCAATCCACAAATGCAGCAGTTGATACAGAGAAATCCAGAAATTAGTCATATGTTGAATAATCCAGATATAATGAGACAAACGTTGGAA
CTTGCCAGGAATCCAGCAATGATGCAGGAGATGATGAGGAACCAGGACCGAGCTTTGAGCAACCTAGAAAGCATCCCAGGGGGATATAAT
GCTTTAAGGCGCATGTACACAGATATTCAGGAACCAATGCTGAGTGCTGCACAAGAGCAGTTTGGTGGTAATCCATTTGCTTCCTTGGTG
AGCAATACATCCTCTGGTGAAGGTAGTCAACCTTCCCGTACAGAAAATAGAGATCCACTACCCAATCCATGGGCTCCACAGACTTCCCAG
AGTTCATCAGCTTCCAGCGGCACTGCCAGCACTGTGGGTGGCACTACTGGTAGTACTGCCAGTGGCACTTCTGGGCAGAGTACTACTGCG
CCAAATTTGGTGCCTGGAGTAGGAGAAATTTCACAAGCTATGGAACAAGAAGGTGCCACAGCAGCAGAGACAGAAGAACAAGGACATGGA
GGTGACACATGGGACTACAAGAGTCACGTGATGACCAAATTCGCTGAGGAGGAGGATGTACGTCGTAGTTTTGAAAACACTGCTGCTGAC
TGGCCGGAAATGCAAACGTTGGCTGGTGCTTTTGATTCAGACCGGTGGGGCTTCCGGCCTCGCACGGTGGTTCTGCACGGAAAGTCAGGA
ATTGGGAAATCGGCTCTAGCCAGAAGGATCGTGCTGTGCTGGGCGCAAGGTGGACTCTACCAGGGAATGTTCTCCTACGTCTTCTTCCTC
CCCGTTAGAGAGATGCAGCGGAAGAAGGAGAGCAGTGTCACAGAGTTCATCTCCAGGGAGTGGCCAGACTCCCAGGCTCCGGTGACGGAG
ATCATGTCCCGACCAGAAAGGCTGTTGTTCATCATTGACGGTTTCGATGACCTGGGCTCTGTCCTCAACAATGACACAAAGCTCTGCAAA
GACTGGGCTGAGAAGCAGCCTCCGTTCACCCTCATACGCAGTCTGCTGAGGAAGGTCCTGCTCCCTGAGTCCTTCCTGATCGTCACCGTC
AGAGACGTGGGCACAGAGAAGCTCAAGTCAGAGGTCGTGTCTCCCCGTTACCTGTTAGTTAGAGGAATCTCCGGGGAACAAAGAATCCAC
TTGCTCCTTGAGCGCGGGATTGGTGAGCATCAGAAGACACAAGGGTTGCGTGCGATCATGAACAACCGTGAGCTGCTCGACCAGTGCCAG
GTGCCCGCCGTGGGCTCTCTCATCTGCGTGGCCCTGCAGCTGCAGGACGTGGTGGGGGAGAGCGTCGCCCCCTTCAACCAAACGCTCACA
GGCCTGCACGCCGCTTTTGTGTTTCATCAGCTCACCCCTCGAGGCGTGGTCCGGCGCTGTCTCAATCTGGAGGAAAGAGTTGTCCTGAAG
CGCTTCTGCCGTATGGCTGTGGAGGGAGTGTGGAATAGGAAGTCAGTGTTTGACGGTGACGACCTCATGGTTCAAGGACTCGGGGAGTCT
GAGCTCCGTGCTCTGTTTCACATGAACATCCTTCTCCCAGACAGCCACTGTGAGGAGTACTACACCTTCTTCCACCTCAGTCTCCAGGAC
TTCTGTGCCGCCTTGTACTACGTGTTAGAGGGCCTGGAAATCGAGCCAGCTCTCTGCCCTCTGTACGTTGAGAAGACAAAGAGGTCCATG
GAGCTTAAACAGGCAGGCTTCCATATCCACTCGCTTTGGATGAAGCGTTTCTTGTTTGGCCTCGTGAGCGAAGACGTAAGGAGGCCACTG
GAGGTCCTGCTGGGCTGTCCCGTTCCCCTGGGGGTGAAGCAGAAGCTTCTGCACTGGGTCTCTCTGTTGGGTCAGCAGCCTAATGCCACC
ACCCCAGGAGACACCCTGGACGCCTTCCACTGTCTTTTCGAGACTCAAGACAAAGAGTTTGTTCGCTTGGCATTAAACAGCTTCCAAGAA
GTGTGGCTTCCGATTAACCAGAACCTGGACTTGATAGCATCTTCCTTCTGCCTCCAGCACTGTCCGTATTTGCGGAAAATTCGGGTGGAT
GTCAAAGGGATCTTCCCAAGAGATGAGTCCGCTGAGGCATGTCCTGTGGTCCCTCTATGGATGCGGGATAAGACCCTCATTGAGGAGCAG
TGGGAAGATTTCTGCTCCATGCTTGGCACCCACCCACACCTGCGGCAGCTGGACCTGGGCAGCAGCATCCTGACAGAGCGGGCCATGAAG
ACCCTGTGTGCCAAGCTGAGGCATCCCACCTGCAAGATACAGACCCTGATGTTTAGAAATGCACAGATTACCCCTGGTGTGCAGCACCTC
TGGAGAATCGTCATGGCCAACCGTAACCTAAGATCCCTCAACTTGGGAGGCACCCACCTGAAGGAAGAGGATGTAAGGATGGCGTGTGAA
GCCTTAAAACACCCAAAATGTTTGTTGGAGTCTTTGAGGCTGGATTGCTGTGGATTGACCCATGCCTGTTACCTGAAGATCTCCCAAATC
CTTACGACCTCCCCCAGCCTGAAATCTCTGAGCCTGGCAGGAAACAAGGTGACAGACCAGGGAGTAATGCCTCTCAGTGATGCCTTGAGA
GTCTCCCAGTGCGCCCTGCAGAAGCTGATACTGGAGGACTGTGGCATCACAGCCACGGGTTGCCAGAGTCTGGCCTCAGCCCTCGTCAGC
AACCGGAGCTTGACACACCTGTGCCTATCCAACAACAGCCTGGGGAACGAAGGTGTAAATCTACTGTGTCGATCCATGAGGCTTCCCCAC
TGTAGTCTGCAGAGGCTGATGCTGAATCAGTGCCACCTGGACACGGCTGGCTGTGGTTTTCTTGCACTTGCGCTTATGGGTAACTCATGG
CTGACGCACCTGAGCCTTAGCATGAACCCTGTGGAAGACAATGGCGTGAAGCTTCTGTGCGAGGTCATGAGAGAACCATCTTGTCATCTC
CAGGACCTGGAGTTGGTAAAGTGTCATCTCACCGCCGCGTGCTGTGAGAGTCTGTCCTGTGTGATCTCGAGGAGCAGACACCTGAAGAGC
CTGGATCTCACGGACAATGCCCTGGGTGACGGTGGGGTTGCTGCGCTGTGCGAGGGACTGAAGCAAAAGAACAGTGTTCTGGCGAGACTC
GGGTTGAAGGCATGTGGACTGACTTCTGATTGCTGTGAGGCACTCTCCTTGGCCCTTTCCTGCAACCGGCATCTGACCAGTCTAAACCTG
GTGCAGAATAACTTCAGTCCCAAAGGAATGATGAAGCTGTGTTCGGCCTTTGCCTGTCCCACGTCTAACTTACAGATAATTGGGCTGTGG
AAATGGCAGTACCCTGTGCAAATAAGGAAGCTGCTGGAGGAAGTGCAGCTACTCAAGCCCCGAGTCGTAATTGACGGTAGTTGGCATTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_UBQLN1_ENST00000376395_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_4895nt
GGAAACTGCGATTTAGTTTTTGGTGAAAGGAGTGGAAAAAAACCATGAACTGACCTACCCCGCCCCATTTTGCTTTTAGTCCTTCACACT
GGCTTCGCCTGCACTTTGGGCAATGGAGCGGGAAAGGAAAAGGCACGCAGGCTGAGCTCAAAGTCGCGCCAGCCGGGGATGACTCGGCGA
CGCCGCCAGGCGCGTTACCCGGCGTGCTCCGCGCGGCGCCGGCGAAGGGACGTGGGGGAAGGGGCAGGGAGGAGGAAGCGGTGGCTGCTG
CGGATGTCGGTGTGAGCGAGCGGCGCCTGAACACACGGCGGCTGCCGAGCGCCTGACCCGGGCCTGCGCCAGAGCCTGCACCGAGCTCCG
GGGCCCCACACCCGCTACGGTGGCCCTGCGCCCGTTGCTACTGAGGCGGCGTGCTCTGCATTCTTCGCTGTCCAGGCCTGCCGGCTCTGG
TGTCTGCTGGCTCCTCCTTGCTCGCCTGCTCCCTCCTGCTTGCCTGAGTCACCGCCGCCGCCGCCGCCACAGCCATGGCCGAGAGTGGTG
AAAGCGGCGGTCCTCCGGGCTCCCAGGATAGCGCCGCCGGAGCCGAAGGTGCTGGCGCCCCCGCGGCCGCTGCCTCCGCGGAGCCCAAAA
TCATGAAAGTCACCGTGAAGACCCCGAAGGAAAAGGAGGAATTCGCCGTGCCCGAGAATAGCTCCGTCCAGCAGTTTAAGGAAGAAATCT
CTAAACGTTTTAAATCACATACTGACCAACTTGTGTTGATATTTGCTGGAAAAATTTTGAAAGATCAAGATACCTTGAGTCAGCATGGAA
TTCATGATGGACTTACTGTTCACCTTGTCATTAAAACACAAAACAGGCCTCAGGATCATTCAGCTCAGCAAACAAATACAGCTGGAAGCA
ATGTTACTACATCATCAACTCCTAATAGTAACTCTACATCTGGTTCTGCTACTAGCAACCCTTTTGGTTTAGGTGGCCTTGGGGGACTTG
CAGGTCTGAGTAGCTTGGGTTTGAATACTACCAACTTCTCTGAACTACAGAGTCAGATGCAGCGACAACTTTTGTCTAACCCTGAAATGA
TGGTCCAGATCATGGAAAATCCCTTTGTTCAGAGCATGCTCTCAAATCCTGACCTGATGAGACAGTTAATTATGGCCAATCCACAAATGC
AGCAGTTGATACAGAGAAATCCAGAAATTAGTCATATGTTGAATAATCCAGATATAATGAGACAAACGTTGGAACTTGCCAGGAATCCAG
CAATGATGCAGGAGATGATGAGGAACCAGGACCGAGCTTTGAGCAACCTAGAAAGCATCCCAGGGGGATATAATGCTTTAAGGCGCATGT
ACACAGATATTCAGGAACCAATGCTGAGTGCTGCACAAGAGCAGTTTGGTGGTAATCCATTTGCTTCCTTGGTGAGCAATACATCCTCTG
GTGAAGGTAGTCAACCTTCCCGTACAGAAAATAGAGATCCACTACCCAATCCATGGGCTCCACAGACTTCCCAGAGTTCATCAGCTTCCA
GCGGCACTGCCAGCACTGTGGGTGGCACTACTGGTAGTACTGCCAGTGGCACTTCTGGGCAGAGTACTACTGCGCCAAATTTGGTGCCTG
GAGTAGGAGAAATTTCACAAGCTATGGAACAAGAAGGTGCCACAGCAGCAGAGACAGAAGAACAAGGACATGGAGGTGACACATGGGACT
ACAAGAGTCACGTGATGACCAAATTCGCTGAGGAGGAGGATGTACGTCGTAGTTTTGAAAACACTGCTGCTGACTGGCCGGAAATGCAAA
CGTTGGCTGGTGCTTTTGATTCAGACCGGTGGGGCTTCCGGCCTCGCACGGTGGTTCTGCACGGAAAGTCAGGAATTGGGAAATCGGCTC
TAGCCAGAAGGATCGTGCTGTGCTGGGCGCAAGGTGGACTCTACCAGGGAATGTTCTCCTACGTCTTCTTCCTCCCCGTTAGAGAGATGC
AGCGGAAGAAGGAGAGCAGTGTCACAGAGTTCATCTCCAGGGAGTGGCCAGACTCCCAGGCTCCGGTGACGGAGATCATGTCCCGACCAG
AAAGGCTGTTGTTCATCATTGACGGTTTCGATGACCTGGGCTCTGTCCTCAACAATGACACAAAGCTCTGCAAAGACTGGGCTGAGAAGC
AGCCTCCGTTCACCCTCATACGCAGTCTGCTGAGGAAGGTCCTGCTCCCTGAGTCCTTCCTGATCGTCACCGTCAGAGACGTGGGCACAG
AGAAGCTCAAGTCAGAGGTCGTGTCTCCCCGTTACCTGTTAGTTAGAGGAATCTCCGGGGAACAAAGAATCCACTTGCTCCTTGAGCGCG
GGATTGGTGAGCATCAGAAGACACAAGGGTTGCGTGCGATCATGAACAACCGTGAGCTGCTCGACCAGTGCCAGGTGCCCGCCGTGGGCT
CTCTCATCTGCGTGGCCCTGCAGCTGCAGGACGTGGTGGGGGAGAGCGTCGCCCCCTTCAACCAAACGCTCACAGGCCTGCACGCCGCTT
TTGTGTTTCATCAGCTCACCCCTCGAGGCGTGGTCCGGCGCTGTCTCAATCTGGAGGAAAGAGTTGTCCTGAAGCGCTTCTGCCGTATGG
CTGTGGAGGGAGTGTGGAATAGGAAGTCAGTGTTTGACGGTGACGACCTCATGGTTCAAGGACTCGGGGAGTCTGAGCTCCGTGCTCTGT
TTCACATGAACATCCTTCTCCCAGACAGCCACTGTGAGGAGTACTACACCTTCTTCCACCTCAGTCTCCAGGACTTCTGTGCCGCCTTGT
ACTACGTGTTAGAGGGCCTGGAAATCGAGCCAGCTCTCTGCCCTCTGTACGTTGAGAAGACAAAGAGGTCCATGGAGCTTAAACAGGCAG
GCTTCCATATCCACTCGCTTTGGATGAAGCGTTTCTTGTTTGGCCTCGTGAGCGAAGACGTAAGGAGGCCACTGGAGGTCCTGCTGGGCT
GTCCCGTTCCCCTGGGGGTGAAGCAGAAGCTTCTGCACTGGGTCTCTCTGTTGGGTCAGCAGCCTAATGCCACCACCCCAGGAGACACCC
TGGACGCCTTCCACTGTCTTTTCGAGACTCAAGACAAAGAGTTTGTTCGCTTGGCATTAAACAGCTTCCAAGAAGTGTGGCTTCCGATTA
ACCAGAACCTGGACTTGATAGCATCTTCCTTCTGCCTCCAGCACTGTCCGTATTTGCGGAAAATTCGGGTGGATGTCAAAGGGATCTTCC
CAAGAGATGAGTCCGCTGAGGCATGTCCTGTGGTCCCTCTATGGATGCGGGATAAGACCCTCATTGAGGAGCAGTGGGAAGATTTCTGCT
CCATGCTTGGCACCCACCCACACCTGCGGCAGCTGGACCTGGGCAGCAGCATCCTGACAGAGCGGGCCATGAAGACCCTGTGTGCCAAGC
TGAGGCATCCCACCTGCAAGATACAGACCCTGATGTTTAGAAATGCACAGATTACCCCTGGTGTGCAGCACCTCTGGAGAATCGTCATGG
CCAACCGTAACCTAAGATCCCTCAACTTGGGAGGCACCCACCTGAAGGAAGAGGATGTAAGGATGGCGTGTGAAGCCTTAAAACACCCAA
AATGTTTGTTGGAGTCTTTGAGGCTGGATTGCTGTGGATTGACCCATGCCTGTTACCTGAAGATCTCCCAAATCCTTACGACCTCCCCCA
GCCTGAAATCTCTGAGCCTGGCAGGAAACAAGGTGACAGACCAGGGAGTAATGCCTCTCAGTGATGCCTTGAGAGTCTCCCAGTGCGCCC
TGCAGAAGCTGATACTGGAGGACTGTGGCATCACAGCCACGGGTTGCCAGAGTCTGGCCTCAGCCCTCGTCAGCAACCGGAGCTTGACAC
ACCTGTGCCTATCCAACAACAGCCTGGGGAACGAAGGTGTAAATCTACTGTGTCGATCCATGAGGCTTCCCCACTGTAGTCTGCAGAGGC
TGATGCTGAATCAGTGCCACCTGGACACGGCTGGCTGTGGTTTTCTTGCACTTGCGCTTATGGGTAACTCATGGCTGACGCACCTGAGCC
TTAGCATGAACCCTGTGGAAGACAATGGCGTGAAGCTTCTGTGCGAGGTCATGAGAGAACCATCTTGTCATCTCCAGGACCTGGAGTTGG
TAAAGTGTCATCTCACCGCCGCGTGCTGTGAGAGTCTGTCCTGTGTGATCTCGAGGAGCAGACACCTGAAGAGCCTGGATCTCACGGACA
ATGCCCTGGGTGACGGTGGGGTTGCTGCGCTGTGCGAGGGACTGAAGCAAAAGAACAGTGTTCTGGCGAGACTCGGGTTGAAGGCATGTG
GACTGACTTCTGATTGCTGTGAGGCACTCTCCTTGGCCCTTTCCTGCAACCGGCATCTGACCAGTCTAAACCTGGTGCAGAATAACTTCA
GTCCCAAAGGAATGATGAAGCTGTGTTCGGCCTTTGCCTGTCCCACGTCTAACTTACAGATAATTGGGCTGTGGAAATGGCAGTACCCTG
TGCAAATAAGGAAGCTGCTGGAGGAAGTGCAGCTACTCAAGCCCCGAGTCGTAATTGACGGTAGTTGGCATTCTTTTGATGAAGATGACC
GGTACTGGTGGAAAAACTGAAGATACGGAAACCTGCCCCACTCACACCCATCTGATGGAGGAACTTTAAACGCTGTTTTCTCAGAGCAAG
CTATGCACCTGGGAGTTCCTTCTCAAAGATGGAGAATGATTTCTGATTCTCACAAAGCCCTCAATGGTAGTGATTCTTCTGTGTTCACTC
TACGTTGGTTACTGGATTTGAAGGCTAGAGACCTTCAAGTCATAGGACTCAGTATCTGTGAAATGTCCGTCATATCTCAGAGCATATAGA

>In-frame_UBQLN1_ENST00000257468_chr9_86292642_-_NLRP5_ENST00000390649_chr19_56531741_+_4626nt
GCGGATGTCGGTGTGAGCGAGCGGCGCCTGAACACACGGCGGCTGCCGAGCGCCTGACCCGGGCCTGCGCCAGAGCCTGCACCGAGCTCC
GGGGCCCCACACCCGCTACGGTGGCCCTGCGCCCGTTGCTACTGAGGCGGCGTGCTCTGCATTCTTCGCTGTCCAGGCCTGCCGGCTCTG
GTGTCTGCTGGCTCCTCCTTGCTCGCCTGCTCCCTCCTGCTTGCCTGAGTCACCGCCGCCGCCGCCGCCACAGCCATGGCCGAGAGTGGT
GAAAGCGGCGGTCCTCCGGGCTCCCAGGATAGCGCCGCCGGAGCCGAAGGTGCTGGCGCCCCCGCGGCCGCTGCCTCCGCGGAGCCCAAA
ATCATGAAAGTCACCGTGAAGACCCCGAAGGAAAAGGAGGAATTCGCCGTGCCCGAGAATAGCTCCGTCCAGCAGTTTAAGGAAGAAATC
TCTAAACGTTTTAAATCACATACTGACCAACTTGTGTTGATATTTGCTGGAAAAATTTTGAAAGATCAAGATACCTTGAGTCAGCATGGA
ATTCATGATGGACTTACTGTTCACCTTGTCATTAAAACACAAAACAGGCCTCAGGATCATTCAGCTCAGCAAACAAATACAGCTGGAAGC
AATGTTACTACATCATCAACTCCTAATAGTAACTCTACATCTGGTTCTGCTACTAGCAACCCTTTTGGTTTAGGTGGCCTTGGGGGACTT
GCAGGTCTGAGTAGCTTGGGTTTGAATACTACCAACTTCTCTGAACTACAGAGTCAGATGCAGCGACAACTTTTGTCTAACCCTGAAATG
ATGGTCCAGATCATGGAAAATCCCTTTGTTCAGAGCATGCTCTCAAATCCTGACCTGATGAGACAGTTAATTATGGCCAATCCACAAATG
CAGCAGTTGATACAGAGAAATCCAGAAATTAGTCATATGTTGAATAATCCAGATATAATGAGACAAACGTTGGAACTTGCCAGGAATCCA
GCAATGATGCAGGAGATGATGAGGAACCAGGACCGAGCTTTGAGCAACCTAGAAAGCATCCCAGGGGGATATAATGCTTTAAGGCGCATG
TACACAGATATTCAGGAACCAATGCTGAGTGCTGCACAAGAGCAGTTTGGTGGTAATCCATTTGCTTCCTTGGTGAGCAATACATCCTCT
GGTGAAGGTAGTCAACCTTCCCGTACAGAAAATAGAGATCCACTACCCAATCCATGGGCTCCACAGACTTCCCAGAGTTCATCAGCTTCC
AGCGGCACTGCCAGCACTGTGGGTGGCACTACTGGTAGTACTGCCAGTGGCACTTCTGGGCAGAGTACTACTGCGCCAAATTTGGTGCCT
GGAGTAGGAGAAATTTCACAAGCTATGGAACAAGAAGGTGCCACAGCAGCAGAGACAGAAGAACAAGGACATGGAGGTGACACATGGGAC
TACAAGAGTCACGTGATGACCAAATTCGCTGAGGAGGAGGATGTACGTCGTAGTTTTGAAAACACTGCTGCTGACTGGCCGGAAATGCAA
ACGTTGGCTGGTGCTTTTGATTCAGACCGGTGGGGCTTCCGGCCTCGCACGGTGGTTCTGCACGGAAAGTCAGGAATTGGGAAATCGGCT
CTAGCCAGAAGGATCGTGCTGTGCTGGGCGCAAGGTGGACTCTACCAGGGAATGTTCTCCTACGTCTTCTTCCTCCCCGTTAGAGAGATG
CAGCGGAAGAAGGAGAGCAGTGTCACAGAGTTCATCTCCAGGGAGTGGCCAGACTCCCAGGCTCCGGTGACGGAGATCATGTCCCGACCA
GAAAGGCTGTTGTTCATCATTGACGGTTTCGATGACCTGGGCTCTGTCCTCAACAATGACACAAAGCTCTGCAAAGACTGGGCTGAGAAG
CAGCCTCCGTTCACCCTCATACGCAGTCTGCTGAGGAAGGTCCTGCTCCCTGAGTCCTTCCTGATCGTCACCGTCAGAGACGTGGGCACA
GAGAAGCTCAAGTCAGAGGTCGTGTCTCCCCGTTACCTGTTAGTTAGAGGAATCTCCGGGGAACAAAGAATCCACTTGCTCCTTGAGCGC
GGGATTGGTGAGCATCAGAAGACACAAGGGTTGCGTGCGATCATGAACAACCGTGAGCTGCTCGACCAGTGCCAGGTGCCCGCCGTGGGC
TCTCTCATCTGCGTGGCCCTGCAGCTGCAGGACGTGGTGGGGGAGAGCGTCGCCCCCTTCAACCAAACGCTCACAGGCCTGCACGCCGCT
TTTGTGTTTCATCAGCTCACCCCTCGAGGCGTGGTCCGGCGCTGTCTCAATCTGGAGGAAAGAGTTGTCCTGAAGCGCTTCTGCCGTATG
GCTGTGGAGGGAGTGTGGAATAGGAAGTCAGTGTTTGACGGTGACGACCTCATGGTTCAAGGACTCGGGGAGTCTGAGCTCCGTGCTCTG
TTTCACATGAACATCCTTCTCCCAGACAGCCACTGTGAGGAGTACTACACCTTCTTCCACCTCAGTCTCCAGGACTTCTGTGCCGCCTTG
TACTACGTGTTAGAGGGCCTGGAAATCGAGCCAGCTCTCTGCCCTCTGTACGTTGAGAAGACAAAGAGGTCCATGGAGCTTAAACAGGCA
GGCTTCCATATCCACTCGCTTTGGATGAAGCGTTTCTTGTTTGGCCTCGTGAGCGAAGACGTAAGGAGGCCACTGGAGGTCCTGCTGGGC
TGTCCCGTTCCCCTGGGGGTGAAGCAGAAGCTTCTGCACTGGGTCTCTCTGTTGGGTCAGCAGCCTAATGCCACCACCCCAGGAGACACC
CTGGACGCCTTCCACTGTCTTTTCGAGACTCAAGACAAAGAGTTTGTTCGCTTGGCATTAAACAGCTTCCAAGAAGTGTGGCTTCCGATT
AACCAGAACCTGGACTTGATAGCATCTTCCTTCTGCCTCCAGCACTGTCCGTATTTGCGGAAAATTCGGGTGGATGTCAAAGGGATCTTC
CCAAGAGATGAGTCCGCTGAGGCATGTCCTGTGGTCCCTCTATGGATGCGGGATAAGACCCTCATTGAGGAGCAGTGGGAAGATTTCTGC
TCCATGCTTGGCACCCACCCACACCTGCGGCAGCTGGACCTGGGCAGCAGCATCCTGACAGAGCGGGCCATGAAGACCCTGTGTGCCAAG
CTGAGGCATCCCACCTGCAAGATACAGACCCTGATGTTTAGAAATGCACAGATTACCCCTGGTGTGCAGCACCTCTGGAGAATCGTCATG
GCCAACCGTAACCTAAGATCCCTCAACTTGGGAGGCACCCACCTGAAGGAAGAGGATGTAAGGATGGCGTGTGAAGCCTTAAAACACCCA
AAATGTTTGTTGGAGTCTTTGAGGCTGGATTGCTGTGGATTGACCCATGCCTGTTACCTGAAGATCTCCCAAATCCTTACGACCTCCCCC
AGCCTGAAATCTCTGAGCCTGGCAGGAAACAAGGTGACAGACCAGGGAGTAATGCCTCTCAGTGATGCCTTGAGAGTCTCCCAGTGCGCC
CTGCAGAAGCTGATACTGGAGGACTGTGGCATCACAGCCACGGGTTGCCAGAGTCTGGCCTCAGCCCTCGTCAGCAACCGGAGCTTGACA
CACCTGTGCCTATCCAACAACAGCCTGGGGAACGAAGGTGTAAATCTACTGTGTCGATCCATGAGGCTTCCCCACTGTAGTCTGCAGAGG
CTGATGCTGAATCAGTGCCACCTGGACACGGCTGGCTGTGGTTTTCTTGCACTTGCGCTTATGGGTAACTCATGGCTGACGCACCTGAGC
CTTAGCATGAACCCTGTGGAAGACAATGGCGTGAAGCTTCTGTGCGAGGTCATGAGAGAACCATCTTGTCATCTCCAGGACCTGGAGTTG
GTAAAGTGTCATCTCACCGCCGCGTGCTGTGAGAGTCTGTCCTGTGTGATCTCGAGGAGCAGACACCTGAAGAGCCTGGATCTCACGGAC
AATGCCCTGGGTGACGGTGGGGTTGCTGCGCTGTGCGAGGGACTGAAGCAAAAGAACAGTGTTCTGGCGAGACTCGGGTTGAAGGCATGT
GGACTGACTTCTGATTGCTGTGAGGCACTCTCCTTGGCCCTTTCCTGCAACCGGCATCTGACCAGTCTAAACCTGGTGCAGAATAACTTC
AGTCCCAAAGGAATGATGAAGCTGTGTTCGGCCTTTGCCTGTCCCACGTCTAACTTACAGATAATTGGGCTGTGGAAATGGCAGTACCCT
GTGCAAATAAGGAAGCTGCTGGAGGAAGTGCAGCTACTCAAGCCCCGAGTCGTAATTGACGGTAGTTGGCATTCTTTTGATGAAGATGAC
CGGTACTGGTGGAAAAACTGAAGATACGGAAACCTGCCCCACTCACACCCATCTGATGGAGGAACTTTAAACGCTGTTTTCTCAGAGCAA
GCTATGCACCTGGGAGTTCCTTCTCAAAGATGGAGAATGATTTCTGATTCTCACAAAGCCCTCAATGGTAGTGATTCTTCTGTGTTCACT
CTACGTTGGTTACTGGATTTGAAGGCTAGAGACCTTCAAGTCATAGGACTCAGTATCTGTGAAATGTCCGTCATATCTCAGAGCATATAG


Top

FusionGenePPI for UBQLN1_NLRP5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UBQLN1MTOR, NBL1, P4HB, HK2, FAM127B, TRIM32, TFF1, GABRD, TMCO6, PLA2G16, FZD7, CSTF2T, UBQLN1, CD99, IGLC1, RIC8A, SERPINI2, EFEMP2, MIEF2, HSPA13, KLHL42, CSTF2, HGS, PSEN1, PSEN2, UBE3A, HERC3, HERPUD1, PSMD4, ATXN3, EPS15, DNAJB2, RNF185, UBC, INSIG2, RAD23A, BCL2L10, CHGB, APP, SPARC, STMN3, TICAM1, MAP1LC3A, UBXN4, VCP, TARDBP, UBQLN2, GABRA1, GABRB2, GABRB3, GABRA2, GABRA3, GABRA6, GABRB1, HTT, EPS15L1, STAM2, GNB1, ADRM1, RARA, UBQLN4, FAM127A, GKAP1, RASSF5, ZG16, PSMD2, PSMC2, PSMA5, UBE2D2, SSSCA1, AHCYL1, USP34, UBE2A, RAD23B, VPS26A, VPS4B, ATP6V1B2, UBE2B, ZRANB2, UCHL3, UBE4B, USP9X, UBE2D1, UBE2C, SNRNP70, RBMS1, UBXN1, ATP6V1H, UNK, CLNS1A, WDFY1, SFXN1, UBL7, HYPK, ORAI1, SMAD9, PRPF40A, UBL4A, FBXO25, FAS, F8, ABCC2, EP300, FAM86B3P, C1QA, FGF7, NPY, PTN, TNFRSF1A, TNFRSF1B, GIT2, TMEM37, DCTPP1, GAPDH, GNPDA1, HSPA1L, MTHFD1, RAP1GDS1, NUBP1, WIBG, PSMD3, SHFM1, PSMD14, NDE1, CALU, COL1A2, COL10A1, CTAG1B, DEFA6, FCGR2A, FKBP2, FN1, GPX3, GRM2, GYPB, SLC29A2, IGL, IL6ST, MCM7, MLLT6, NME3, NPPA, SERPINE1, PPIB, PPIC, PRB1, SRGN, RPN1, CCL7, SCG5, UBB, UBE2V1, ZMYM4, PNMA1, FAM189A2, LITAF, IST1, NUPL1, PSMD6, AGR2, SMR3B, ACOT7, SCMH1, COLGALT2, IGLV2-14, CTAG2, TXNDC12, HSD17B12, BPIFA1, CYB5R1, GHRL, MIEF1, AGPAT5, ETNK1, CARKD, NGLY1, PBXIP1, MANBAL, XPO4, SIL1, RSRC2, SMIM2, TMUB2, ZNF343, CD99L2, PIK3IP1, C1QTNF2, PRAP1, COMTD1, ERP27, ZG16B, ZFAND2B, ITPRIPL1, AGR3, TMEM31, FAM127C, RNF208, TREX1, MAP3K1, TLR4, PSMA6, PSMA7, CD3D, ASNS, PDCD6, TRIAP1, C12orf10, STMN1, ZMYM3, NTRK1, PARVA, SCG2, RELA, SMURF1, CD47, KDELR1, WBP2, MTNR1A, CYLD, TRIM25, IGF1R, ESYT2, BAG6NLRP5TXNDC17, DECR1, BECN1, BAG2, STIP1, LRRC1, MATR3, NLRP2, NLRP3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000257468-610178_428368562UBXN4
HgeneUBQLN1chr9:86292642chr19:56531741ENST00000376395-611178_428368590UBXN4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UBQLN1_NLRP5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UBQLN1_NLRP5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneUBQLN1C0027626Neoplasm Invasiveness1CTD_human