FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40451

FusionGeneSummary for UBE2K_KLB

check button Fusion gene summary
Fusion gene informationFusion gene name: UBE2K_KLB
Fusion gene ID: 40451
HgeneTgene
Gene symbol

UBE2K

KLB

Gene ID

3093

152831

Gene nameubiquitin conjugating enzyme E2 Kklotho beta
SynonymsE2-25K|HIP2|HYPG|LIG|UBC1BKL
Cytomap

4p14

4p14

Type of geneprotein-codingprotein-coding
Descriptionubiquitin-conjugating enzyme E2 KE2 ubiquitin-conjugating enzyme KE2(25K)HIP-2huntingtin-interacting protein 2ubiquitin carrier proteinubiquitin conjugating enzyme E2Kubiquitin-conjugating enzyme E2(25K)ubiquitin-conjugating enzyme E2-25 KDAubiqubeta-klothob-KlothobetaKlothoklotho beta likeklotho beta-like protein
Modification date2018052320180527
UniProtAcc

P61086

Q86Z14

Ensembl transtripts involved in fusion geneENST00000261427, ENST00000295963, 
ENST00000438068, ENST00000503368, 
ENST00000445950, 
ENST00000257408, 
Fusion gene scores* DoF score9 X 6 X 9=4861 X 1 X 1=1
# samples 101
** MAII scorelog2(10/486*10)=-2.28095631383106
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: UBE2K [Title/Abstract] AND KLB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneUBE2K

GO:0010800

positive regulation of peptidyl-threonine phosphorylation

24882218

HgeneUBE2K

GO:0010994

free ubiquitin chain polymerization

24882218

HgeneUBE2K

GO:0070936

protein K48-linked ubiquitination

20061386


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A1FD-01AUBE2Kchr4

39776553

+KLBchr4

39435830

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261427ENST00000257408UBE2Kchr4

39776553

+KLBchr4

39435830

+
intron-3CDSENST00000295963ENST00000257408UBE2Kchr4

39776553

+KLBchr4

39435830

+
3UTR-3CDSENST00000438068ENST00000257408UBE2Kchr4

39776553

+KLBchr4

39435830

+
In-frameENST00000503368ENST00000257408UBE2Kchr4

39776553

+KLBchr4

39435830

+
In-frameENST00000445950ENST00000257408UBE2Kchr4

39776553

+KLBchr4

39435830

+

Top

FusionProtFeatures for UBE2K_KLB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UBE2K

P61086

KLB

Q86Z14

Contributes to the transcriptional repression ofcholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzymein bile acid synthesis. Probably inactive as a glycosidase.Increases the ability of FGFR1 and FGFR4 to bind FGF21 (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneKLBchr4:39776553chr4:39435830ENST00000257408+05517_9672751045RegionNote=Glycosyl hydrolase-1 2
TgeneKLBchr4:39776553chr4:39435830ENST00000257408+051018_10442751045Topological domainCytoplasmic
TgeneKLBchr4:39776553chr4:39435830ENST00000257408+05997_10172751045TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBE2Kchr4:39776553chr4:39435830ENST00000261427+57160_200133201DomainUBA
HgeneUBE2Kchr4:39776553chr4:39435830ENST00000445950+56160_200133158DomainUBA
HgeneUBE2Kchr4:39776553chr4:39435830ENST00000503368+35160_20082150DomainUBA
TgeneKLBchr4:39776553chr4:39435830ENST00000257408+0577_5082751045RegionNote=Glycosyl hydrolase-1 1
TgeneKLBchr4:39776553chr4:39435830ENST00000257408+051_9962751045Topological domainExtracellular


Top

FusionGeneSequence for UBE2K_KLB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UBE2K_ENST00000261427_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_903aa
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGA
ICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQAHSKVWHNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQS
MVSVLGWFANPIHGDGDYPEGMRKKLFSVLPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRI
LIAENGWFTDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQI
IRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPESVASSPQFSDPHLYVWNATGNRLLHRVEGVRLKTRPAQCTDFVNIKKQLEMLARM
KVTHYRFALDWASVLPTGNLSAVNRQALRYYRCVVSEGLKLGISAMVTLYYPTHAHLGLPEPLLHADGWLNPSTAEAFQAYAGLCFQELG
DLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPSQRGAVSLSLHADWAEPANPYADSHWRAAERFLQFEIAWF
AEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLTEAERRLLKGTVDFCALNHFTTRFVMHEQLAGSRYDSDRDIQFLQDITRLSSPTRL
AVIPWGVRKLLRWVRRNYGDMDIYITASGIDDQALEDDRLRKYYLGKYLQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFKAK
SSIQFYNKVISSRGFPFENSSSRCSQTQENTECTVCLFLVQKKPLIFLGCCFFSTLVLLLSIAIFQRQKRRKFWKAKNLQHIPLKKGKRV

>In-frame_UBE2K_ENST00000503368_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_852aa
MANIAVQRIKREFKEVLKSEEVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQAHSKVWHN
YNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVLGWFANPIHGDGDYPEGMRKKLFSVLPIFSEAEKHEMRGTADFFAFS
FGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRILIAENGWFTDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLL
DGFEWQDAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPESVASSPQFSDPHLYVW
NATGNRLLHRVEGVRLKTRPAQCTDFVNIKKQLEMLARMKVTHYRFALDWASVLPTGNLSAVNRQALRYYRCVVSEGLKLGISAMVTLYY
PTHAHLGLPEPLLHADGWLNPSTAEAFQAYAGLCFQELGDLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPS
QRGAVSLSLHADWAEPANPYADSHWRAAERFLQFEIAWFAEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLTEAERRLLKGTVDFCAL
NHFTTRFVMHEQLAGSRYDSDRDIQFLQDITRLSSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITASGIDDQALEDDRLRKYYLGKYLQE
VLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFKAKSSIQFYNKVISSRGFPFENSSSRCSQTQENTECTVCLFLVQKKPLIFLGCC

>In-frame_UBE2K_ENST00000445950_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_903aa
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGA
ICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQAHSKVWHNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQS
MVSVLGWFANPIHGDGDYPEGMRKKLFSVLPIFSEAEKHEMRGTADFFAFSFGPNNFKPLNTMAKMGQNVSLNLREALNWIKLEYNNPRI
LIAENGWFTDSRVKTEDTTAIYMMKNFLSQVLQAIRLDEIRVFGYTAWSLLDGFEWQDAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQI
IRENGFSLKESTPDVQGQFPCDFSWGVTESVLKPESVASSPQFSDPHLYVWNATGNRLLHRVEGVRLKTRPAQCTDFVNIKKQLEMLARM
KVTHYRFALDWASVLPTGNLSAVNRQALRYYRCVVSEGLKLGISAMVTLYYPTHAHLGLPEPLLHADGWLNPSTAEAFQAYAGLCFQELG
DLVKLWITINEPNRLSDIYNRSGNDTYGAAHNLLVAHALAWRLYDRQFRPSQRGAVSLSLHADWAEPANPYADSHWRAAERFLQFEIAWF
AEPLFKTGDYPAAMREYIASKHRRGLSSSALPRLTEAERRLLKGTVDFCALNHFTTRFVMHEQLAGSRYDSDRDIQFLQDITRLSSPTRL
AVIPWGVRKLLRWVRRNYGDMDIYITASGIDDQALEDDRLRKYYLGKYLQEVLKAYLIDKVRIKGYYAFKLAEEKSKPRFGFFTSDFKAK
SSIQFYNKVISSRGFPFENSSSRCSQTQENTECTVCLFLVQKKPLIFLGCCFFSTLVLLLSIAIFQRQKRRKFWKAKNLQHIPLKKGKRV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UBE2K_ENST00000261427_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_2709nt
ATGGCCAACATCGCGGTGCAGCGAATCAAGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGACGAGCAAAAATCAAATTAAAGTAGAT
CTTGTAGATGAGAATTTTACAGAATTAAGAGGAGAAATAGCAGGACCTCCAGACACACCATATGAAGGAGGAAGATACCAACTAGAGATA
AAAATACCAGAAACATACCCATTTAATCCCCCTAAGGTCCGGTTTATCACTAAAATATGGCATCCTAATATTAGTTCCGTCACAGGGGCT
ATTTGTTTGGATATCCTGAAAGATCAATGGGCAGCTGCAATGACTCTCCGCACGGTATTATTGTCATTGCAAGCACTATTGGCAGCTGCA
GAGCCAGATGATCCACAGGATGCTGTAGTAGCAAATCAGGCTCACTCGAAAGTTTGGCATAACTACAACACACATTTCCGCCCACATCAG
AAGGGTTGGTTATCGATCACGTTGGGATCTCATTGGATCGAGCCAAACCGGTCGGAAAACACGATGGATATATTCAAATGTCAACAATCC
ATGGTTTCTGTGCTTGGATGGTTTGCCAACCCTATCCATGGGGATGGCGACTATCCAGAGGGGATGAGAAAGAAGTTGTTCTCCGTTCTA
CCCATTTTCTCTGAAGCAGAGAAGCATGAGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCTTTTGGACCCAACAACTTCAAGCCCCTA
AACACCATGGCTAAAATGGGACAAAATGTTTCACTTAATTTAAGAGAAGCGCTGAACTGGATTAAACTGGAATACAACAACCCTCGAATC
TTGATTGCTGAGAATGGCTGGTTCACAGACAGTCGTGTGAAAACAGAAGACACCACGGCCATCTACATGATGAAGAATTTCCTCAGCCAG
GTGCTTCAAGCAATAAGGTTAGATGAAATACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTGGATGGCTTTGAATGGCAGGATGCTTAC
ACCATCCGCCGAGGATTATTTTATGTGGATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAGTCTTCAGCACACTACTACAAACAGATC
ATACGAGAAAATGGTTTTTCTTTAAAAGAGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGTGACTTCTCCTGGGGTGTCACTGAATCT
GTTCTTAAGCCCGAGTCTGTGGCTTCGTCCCCACAGTTCAGCGATCCTCATCTGTACGTGTGGAACGCCACTGGCAACAGACTGTTGCAC
CGAGTGGAAGGGGTGAGGCTGAAAACACGACCCGCTCAATGCACAGATTTTGTAAACATCAAAAAACAACTTGAGATGTTGGCAAGAATG
AAAGTCACCCACTACCGGTTTGCTCTGGATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCCGCGGTGAACCGACAGGCCCTGAGGTAC
TACAGGTGCGTGGTCAGTGAGGGGCTGAAGCTTGGCATCTCCGCGATGGTCACCCTGTATTATCCGACCCACGCCCACCTAGGCCTCCCC
GAGCCTCTGTTGCATGCCGACGGGTGGCTGAACCCATCGACGGCCGAGGCCTTCCAGGCCTACGCTGGGCTGTGCTTCCAGGAGCTGGGG
GACCTGGTGAAGCTCTGGATCACCATCAACGAGCCTAACCGGCTAAGTGACATCTACAACCGCTCTGGCAACGACACCTACGGGGCGGCG
CACAACCTGCTGGTGGCCCACGCCCTGGCCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCACAGCGCGGGGCCGTGTCGCTGTCGCTG
CACGCGGACTGGGCGGAACCCGCCAACCCCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGCTTCCTGCAGTTCGAGATCGCCTGGTTC
GCCGAGCCGCTCTTCAAGACCGGGGACTACCCCGCGGCCATGAGGGAATACATTGCCTCCAAGCACCGACGGGGGCTTTCCAGCTCGGCC
CTGCCGCGCCTCACCGAGGCCGAAAGGAGGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTCAACCACTTCACCACTAGGTTCGTGATG
CACGAGCAGCTGGCCGGCAGCCGCTACGACTCGGACAGGGACATCCAGTTTCTGCAGGACATCACCCGCCTGAGCTCCCCCACGCGCCTG
GCTGTGATTCCCTGGGGGGTGCGCAAGCTGCTGCGGTGGGTCCGGAGGAACTACGGCGACATGGACATTTACATCACCGCCAGTGGCATC
GACGACCAGGCTCTGGAGGATGACCGGCTCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAGGTGCTGAAAGCATACCTGATTGATAAA
GTCAGAATCAAAGGCTATTATGCATTCAAACTGGCTGAAGAGAAATCTAAACCCAGATTTGGATTCTTCACATCTGATTTTAAAGCTAAA
TCCTCAATACAATTTTACAACAAAGTGATCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGTTCTAGATGCAGTCAGACCCAAGAAAAT
ACAGAGTGCACTGTCTGCTTATTCCTTGTGCAGAAGAAACCACTGATATTCCTGGGTTGTTGCTTCTTCTCCACCCTGGTTCTACTCTTA
TCAATTGCCATTTTTCAAAGGCAGAAGAGAAGAAAGTTTTGGAAAGCAAAAAACTTACAACACATACCATTAAAGAAAGGCAAGAGAGTT

>In-frame_UBE2K_ENST00000503368_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_2556nt
ATGGCCAACATCGCGGTGCAGCGAATCAAGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGGTCCGGTTTATCACTAAAATATGGCAT
CCTAATATTAGTTCCGTCACAGGGGCTATTTGTTTGGATATCCTGAAAGATCAATGGGCAGCTGCAATGACTCTCCGCACGGTATTATTG
TCATTGCAAGCACTATTGGCAGCTGCAGAGCCAGATGATCCACAGGATGCTGTAGTAGCAAATCAGGCTCACTCGAAAGTTTGGCATAAC
TACAACACACATTTCCGCCCACATCAGAAGGGTTGGTTATCGATCACGTTGGGATCTCATTGGATCGAGCCAAACCGGTCGGAAAACACG
ATGGATATATTCAAATGTCAACAATCCATGGTTTCTGTGCTTGGATGGTTTGCCAACCCTATCCATGGGGATGGCGACTATCCAGAGGGG
ATGAGAAAGAAGTTGTTCTCCGTTCTACCCATTTTCTCTGAAGCAGAGAAGCATGAGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCT
TTTGGACCCAACAACTTCAAGCCCCTAAACACCATGGCTAAAATGGGACAAAATGTTTCACTTAATTTAAGAGAAGCGCTGAACTGGATT
AAACTGGAATACAACAACCCTCGAATCTTGATTGCTGAGAATGGCTGGTTCACAGACAGTCGTGTGAAAACAGAAGACACCACGGCCATC
TACATGATGAAGAATTTCCTCAGCCAGGTGCTTCAAGCAATAAGGTTAGATGAAATACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTG
GATGGCTTTGAATGGCAGGATGCTTACACCATCCGCCGAGGATTATTTTATGTGGATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAG
TCTTCAGCACACTACTACAAACAGATCATACGAGAAAATGGTTTTTCTTTAAAAGAGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGT
GACTTCTCCTGGGGTGTCACTGAATCTGTTCTTAAGCCCGAGTCTGTGGCTTCGTCCCCACAGTTCAGCGATCCTCATCTGTACGTGTGG
AACGCCACTGGCAACAGACTGTTGCACCGAGTGGAAGGGGTGAGGCTGAAAACACGACCCGCTCAATGCACAGATTTTGTAAACATCAAA
AAACAACTTGAGATGTTGGCAAGAATGAAAGTCACCCACTACCGGTTTGCTCTGGATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCC
GCGGTGAACCGACAGGCCCTGAGGTACTACAGGTGCGTGGTCAGTGAGGGGCTGAAGCTTGGCATCTCCGCGATGGTCACCCTGTATTAT
CCGACCCACGCCCACCTAGGCCTCCCCGAGCCTCTGTTGCATGCCGACGGGTGGCTGAACCCATCGACGGCCGAGGCCTTCCAGGCCTAC
GCTGGGCTGTGCTTCCAGGAGCTGGGGGACCTGGTGAAGCTCTGGATCACCATCAACGAGCCTAACCGGCTAAGTGACATCTACAACCGC
TCTGGCAACGACACCTACGGGGCGGCGCACAACCTGCTGGTGGCCCACGCCCTGGCCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCA
CAGCGCGGGGCCGTGTCGCTGTCGCTGCACGCGGACTGGGCGGAACCCGCCAACCCCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGC
TTCCTGCAGTTCGAGATCGCCTGGTTCGCCGAGCCGCTCTTCAAGACCGGGGACTACCCCGCGGCCATGAGGGAATACATTGCCTCCAAG
CACCGACGGGGGCTTTCCAGCTCGGCCCTGCCGCGCCTCACCGAGGCCGAAAGGAGGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTC
AACCACTTCACCACTAGGTTCGTGATGCACGAGCAGCTGGCCGGCAGCCGCTACGACTCGGACAGGGACATCCAGTTTCTGCAGGACATC
ACCCGCCTGAGCTCCCCCACGCGCCTGGCTGTGATTCCCTGGGGGGTGCGCAAGCTGCTGCGGTGGGTCCGGAGGAACTACGGCGACATG
GACATTTACATCACCGCCAGTGGCATCGACGACCAGGCTCTGGAGGATGACCGGCTCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAG
GTGCTGAAAGCATACCTGATTGATAAAGTCAGAATCAAAGGCTATTATGCATTCAAACTGGCTGAAGAGAAATCTAAACCCAGATTTGGA
TTCTTCACATCTGATTTTAAAGCTAAATCCTCAATACAATTTTACAACAAAGTGATCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGT
TCTAGATGCAGTCAGACCCAAGAAAATACAGAGTGCACTGTCTGCTTATTCCTTGTGCAGAAGAAACCACTGATATTCCTGGGTTGTTGC
TTCTTCTCCACCCTGGTTCTACTCTTATCAATTGCCATTTTTCAAAGGCAGAAGAGAAGAAAGTTTTGGAAAGCAAAAAACTTACAACAC

>In-frame_UBE2K_ENST00000445950_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_2709nt
ATGGCCAACATCGCGGTGCAGCGAATCAAGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGACGAGCAAAAATCAAATTAAAGTAGAT
CTTGTAGATGAGAATTTTACAGAATTAAGAGGAGAAATAGCAGGACCTCCAGACACACCATATGAAGGAGGAAGATACCAACTAGAGATA
AAAATACCAGAAACATACCCATTTAATCCCCCTAAGGTCCGGTTTATCACTAAAATATGGCATCCTAATATTAGTTCCGTCACAGGGGCT
ATTTGTTTGGATATCCTGAAAGATCAATGGGCAGCTGCAATGACTCTCCGCACGGTATTATTGTCATTGCAAGCACTATTGGCAGCTGCA
GAGCCAGATGATCCACAGGATGCTGTAGTAGCAAATCAGGCTCACTCGAAAGTTTGGCATAACTACAACACACATTTCCGCCCACATCAG
AAGGGTTGGTTATCGATCACGTTGGGATCTCATTGGATCGAGCCAAACCGGTCGGAAAACACGATGGATATATTCAAATGTCAACAATCC
ATGGTTTCTGTGCTTGGATGGTTTGCCAACCCTATCCATGGGGATGGCGACTATCCAGAGGGGATGAGAAAGAAGTTGTTCTCCGTTCTA
CCCATTTTCTCTGAAGCAGAGAAGCATGAGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCTTTTGGACCCAACAACTTCAAGCCCCTA
AACACCATGGCTAAAATGGGACAAAATGTTTCACTTAATTTAAGAGAAGCGCTGAACTGGATTAAACTGGAATACAACAACCCTCGAATC
TTGATTGCTGAGAATGGCTGGTTCACAGACAGTCGTGTGAAAACAGAAGACACCACGGCCATCTACATGATGAAGAATTTCCTCAGCCAG
GTGCTTCAAGCAATAAGGTTAGATGAAATACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTGGATGGCTTTGAATGGCAGGATGCTTAC
ACCATCCGCCGAGGATTATTTTATGTGGATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAGTCTTCAGCACACTACTACAAACAGATC
ATACGAGAAAATGGTTTTTCTTTAAAAGAGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGTGACTTCTCCTGGGGTGTCACTGAATCT
GTTCTTAAGCCCGAGTCTGTGGCTTCGTCCCCACAGTTCAGCGATCCTCATCTGTACGTGTGGAACGCCACTGGCAACAGACTGTTGCAC
CGAGTGGAAGGGGTGAGGCTGAAAACACGACCCGCTCAATGCACAGATTTTGTAAACATCAAAAAACAACTTGAGATGTTGGCAAGAATG
AAAGTCACCCACTACCGGTTTGCTCTGGATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCCGCGGTGAACCGACAGGCCCTGAGGTAC
TACAGGTGCGTGGTCAGTGAGGGGCTGAAGCTTGGCATCTCCGCGATGGTCACCCTGTATTATCCGACCCACGCCCACCTAGGCCTCCCC
GAGCCTCTGTTGCATGCCGACGGGTGGCTGAACCCATCGACGGCCGAGGCCTTCCAGGCCTACGCTGGGCTGTGCTTCCAGGAGCTGGGG
GACCTGGTGAAGCTCTGGATCACCATCAACGAGCCTAACCGGCTAAGTGACATCTACAACCGCTCTGGCAACGACACCTACGGGGCGGCG
CACAACCTGCTGGTGGCCCACGCCCTGGCCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCACAGCGCGGGGCCGTGTCGCTGTCGCTG
CACGCGGACTGGGCGGAACCCGCCAACCCCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGCTTCCTGCAGTTCGAGATCGCCTGGTTC
GCCGAGCCGCTCTTCAAGACCGGGGACTACCCCGCGGCCATGAGGGAATACATTGCCTCCAAGCACCGACGGGGGCTTTCCAGCTCGGCC
CTGCCGCGCCTCACCGAGGCCGAAAGGAGGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTCAACCACTTCACCACTAGGTTCGTGATG
CACGAGCAGCTGGCCGGCAGCCGCTACGACTCGGACAGGGACATCCAGTTTCTGCAGGACATCACCCGCCTGAGCTCCCCCACGCGCCTG
GCTGTGATTCCCTGGGGGGTGCGCAAGCTGCTGCGGTGGGTCCGGAGGAACTACGGCGACATGGACATTTACATCACCGCCAGTGGCATC
GACGACCAGGCTCTGGAGGATGACCGGCTCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAGGTGCTGAAAGCATACCTGATTGATAAA
GTCAGAATCAAAGGCTATTATGCATTCAAACTGGCTGAAGAGAAATCTAAACCCAGATTTGGATTCTTCACATCTGATTTTAAAGCTAAA
TCCTCAATACAATTTTACAACAAAGTGATCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGTTCTAGATGCAGTCAGACCCAAGAAAAT
ACAGAGTGCACTGTCTGCTTATTCCTTGTGCAGAAGAAACCACTGATATTCCTGGGTTGTTGCTTCTTCTCCACCCTGGTTCTACTCTTA
TCAATTGCCATTTTTCAAAGGCAGAAGAGAAGAAAGTTTTGGAAAGCAAAAAACTTACAACACATACCATTAAAGAAAGGCAAGAGAGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_UBE2K_ENST00000261427_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_5843nt
ACGCGAGCTCGTGGCTCGGGCGTATGGGGGCTCCAACGGGAGCGGCTGCGCCGCCCGGCCGGGTCAACGTCGTGCGCATGCGCCGACCCG
GCGCCATTTTGGTGGCCGGGCGCGGAGGTGATTCCACACTGAGGCGAGCGCGGCGGCCGGGGTGGTAGTGGCAGTGTTCGTGTGCTCAGG
TCTGAATCGCCGAGGGAGGAGGCGGTGGAGGAAGAGGTGGCGGCGGTGGCGGTGGTCGTAGCGGTGGCGGAGGAGGCGGGTACGAATCAG
CTGCGGGCGGAGACATGGCCAACATCGCGGTGCAGCGAATCAAGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGACGAGCAAAAATC
AAATTAAAGTAGATCTTGTAGATGAGAATTTTACAGAATTAAGAGGAGAAATAGCAGGACCTCCAGACACACCATATGAAGGAGGAAGAT
ACCAACTAGAGATAAAAATACCAGAAACATACCCATTTAATCCCCCTAAGGTCCGGTTTATCACTAAAATATGGCATCCTAATATTAGTT
CCGTCACAGGGGCTATTTGTTTGGATATCCTGAAAGATCAATGGGCAGCTGCAATGACTCTCCGCACGGTATTATTGTCATTGCAAGCAC
TATTGGCAGCTGCAGAGCCAGATGATCCACAGGATGCTGTAGTAGCAAATCAGGCTCACTCGAAAGTTTGGCATAACTACAACACACATT
TCCGCCCACATCAGAAGGGTTGGTTATCGATCACGTTGGGATCTCATTGGATCGAGCCAAACCGGTCGGAAAACACGATGGATATATTCA
AATGTCAACAATCCATGGTTTCTGTGCTTGGATGGTTTGCCAACCCTATCCATGGGGATGGCGACTATCCAGAGGGGATGAGAAAGAAGT
TGTTCTCCGTTCTACCCATTTTCTCTGAAGCAGAGAAGCATGAGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCTTTTGGACCCAACA
ACTTCAAGCCCCTAAACACCATGGCTAAAATGGGACAAAATGTTTCACTTAATTTAAGAGAAGCGCTGAACTGGATTAAACTGGAATACA
ACAACCCTCGAATCTTGATTGCTGAGAATGGCTGGTTCACAGACAGTCGTGTGAAAACAGAAGACACCACGGCCATCTACATGATGAAGA
ATTTCCTCAGCCAGGTGCTTCAAGCAATAAGGTTAGATGAAATACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTGGATGGCTTTGAAT
GGCAGGATGCTTACACCATCCGCCGAGGATTATTTTATGTGGATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAGTCTTCAGCACACT
ACTACAAACAGATCATACGAGAAAATGGTTTTTCTTTAAAAGAGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGTGACTTCTCCTGGG
GTGTCACTGAATCTGTTCTTAAGCCCGAGTCTGTGGCTTCGTCCCCACAGTTCAGCGATCCTCATCTGTACGTGTGGAACGCCACTGGCA
ACAGACTGTTGCACCGAGTGGAAGGGGTGAGGCTGAAAACACGACCCGCTCAATGCACAGATTTTGTAAACATCAAAAAACAACTTGAGA
TGTTGGCAAGAATGAAAGTCACCCACTACCGGTTTGCTCTGGATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCCGCGGTGAACCGAC
AGGCCCTGAGGTACTACAGGTGCGTGGTCAGTGAGGGGCTGAAGCTTGGCATCTCCGCGATGGTCACCCTGTATTATCCGACCCACGCCC
ACCTAGGCCTCCCCGAGCCTCTGTTGCATGCCGACGGGTGGCTGAACCCATCGACGGCCGAGGCCTTCCAGGCCTACGCTGGGCTGTGCT
TCCAGGAGCTGGGGGACCTGGTGAAGCTCTGGATCACCATCAACGAGCCTAACCGGCTAAGTGACATCTACAACCGCTCTGGCAACGACA
CCTACGGGGCGGCGCACAACCTGCTGGTGGCCCACGCCCTGGCCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCACAGCGCGGGGCCG
TGTCGCTGTCGCTGCACGCGGACTGGGCGGAACCCGCCAACCCCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGCTTCCTGCAGTTCG
AGATCGCCTGGTTCGCCGAGCCGCTCTTCAAGACCGGGGACTACCCCGCGGCCATGAGGGAATACATTGCCTCCAAGCACCGACGGGGGC
TTTCCAGCTCGGCCCTGCCGCGCCTCACCGAGGCCGAAAGGAGGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTCAACCACTTCACCA
CTAGGTTCGTGATGCACGAGCAGCTGGCCGGCAGCCGCTACGACTCGGACAGGGACATCCAGTTTCTGCAGGACATCACCCGCCTGAGCT
CCCCCACGCGCCTGGCTGTGATTCCCTGGGGGGTGCGCAAGCTGCTGCGGTGGGTCCGGAGGAACTACGGCGACATGGACATTTACATCA
CCGCCAGTGGCATCGACGACCAGGCTCTGGAGGATGACCGGCTCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAGGTGCTGAAAGCAT
ACCTGATTGATAAAGTCAGAATCAAAGGCTATTATGCATTCAAACTGGCTGAAGAGAAATCTAAACCCAGATTTGGATTCTTCACATCTG
ATTTTAAAGCTAAATCCTCAATACAATTTTACAACAAAGTGATCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGTTCTAGATGCAGTC
AGACCCAAGAAAATACAGAGTGCACTGTCTGCTTATTCCTTGTGCAGAAGAAACCACTGATATTCCTGGGTTGTTGCTTCTTCTCCACCC
TGGTTCTACTCTTATCAATTGCCATTTTTCAAAGGCAGAAGAGAAGAAAGTTTTGGAAAGCAAAAAACTTACAACACATACCATTAAAGA
AAGGCAAGAGAGTTGTTAGCTAAACTGATCTGTCTGCATGATAGACAGTTTAAAAATTCATCCCAGTTCCATATGCTGGTAACTTACAGG
AGATATACCTGTATTATAGAAAGACAATCTGAGATACAGCTGTAACCAAGGTGATGACAATTGTCTCTGCTGTGTGGTTCAAAGAACATT
CCCTTAGGTGTTGACATCAGTGAACTCAGTTCTTGGATGTAAACATAAAGGCTTCATCCTGACAGTAAGCTATGAGGATTACATGCTACA
TTGCTTCTTAAAGTTTCATCAACTGTATTCCATCATTCTGCTTTAGCTTTCATCTCTACCAATAGCTACTTGTGGTACAATAAATTATTT
TTAAGAAGTAAAACTCTGGGGCTGGACGCTGTGGCTCACACCTGTAATCTCAGCACTTTGGGAGGCCGAGGCGGGGAGATCACCTGAGGT
GAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCATGTCTCTACTAAAAATACAAAAAATTAGCCAGGCGTGGTGACAGTGGCACC
TGTAATCCCAGCTACTTGGGAGGCTGAGGCAGAAGTTTGAACCCAGGAAACAGGTTACAGTAGGCCAAAATTGCGCCACTGCACTCCAGC
CTAGGCGACAACAGCAAGACTGTGTCCAAAAAAAAAAAAAAAAGCAAAAGCAAAACTTTGTTTTGTTAGACTCTACAGCAGAGATTTAAC
ACCCTTCTTTAAACTGGGTAGTCAGTGATAGATAATATATATTCTGTCACTTCTAATAAGGTGCCTTCTCCTTTAGGTCAGGGTGGTTCT
AAAATGGAAAGAAAACACAATAGGGTAAGTAGTGCTTGTCTAAGCCAGTTACAACACAGACTCTTAAAGAGGATCAAGCCCTTCATTTTT
CTAACAACAAAAAATCACCTATAGAATATCTAATTTGTGATCTTTTACTAGATCTGATTTTTTAAAATAATGTAATTTCCGGCCAGGCAC
GGTGGCACCGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGTGGATCACCTGAGGTTAGGAGTTCGAGACTAGCCTGGCCAACATG
GCAAAACCCCATCTCTACTAAAAATACAAAAGTTAGCCGGGCATGGTGGTGGGCACCTGTAATCCCAGCTACTCAGGAGGCCGAGGCAGG
AGAATCGCTTGAACCCGAGAGGCAGAGGTTGCAATGAGCCAAGATCGTGCCATTGCACTCCAGCCTGGGGGACAGGGCAAGACTGTCTCT
CAAAATAAAAAAAAATAATAAAAATAAAAATAAAAGTAATTTCCAAAACCTCATCTCATGGAAAGATCACAGGATGAAGGAAAGCTAGAC
TCAACTCTGTGAATAGAAGTTGCTATACTGTAAGTAAAGCAACAATTCAGAATACTGAATGAGTTTAAATTGTTTTATATAGCACCCTTT
TGGGCTAGGGTTAATTACTAGATCTGACTTGGATAATTTGACACTTTGGGAAATGAACTCTGTTCTTGAGACTTGTTCAGTGTATTTTAA
ACATCTGAGGAAGAAAACTTAAATATGCACCTATTTATACCTATTCTTTCTTTAGGTCAACATTTAACACCCACTGCATACATTAATTTG
TCCTTGTCTGCTCACTCCAGCAATTTAGACCTTAACAGTCACAAGAGACGTTCTTCTGTTACAAAGCCTTAGTAAATTAAGGCAGTTTTG
ATTATATTCTAGGTCCACCTATGTCTGAAGCTAAATTCAGTATCTAACTGCTAATGAACAAGTTTCCAAAATACTGTAAAAATACAATTA
GTCAATTTGAGTAAATGCAAATATGATGAGAAATCAATTTGCTATTTGGCCTGGCAAATGGGAACAGTAAAATTCTGCTTTACTCTTCTC
TAGTCTCCTTGCCCCAGCTGCACCCACTACCCCAAAGTTGGCAGTTTTGAGGTATGATTTTCAAGGAATTTTTTTAGTATTAACATCTCC
CTCTGAGAACTATGTACCTAAGGTCACGCATACAACTAGTCAATTCTGTTTTTATTACTCTAACTATGTAGAAACAGTAAGTCACTTAAA
ACAATCACTTGGCTGGGTTTTTTCCCCTTTGTGCCACATTGATTCACCCTGACCCAAGAACTCCAGGGAAAATTCTTTAATGTCAACTGG
GCAACTCATTAACCTCTCTTTAACATCAAGGGCTTGGGAAAAAAAAAAAAAAGGTTAGCCACAGGAATAACAAAAACCTGGAATTTATCT
TTCAGGTTTTGCTTTCTCTTTCTCACTTTGTTTAAAGTATCTCGTACTCACAGTTCACAAATTAACCTTCACTGTCTCTTTCACATTAAG
AGCTTATGCTTAAAGCATGCCCCCCTTTTCTAACTTGCTGGTTTACCATAAACTCCCCTAAGTAATAAAATTCCTAACCCAGTACTGAGA
GTCCTCCTTCTCTGCCACTTGGGCATTATTTTACTAGTTTTTAAGCCATCATCGCACAAGAATCCAAAAACCCTTAAATTTTTTAACCAC
TGGCAAATATGTACAGCAAATTAGGTTAAGCATTTAATCTGGCTCATGCTCTATCATACTAAATATTCAGGTTTATCATAAACTCCTTAA
AAACCATCAAAGGTCAACCAGAAACTGATAACTCTTGAAAGGAGCAAACAGGTAAGATCTTTGGAGTTTAAGCTTTTCTGAGATGTGTTG
TGAAAAATCTAACGTGTTTATCGTATATTCAATGTAACAACCTGGAGAATCACAACTATATTTAAAGAGCCTCTGGAAAATGAGGCCAGT

>In-frame_UBE2K_ENST00000503368_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_5571nt
GATTCCACACTGAGGCGAGCGCGGCGGCCGGGGTGGTAGTGGCAGTGTTCGTGTGCTCAGGTCTGAATCGCCGAGGGAGGAGGCGGTGGA
GGAAGAGGTGGCGGCGGTGGCGGTGGTCGTAGCGGTGGCGGAGGAGGCGGGTACGAATCAGCTGCGGGCGGAGACATGGCCAACATCGCG
GTGCAGCGAATCAAGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGGTCCGGTTTATCACTAAAATATGGCATCCTAATATTAGTTCC
GTCACAGGGGCTATTTGTTTGGATATCCTGAAAGATCAATGGGCAGCTGCAATGACTCTCCGCACGGTATTATTGTCATTGCAAGCACTA
TTGGCAGCTGCAGAGCCAGATGATCCACAGGATGCTGTAGTAGCAAATCAGGCTCACTCGAAAGTTTGGCATAACTACAACACACATTTC
CGCCCACATCAGAAGGGTTGGTTATCGATCACGTTGGGATCTCATTGGATCGAGCCAAACCGGTCGGAAAACACGATGGATATATTCAAA
TGTCAACAATCCATGGTTTCTGTGCTTGGATGGTTTGCCAACCCTATCCATGGGGATGGCGACTATCCAGAGGGGATGAGAAAGAAGTTG
TTCTCCGTTCTACCCATTTTCTCTGAAGCAGAGAAGCATGAGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCTTTTGGACCCAACAAC
TTCAAGCCCCTAAACACCATGGCTAAAATGGGACAAAATGTTTCACTTAATTTAAGAGAAGCGCTGAACTGGATTAAACTGGAATACAAC
AACCCTCGAATCTTGATTGCTGAGAATGGCTGGTTCACAGACAGTCGTGTGAAAACAGAAGACACCACGGCCATCTACATGATGAAGAAT
TTCCTCAGCCAGGTGCTTCAAGCAATAAGGTTAGATGAAATACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTGGATGGCTTTGAATGG
CAGGATGCTTACACCATCCGCCGAGGATTATTTTATGTGGATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAGTCTTCAGCACACTAC
TACAAACAGATCATACGAGAAAATGGTTTTTCTTTAAAAGAGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGTGACTTCTCCTGGGGT
GTCACTGAATCTGTTCTTAAGCCCGAGTCTGTGGCTTCGTCCCCACAGTTCAGCGATCCTCATCTGTACGTGTGGAACGCCACTGGCAAC
AGACTGTTGCACCGAGTGGAAGGGGTGAGGCTGAAAACACGACCCGCTCAATGCACAGATTTTGTAAACATCAAAAAACAACTTGAGATG
TTGGCAAGAATGAAAGTCACCCACTACCGGTTTGCTCTGGATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCCGCGGTGAACCGACAG
GCCCTGAGGTACTACAGGTGCGTGGTCAGTGAGGGGCTGAAGCTTGGCATCTCCGCGATGGTCACCCTGTATTATCCGACCCACGCCCAC
CTAGGCCTCCCCGAGCCTCTGTTGCATGCCGACGGGTGGCTGAACCCATCGACGGCCGAGGCCTTCCAGGCCTACGCTGGGCTGTGCTTC
CAGGAGCTGGGGGACCTGGTGAAGCTCTGGATCACCATCAACGAGCCTAACCGGCTAAGTGACATCTACAACCGCTCTGGCAACGACACC
TACGGGGCGGCGCACAACCTGCTGGTGGCCCACGCCCTGGCCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCACAGCGCGGGGCCGTG
TCGCTGTCGCTGCACGCGGACTGGGCGGAACCCGCCAACCCCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGCTTCCTGCAGTTCGAG
ATCGCCTGGTTCGCCGAGCCGCTCTTCAAGACCGGGGACTACCCCGCGGCCATGAGGGAATACATTGCCTCCAAGCACCGACGGGGGCTT
TCCAGCTCGGCCCTGCCGCGCCTCACCGAGGCCGAAAGGAGGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTCAACCACTTCACCACT
AGGTTCGTGATGCACGAGCAGCTGGCCGGCAGCCGCTACGACTCGGACAGGGACATCCAGTTTCTGCAGGACATCACCCGCCTGAGCTCC
CCCACGCGCCTGGCTGTGATTCCCTGGGGGGTGCGCAAGCTGCTGCGGTGGGTCCGGAGGAACTACGGCGACATGGACATTTACATCACC
GCCAGTGGCATCGACGACCAGGCTCTGGAGGATGACCGGCTCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAGGTGCTGAAAGCATAC
CTGATTGATAAAGTCAGAATCAAAGGCTATTATGCATTCAAACTGGCTGAAGAGAAATCTAAACCCAGATTTGGATTCTTCACATCTGAT
TTTAAAGCTAAATCCTCAATACAATTTTACAACAAAGTGATCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGTTCTAGATGCAGTCAG
ACCCAAGAAAATACAGAGTGCACTGTCTGCTTATTCCTTGTGCAGAAGAAACCACTGATATTCCTGGGTTGTTGCTTCTTCTCCACCCTG
GTTCTACTCTTATCAATTGCCATTTTTCAAAGGCAGAAGAGAAGAAAGTTTTGGAAAGCAAAAAACTTACAACACATACCATTAAAGAAA
GGCAAGAGAGTTGTTAGCTAAACTGATCTGTCTGCATGATAGACAGTTTAAAAATTCATCCCAGTTCCATATGCTGGTAACTTACAGGAG
ATATACCTGTATTATAGAAAGACAATCTGAGATACAGCTGTAACCAAGGTGATGACAATTGTCTCTGCTGTGTGGTTCAAAGAACATTCC
CTTAGGTGTTGACATCAGTGAACTCAGTTCTTGGATGTAAACATAAAGGCTTCATCCTGACAGTAAGCTATGAGGATTACATGCTACATT
GCTTCTTAAAGTTTCATCAACTGTATTCCATCATTCTGCTTTAGCTTTCATCTCTACCAATAGCTACTTGTGGTACAATAAATTATTTTT
AAGAAGTAAAACTCTGGGGCTGGACGCTGTGGCTCACACCTGTAATCTCAGCACTTTGGGAGGCCGAGGCGGGGAGATCACCTGAGGTGA
GGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCATGTCTCTACTAAAAATACAAAAAATTAGCCAGGCGTGGTGACAGTGGCACCTG
TAATCCCAGCTACTTGGGAGGCTGAGGCAGAAGTTTGAACCCAGGAAACAGGTTACAGTAGGCCAAAATTGCGCCACTGCACTCCAGCCT
AGGCGACAACAGCAAGACTGTGTCCAAAAAAAAAAAAAAAAGCAAAAGCAAAACTTTGTTTTGTTAGACTCTACAGCAGAGATTTAACAC
CCTTCTTTAAACTGGGTAGTCAGTGATAGATAATATATATTCTGTCACTTCTAATAAGGTGCCTTCTCCTTTAGGTCAGGGTGGTTCTAA
AATGGAAAGAAAACACAATAGGGTAAGTAGTGCTTGTCTAAGCCAGTTACAACACAGACTCTTAAAGAGGATCAAGCCCTTCATTTTTCT
AACAACAAAAAATCACCTATAGAATATCTAATTTGTGATCTTTTACTAGATCTGATTTTTTAAAATAATGTAATTTCCGGCCAGGCACGG
TGGCACCGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGTGGATCACCTGAGGTTAGGAGTTCGAGACTAGCCTGGCCAACATGGC
AAAACCCCATCTCTACTAAAAATACAAAAGTTAGCCGGGCATGGTGGTGGGCACCTGTAATCCCAGCTACTCAGGAGGCCGAGGCAGGAG
AATCGCTTGAACCCGAGAGGCAGAGGTTGCAATGAGCCAAGATCGTGCCATTGCACTCCAGCCTGGGGGACAGGGCAAGACTGTCTCTCA
AAATAAAAAAAAATAATAAAAATAAAAATAAAAGTAATTTCCAAAACCTCATCTCATGGAAAGATCACAGGATGAAGGAAAGCTAGACTC
AACTCTGTGAATAGAAGTTGCTATACTGTAAGTAAAGCAACAATTCAGAATACTGAATGAGTTTAAATTGTTTTATATAGCACCCTTTTG
GGCTAGGGTTAATTACTAGATCTGACTTGGATAATTTGACACTTTGGGAAATGAACTCTGTTCTTGAGACTTGTTCAGTGTATTTTAAAC
ATCTGAGGAAGAAAACTTAAATATGCACCTATTTATACCTATTCTTTCTTTAGGTCAACATTTAACACCCACTGCATACATTAATTTGTC
CTTGTCTGCTCACTCCAGCAATTTAGACCTTAACAGTCACAAGAGACGTTCTTCTGTTACAAAGCCTTAGTAAATTAAGGCAGTTTTGAT
TATATTCTAGGTCCACCTATGTCTGAAGCTAAATTCAGTATCTAACTGCTAATGAACAAGTTTCCAAAATACTGTAAAAATACAATTAGT
CAATTTGAGTAAATGCAAATATGATGAGAAATCAATTTGCTATTTGGCCTGGCAAATGGGAACAGTAAAATTCTGCTTTACTCTTCTCTA
GTCTCCTTGCCCCAGCTGCACCCACTACCCCAAAGTTGGCAGTTTTGAGGTATGATTTTCAAGGAATTTTTTTAGTATTAACATCTCCCT
CTGAGAACTATGTACCTAAGGTCACGCATACAACTAGTCAATTCTGTTTTTATTACTCTAACTATGTAGAAACAGTAAGTCACTTAAAAC
AATCACTTGGCTGGGTTTTTTCCCCTTTGTGCCACATTGATTCACCCTGACCCAAGAACTCCAGGGAAAATTCTTTAATGTCAACTGGGC
AACTCATTAACCTCTCTTTAACATCAAGGGCTTGGGAAAAAAAAAAAAAAGGTTAGCCACAGGAATAACAAAAACCTGGAATTTATCTTT
CAGGTTTTGCTTTCTCTTTCTCACTTTGTTTAAAGTATCTCGTACTCACAGTTCACAAATTAACCTTCACTGTCTCTTTCACATTAAGAG
CTTATGCTTAAAGCATGCCCCCCTTTTCTAACTTGCTGGTTTACCATAAACTCCCCTAAGTAATAAAATTCCTAACCCAGTACTGAGAGT
CCTCCTTCTCTGCCACTTGGGCATTATTTTACTAGTTTTTAAGCCATCATCGCACAAGAATCCAAAAACCCTTAAATTTTTTAACCACTG
GCAAATATGTACAGCAAATTAGGTTAAGCATTTAATCTGGCTCATGCTCTATCATACTAAATATTCAGGTTTATCATAAACTCCTTAAAA
ACCATCAAAGGTCAACCAGAAACTGATAACTCTTGAAAGGAGCAAACAGGTAAGATCTTTGGAGTTTAAGCTTTTCTGAGATGTGTTGTG
AAAAATCTAACGTGTTTATCGTATATTCAATGTAACAACCTGGAGAATCACAACTATATTTAAAGAGCCTCTGGAAAATGAGGCCAGTAC

>In-frame_UBE2K_ENST00000445950_chr4_39776553_+_KLB_ENST00000257408_chr4_39435830_+_5711nt
GGCGAGCGCGGCGGCCGGGGTGGTAGTGGCAGTGTTCGTGTGCTCAGGTCTGAATCGCCGAGGGAGGAGGCGGTGGAGGAAGAGGTGGCG
GCGGTGGCGGTGGTCGTAGCGGTGGCGGAGGAGGCGGGTACGAATCAGCTGCGGGCGGAGACATGGCCAACATCGCGGTGCAGCGAATCA
AGCGGGAGTTCAAGGAGGTGCTGAAGAGCGAGGAGACGAGCAAAAATCAAATTAAAGTAGATCTTGTAGATGAGAATTTTACAGAATTAA
GAGGAGAAATAGCAGGACCTCCAGACACACCATATGAAGGAGGAAGATACCAACTAGAGATAAAAATACCAGAAACATACCCATTTAATC
CCCCTAAGGTCCGGTTTATCACTAAAATATGGCATCCTAATATTAGTTCCGTCACAGGGGCTATTTGTTTGGATATCCTGAAAGATCAAT
GGGCAGCTGCAATGACTCTCCGCACGGTATTATTGTCATTGCAAGCACTATTGGCAGCTGCAGAGCCAGATGATCCACAGGATGCTGTAG
TAGCAAATCAGGCTCACTCGAAAGTTTGGCATAACTACAACACACATTTCCGCCCACATCAGAAGGGTTGGTTATCGATCACGTTGGGAT
CTCATTGGATCGAGCCAAACCGGTCGGAAAACACGATGGATATATTCAAATGTCAACAATCCATGGTTTCTGTGCTTGGATGGTTTGCCA
ACCCTATCCATGGGGATGGCGACTATCCAGAGGGGATGAGAAAGAAGTTGTTCTCCGTTCTACCCATTTTCTCTGAAGCAGAGAAGCATG
AGATGAGAGGCACAGCTGATTTCTTTGCCTTTTCTTTTGGACCCAACAACTTCAAGCCCCTAAACACCATGGCTAAAATGGGACAAAATG
TTTCACTTAATTTAAGAGAAGCGCTGAACTGGATTAAACTGGAATACAACAACCCTCGAATCTTGATTGCTGAGAATGGCTGGTTCACAG
ACAGTCGTGTGAAAACAGAAGACACCACGGCCATCTACATGATGAAGAATTTCCTCAGCCAGGTGCTTCAAGCAATAAGGTTAGATGAAA
TACGAGTGTTTGGTTATACTGCCTGGTCTCTCCTGGATGGCTTTGAATGGCAGGATGCTTACACCATCCGCCGAGGATTATTTTATGTGG
ATTTTAACAGTAAACAGAAAGAGCGGAAACCTAAGTCTTCAGCACACTACTACAAACAGATCATACGAGAAAATGGTTTTTCTTTAAAAG
AGTCCACGCCAGATGTGCAGGGCCAGTTTCCCTGTGACTTCTCCTGGGGTGTCACTGAATCTGTTCTTAAGCCCGAGTCTGTGGCTTCGT
CCCCACAGTTCAGCGATCCTCATCTGTACGTGTGGAACGCCACTGGCAACAGACTGTTGCACCGAGTGGAAGGGGTGAGGCTGAAAACAC
GACCCGCTCAATGCACAGATTTTGTAAACATCAAAAAACAACTTGAGATGTTGGCAAGAATGAAAGTCACCCACTACCGGTTTGCTCTGG
ATTGGGCCTCGGTCCTTCCCACTGGCAACCTGTCCGCGGTGAACCGACAGGCCCTGAGGTACTACAGGTGCGTGGTCAGTGAGGGGCTGA
AGCTTGGCATCTCCGCGATGGTCACCCTGTATTATCCGACCCACGCCCACCTAGGCCTCCCCGAGCCTCTGTTGCATGCCGACGGGTGGC
TGAACCCATCGACGGCCGAGGCCTTCCAGGCCTACGCTGGGCTGTGCTTCCAGGAGCTGGGGGACCTGGTGAAGCTCTGGATCACCATCA
ACGAGCCTAACCGGCTAAGTGACATCTACAACCGCTCTGGCAACGACACCTACGGGGCGGCGCACAACCTGCTGGTGGCCCACGCCCTGG
CCTGGCGCCTCTACGACCGGCAGTTCAGGCCCTCACAGCGCGGGGCCGTGTCGCTGTCGCTGCACGCGGACTGGGCGGAACCCGCCAACC
CCTATGCTGACTCGCACTGGAGGGCGGCCGAGCGCTTCCTGCAGTTCGAGATCGCCTGGTTCGCCGAGCCGCTCTTCAAGACCGGGGACT
ACCCCGCGGCCATGAGGGAATACATTGCCTCCAAGCACCGACGGGGGCTTTCCAGCTCGGCCCTGCCGCGCCTCACCGAGGCCGAAAGGA
GGCTGCTCAAGGGCACGGTCGACTTCTGCGCGCTCAACCACTTCACCACTAGGTTCGTGATGCACGAGCAGCTGGCCGGCAGCCGCTACG
ACTCGGACAGGGACATCCAGTTTCTGCAGGACATCACCCGCCTGAGCTCCCCCACGCGCCTGGCTGTGATTCCCTGGGGGGTGCGCAAGC
TGCTGCGGTGGGTCCGGAGGAACTACGGCGACATGGACATTTACATCACCGCCAGTGGCATCGACGACCAGGCTCTGGAGGATGACCGGC
TCCGGAAGTACTACCTAGGGAAGTACCTTCAGGAGGTGCTGAAAGCATACCTGATTGATAAAGTCAGAATCAAAGGCTATTATGCATTCA
AACTGGCTGAAGAGAAATCTAAACCCAGATTTGGATTCTTCACATCTGATTTTAAAGCTAAATCCTCAATACAATTTTACAACAAAGTGA
TCAGCAGCAGGGGCTTCCCTTTTGAGAACAGTAGTTCTAGATGCAGTCAGACCCAAGAAAATACAGAGTGCACTGTCTGCTTATTCCTTG
TGCAGAAGAAACCACTGATATTCCTGGGTTGTTGCTTCTTCTCCACCCTGGTTCTACTCTTATCAATTGCCATTTTTCAAAGGCAGAAGA
GAAGAAAGTTTTGGAAAGCAAAAAACTTACAACACATACCATTAAAGAAAGGCAAGAGAGTTGTTAGCTAAACTGATCTGTCTGCATGAT
AGACAGTTTAAAAATTCATCCCAGTTCCATATGCTGGTAACTTACAGGAGATATACCTGTATTATAGAAAGACAATCTGAGATACAGCTG
TAACCAAGGTGATGACAATTGTCTCTGCTGTGTGGTTCAAAGAACATTCCCTTAGGTGTTGACATCAGTGAACTCAGTTCTTGGATGTAA
ACATAAAGGCTTCATCCTGACAGTAAGCTATGAGGATTACATGCTACATTGCTTCTTAAAGTTTCATCAACTGTATTCCATCATTCTGCT
TTAGCTTTCATCTCTACCAATAGCTACTTGTGGTACAATAAATTATTTTTAAGAAGTAAAACTCTGGGGCTGGACGCTGTGGCTCACACC
TGTAATCTCAGCACTTTGGGAGGCCGAGGCGGGGAGATCACCTGAGGTGAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCATGT
CTCTACTAAAAATACAAAAAATTAGCCAGGCGTGGTGACAGTGGCACCTGTAATCCCAGCTACTTGGGAGGCTGAGGCAGAAGTTTGAAC
CCAGGAAACAGGTTACAGTAGGCCAAAATTGCGCCACTGCACTCCAGCCTAGGCGACAACAGCAAGACTGTGTCCAAAAAAAAAAAAAAA
AGCAAAAGCAAAACTTTGTTTTGTTAGACTCTACAGCAGAGATTTAACACCCTTCTTTAAACTGGGTAGTCAGTGATAGATAATATATAT
TCTGTCACTTCTAATAAGGTGCCTTCTCCTTTAGGTCAGGGTGGTTCTAAAATGGAAAGAAAACACAATAGGGTAAGTAGTGCTTGTCTA
AGCCAGTTACAACACAGACTCTTAAAGAGGATCAAGCCCTTCATTTTTCTAACAACAAAAAATCACCTATAGAATATCTAATTTGTGATC
TTTTACTAGATCTGATTTTTTAAAATAATGTAATTTCCGGCCAGGCACGGTGGCACCGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGC
AGGTGGATCACCTGAGGTTAGGAGTTCGAGACTAGCCTGGCCAACATGGCAAAACCCCATCTCTACTAAAAATACAAAAGTTAGCCGGGC
ATGGTGGTGGGCACCTGTAATCCCAGCTACTCAGGAGGCCGAGGCAGGAGAATCGCTTGAACCCGAGAGGCAGAGGTTGCAATGAGCCAA
GATCGTGCCATTGCACTCCAGCCTGGGGGACAGGGCAAGACTGTCTCTCAAAATAAAAAAAAATAATAAAAATAAAAATAAAAGTAATTT
CCAAAACCTCATCTCATGGAAAGATCACAGGATGAAGGAAAGCTAGACTCAACTCTGTGAATAGAAGTTGCTATACTGTAAGTAAAGCAA
CAATTCAGAATACTGAATGAGTTTAAATTGTTTTATATAGCACCCTTTTGGGCTAGGGTTAATTACTAGATCTGACTTGGATAATTTGAC
ACTTTGGGAAATGAACTCTGTTCTTGAGACTTGTTCAGTGTATTTTAAACATCTGAGGAAGAAAACTTAAATATGCACCTATTTATACCT
ATTCTTTCTTTAGGTCAACATTTAACACCCACTGCATACATTAATTTGTCCTTGTCTGCTCACTCCAGCAATTTAGACCTTAACAGTCAC
AAGAGACGTTCTTCTGTTACAAAGCCTTAGTAAATTAAGGCAGTTTTGATTATATTCTAGGTCCACCTATGTCTGAAGCTAAATTCAGTA
TCTAACTGCTAATGAACAAGTTTCCAAAATACTGTAAAAATACAATTAGTCAATTTGAGTAAATGCAAATATGATGAGAAATCAATTTGC
TATTTGGCCTGGCAAATGGGAACAGTAAAATTCTGCTTTACTCTTCTCTAGTCTCCTTGCCCCAGCTGCACCCACTACCCCAAAGTTGGC
AGTTTTGAGGTATGATTTTCAAGGAATTTTTTTAGTATTAACATCTCCCTCTGAGAACTATGTACCTAAGGTCACGCATACAACTAGTCA
ATTCTGTTTTTATTACTCTAACTATGTAGAAACAGTAAGTCACTTAAAACAATCACTTGGCTGGGTTTTTTCCCCTTTGTGCCACATTGA
TTCACCCTGACCCAAGAACTCCAGGGAAAATTCTTTAATGTCAACTGGGCAACTCATTAACCTCTCTTTAACATCAAGGGCTTGGGAAAA
AAAAAAAAAAGGTTAGCCACAGGAATAACAAAAACCTGGAATTTATCTTTCAGGTTTTGCTTTCTCTTTCTCACTTTGTTTAAAGTATCT
CGTACTCACAGTTCACAAATTAACCTTCACTGTCTCTTTCACATTAAGAGCTTATGCTTAAAGCATGCCCCCCTTTTCTAACTTGCTGGT
TTACCATAAACTCCCCTAAGTAATAAAATTCCTAACCCAGTACTGAGAGTCCTCCTTCTCTGCCACTTGGGCATTATTTTACTAGTTTTT
AAGCCATCATCGCACAAGAATCCAAAAACCCTTAAATTTTTTAACCACTGGCAAATATGTACAGCAAATTAGGTTAAGCATTTAATCTGG
CTCATGCTCTATCATACTAAATATTCAGGTTTATCATAAACTCCTTAAAAACCATCAAAGGTCAACCAGAAACTGATAACTCTTGAAAGG
AGCAAACAGGTAAGATCTTTGGAGTTTAAGCTTTTCTGAGATGTGTTGTGAAAAATCTAACGTGTTTATCGTATATTCAATGTAACAACC
TGGAGAATCACAACTATATTTAAAGAGCCTCTGGAAAATGAGGCCAGTACAGTGTGACTACATGTTTAATTTTCAATGTAATTTATTCCA


Top

FusionGenePPI for UBE2K_KLB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UBE2KDSTYK, HTT, RNF2, UBE2I, DDX58, RNF125, RNF138, BFAR, UBOX5, RNF5, DTX3, MARCH7, SIAH1, TRIM27, RNF185, TRIM35, BIRC7, BIRC8, RNF4, TRIM34, RNF167, UHRF2, TRAF7, MKRN2, TRAIP, RING1, RNF41, MARCH3, RNF32, RNF114, LRSAM1, CBLC, DTX3L, DZIP3, MID1, MKRN3, TRIM39, RNF111, RNF144A, TRIM2, TRIM31, TRIM43, TRIM5, RBCK1, ITSN1, PRPF40A, CCNB1, DIABLO, BRCA1, UBC, CASP12, PIAS4, NUB1, NXF1, FZR1, NEDD4L, WWP2, ITCH, WDR1, WDR61, TXNDC17, TYMS, TXN, ANAPC11, IQCB1, BAG3, UBA1, TP53, MDM2, CDC6, PRRG4, REL, MIPOL1, DDI1, ZDHHC17, AMFR, BARD1, SENP1, MAP3K1, HNRNPA1, UBE2D2, RAB1A, TMEM189-UBE2V1, UBE2V1, UBE2N, RC3H2, TRIM63, SMURF1, CYHR1, ARL15, USP1, DLDKLB


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UBE2K_KLB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UBE2K_KLB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource