FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40371

FusionGeneSummary for UBAP2_USP34

check button Fusion gene summary
Fusion gene informationFusion gene name: UBAP2_USP34
Fusion gene ID: 40371
HgeneTgene
Gene symbol

UBAP2

USP34

Gene ID

55833

9736

Gene nameubiquitin associated protein 2ubiquitin specific peptidase 34
SynonymsUBAP-2-
Cytomap

9p13.3

2p15

Type of geneprotein-codingprotein-coding
Descriptionubiquitin-associated protein 2AD-012 proteinubiquitin carboxyl-terminal hydrolase 34deubiquitinating enzyme 34ubiquitin specific protease 34ubiquitin thioesterase 34ubiquitin thiolesterase 34ubiquitin-specific-processing protease 34
Modification date2018052320180523
UniProtAcc

Q5T6F2

Q70CQ2

Ensembl transtripts involved in fusion geneENST00000449054, ENST00000379238, 
ENST00000360802, ENST00000379239, 
ENST00000539807, ENST00000418786, 
ENST00000379225, ENST00000379235, 
ENST00000480885, 
ENST00000398571, 
ENST00000472689, 
Fusion gene scores* DoF score13 X 10 X 8=10406 X 7 X 2=84
# samples 137
** MAII scorelog2(13/1040*10)=-3
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/84*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: UBAP2 [Title/Abstract] AND USP34 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneUSP34

GO:0016579

protein deubiquitination

14715245

TgeneUSP34

GO:0071108

protein K48-linked deubiquitination

21383061

TgeneUSP34

GO:0090263

positive regulation of canonical Wnt signaling pathway

21383061


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A1F2-01AUBAP2chr9

34017048

-USP34chr2

61512092

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000449054ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5CDS-intronENST00000449054ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
In-frameENST00000379238ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5CDS-intronENST00000379238ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
Frame-shiftENST00000360802ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5CDS-intronENST00000360802ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-3CDSENST00000379239ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-intronENST00000379239ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
5UTR-3CDSENST00000539807ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5UTR-intronENST00000539807ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
Frame-shiftENST00000418786ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5CDS-intronENST00000418786ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-3CDSENST00000379225ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-intronENST00000379225ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-3CDSENST00000379235ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
intron-intronENST00000379235ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-
5UTR-3CDSENST00000480885ENST00000398571UBAP2chr9

34017048

-USP34chr2

61512092

-
5UTR-intronENST00000480885ENST00000472689UBAP2chr9

34017048

-USP34chr2

61512092

-

Top

FusionProtFeatures for UBAP2_USP34


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UBAP2

Q5T6F2

USP34

Q70CQ2


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneUSP34chr9:34017048chr2:61512092ENST00000398571-33801894_223915833547DomainNote=USP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUBAP2chr9:34017048chr2:61512092ENST00000360802-229105_130331120Coiled coilOntology_term=ECO:0000255
HgeneUBAP2chr9:34017048chr2:61512092ENST00000379238-229105_130331120Coiled coilOntology_term=ECO:0000255
HgeneUBAP2chr9:34017048chr2:61512092ENST00000449054-230105_130331190Coiled coilOntology_term=ECO:0000255
HgeneUBAP2chr9:34017048chr2:61512092ENST00000360802-22948_92331120DomainUBA
HgeneUBAP2chr9:34017048chr2:61512092ENST00000379238-22948_92331120DomainUBA
HgeneUBAP2chr9:34017048chr2:61512092ENST00000449054-23048_92331190DomainUBA


Top

FusionGeneSequence for UBAP2_USP34


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UBAP2_ENST00000449054_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_1997aa
MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCC
SLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCSGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPILKPG
CKEYFWLLCKLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNVEDDGLTGLLRLATSVVKHKPPFKFSREGQEFLRDIFNL
LFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQ
QLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNT
VKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMR
YTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKEGFKEVSDHSKDSESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKN
NKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQ
DKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQI
LIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDTSVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFA
KMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTD
MAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQR
IWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDT
TVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCA
DCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELF
NLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHV
TGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTY
HHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLS
VLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCANLIST
LITNLISQYQNLQSDFSNRVEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCLQQRNSLQEQEAKERKTKDDEGAT
PIKRRRVSSDEEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDMSNIRSQHAEEQSN
NGRYDDCKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIEST

>In-frame_UBAP2_ENST00000379238_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_1997aa
MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCC
SLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCSGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPILKPG
CKEYFWLLCKLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNVEDDGLTGLLRLATSVVKHKPPFKFSREGQEFLRDIFNL
LFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQ
QLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNT
VKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMR
YTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKEGFKEVSDHSKDSESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKN
NKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQ
DKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQI
LIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDTSVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFA
KMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTD
MAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQR
IWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDT
TVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCA
DCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELF
NLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHV
TGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTY
HHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLS
VLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSEANCANLIST
LITNLISQYQNLQSDFSNRVEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCLQQRNSLQEQEAKERKTKDDEGAT
PIKRRRVSSDEEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDMSNIRSQHAEEQSN
NGRYDDCKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIEST


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UBAP2_ENST00000449054_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_5991nt
ATGATGACTTCAGTGAGCAGTGACCATTGTCGAGGTGCTCGGGAAAAACCACAGATTTCAGCAGCACAATCAACGCAACCACAGAAACAA
GTGGTACAGGTATTTCTTGTTCTTGTCCAAGGAACCAGTTTGATTCAGCGACTTATGTCTGTTGCTTATACGTATGATAATCTGGCTCCT
AGAGTTTTAAAAGCTCAGTCTGATCACAGGTCTAGACATGAAGTTTCACATTATTCAATGTGGCTCTTGGTGAGTTGGGCTCATTGCTGT
TCTTTAGTGAAATCTAGCCTTGCTGATAGCGATCATTTACAAGATTGGCTAAAGAAATTGACTCTCCTTATTCCTGAGACTGCAGTTCGT
CATGAATCATGCAGTGGTCTCTATAAGTTATCCCTGTCAGGGCTGGATGGAGGAGACTCAATCAATCGTTCTTTTCTGCTATTGGCTGCC
TCAACATTATTGAAATTTCTTCCTGATGCTCAAGCACTCAAACCTATTAGGATAGATGATTATGAGGAAGAACCAATATTAAAACCAGGA
TGTAAAGAGTATTTTTGGTTGTTATGCAAATTAGTTGACAACATACATATAAAGGACGCTAGTCAGACAACGCTCCTCGACTTAGATGCC
TTGGCAAGACATTTGGCTGACTGTATTCGAAGTAGGGAGATCCTTGATCATCAGGATGGTAATGTAGAAGATGATGGGCTTACAGGACTC
CTAAGGCTTGCAACAAGTGTTGTTAAACACAAACCACCCTTTAAATTTTCAAGGGAAGGACAGGAATTTTTGAGAGATATCTTCAATCTC
CTGTTTTTGTTGCCAAGTCTAAAGGACCGACAACAGCCAAAGTGCAAATCACATTCTTCAAGAGCTGCCGCTTACGATTTGTTAGTAGAG
ATGGTAAAGGGGTCTGTTGAGAACTACAGGCTAATACACAACTGGGTTATGGCACAACACATGCAGTCCCATGCACCTTATAAATGGGAT
TACTGGCCTCATGAAGATGTCCGTGCTGAATGTAGATTTGTTGGCCTTACTAACCTTGGAGCTACTTGTTACTTAGCTTCTACTATTCAG
CAACTTTATATGATACCTGAGGCAAGACAGGCTGTCTTCACTGCCAAGTATTCAGAGGATATGAAGCACAAGACCACTCTTCTGGAGCTT
CAGAAAATGTTTACATATTTAATGGAGAGTGAATGCAAAGCATATAATCCTAGACCTTTCTGTAAAACATACACCATGGATAAGCAGCCT
CTGAATACTGGGGAACAGAAAGATATGACAGAGTTTTTTACTGATCTAATTACCAAAATCGAAGAAATGTCTCCCGAACTGAAAAATACC
GTCAAAAGTTTATTTGGAGGTGTAATTACAAACAATGTTGTATCCTTGGATTGTGAACATGTTAGTCAAACTGCTGAAGAGTTTTATACT
GTGAGGTGCCAAGTGGCTGATATGAAGAACATTTATGAATCTCTTGATGAAGTTACTATAAAAGACACTTTGGAAGGTGATAACATGTAT
ACTTGTTCTCATTGTGGGAAGAAAGTACGAGCTGAAAAAAGGGCATGTTTTAAGAAATTGCCTCGCATTTTGAGTTTCAATACTATGAGA
TACACATTTAATATGGTCACGATGATGAAAGAGAAAGTGAATACACACTTTTCCTTCCCATTACGTTTGGACATGACGCCCTATACAGAA
GATTTTCTTATGGGAAAGAGTGAGAGGAAAGAAGGTTTTAAAGAAGTCAGTGATCATTCAAAAGACTCAGAGAGCTATGAATATGACTTG
ATAGGAGTGACTGTTCACACAGGAACGGCAGATGGTGGACACTATTATAGCTTTATCAGAGATATAGTAAATCCCCATGCTTATAAAAAC
AATAAATGGTATCTTTTTAATGATGCTGAGGTAAAACCTTTTGATTCTGCTCAACTTGCATCTGAATGTTTTGGTGGAGAGATGACGACC
AAGACCTATGATTCTGTTACAGATAAATTTATGGACTTCTCTTTTGAAAAGACACACAGTGCATATATGCTGTTTTACAAACGCATGGAA
CCAGAGGAAGAAAATGGCAGAGAATACAAATTTGATGTTTCGTCAGAGTTACTAGAGTGGATTTGGCATGATAACATGCAGTTTCTTCAA
GACAAAAACATTTTTGAACATACATATTTTGGATTTATGTGGCAATTGTGTAGTTGTATTCCCAGTACATTACCAGATCCTAAAGCTGTG
TCCTTAATGACAGCAAAGTTAAGCACTTCCTTTGTCCTAGAGACATTTATTCATTCTAAAGAAAAGCCCACGATGCTTCAGTGGATTGAA
CTGTTGACGAAACAGTTTAATAATAGTCAGGCAGCTTGTGAGTGGTTTTTAGATCGTATGGCTGATGACGACTGGTGGCCAATGCAGATA
CTAATTAAGTGCCCTAATCAAATTGTGAGACAGATGTTTCAGCGTTTGTGTATCCATGTGATTCAGAGGCTGAGACCTGTGCATGCTCAT
CTCTATTTGCAGCCAGGAATGGAAGATGGGTCAGATGATATGGATACCTCAGTAGAAGATATTGGTGGTCGTTCATGTGTCACTCGCTTT
GTGAGAACCCTGTTATTAATTATGGAACATGGTGTAAAACCTCACAGTAAACATCTTACAGAGTATTTTGCCTTCCTTTACGAATTTGCA
AAAATGGGTGAAGAAGAGAGCCAATTTTTGCTTTCATTGCAAGCTATATCTACAATGGTACATTTTTACATGGGAACAAAAGGACCTGAA
AATCCTCAAGTTGAAGTGTTATCAGAGGAAGAAGGGGAAGAAGAAGAGGAGGAAGAAGATATCCTCTCTCTGGCAGAAGAAAAATACAGG
CCAGCTGCCCTTGAAAAGATGATAGCTTTAGTTGCTCTTTTGGTTGAACAGTCTCGATCAGAAAGGCATTTGACATTATCACAGACTGAC
ATGGCAGCATTAACAGGAGGAAAGGGATTTCCCTTCTTGTTTCAACATATTCGTGATGGCATCAATATAAGACAAACTTGTAATCTGATT
TTCAGCCTGTGTCGATACAATAATCGACTTGCAGAACATATTGTATCTATGCTTTTCACATCAATAGCAAAGTTGACTCCTGAGGCAGCC
AATCCTTTCTTTAAGTTGTTGACTATGCTAATGGAGTTTGCTGGTGGACCTCCAGGAATGCCTCCCTTTGCATCTTATATTCTGCAGAGG
ATATGGGAGGTGATTGAATACAATCCTTCTCAGTGTCTAGATTGGTTGGCAGTGCAGACACCCCGAAATAAACTGGCACACAGCTGGGTC
TTACAGAATATGGAAAACTGGGTCGAGCGGTTTCTTTTGGCTCACAATTATCCTAGAGTGAGGACTTCTGCAGCTTATCTTCTGGTGTCC
CTTATACCAAGCAATTCATTCCGTCAGATGTTCCGGTCAACAAGGTCTTTGCACATCCCAACCCGTGACCTTCCACTCAGTCCAGACACA
ACAGTAGTCCTACATCAGGTCTACAACGTGCTCCTTGGTTTGCTCTCAAGAGCCAAACTTTATGTTGATGCTGCTGTTCATGGCACTACA
AAGCTAGTGCCCTATTTTAGCTTTATGACTTACTGTTTAATTTCCAAAACTGAGAAGCTGATGTTTTCCACATATTTCATGGATTTGTGG
AACCTTTTCCAGCCTAAACTTTCTGAGCCAGCAATAGCTACAAATCACAATAAACAGGCTTTGCTTTCATTTTGGTACAATGTCTGTGCT
GACTGTCCAGAGAATATCCGCCTTATTGTTCAGAACCCAGTGGTAACCAAGAACATTGCCTTCAATTACATCCTTGCTGACCATGATGAT
CAGGATGTGGTGCTTTTTAACCGTGGGATGCTGCCAGCGTACTATGGCATTCTGAGGCTCTGCTGTGAGCAGTCTCCTGCATTCACACGA
CAACTGGCTTCTCACCAGAACATCCAGTGGGCCTTTAAGAATCTTACACCACATGCCAGCCAATACCCTGGAGCAGTAGAAGAACTGTTT
AACCTGATGCAGCTGTTTATAGCTCAGAGGCCAGATATGAGAGAAGAAGAATTAGAAGATATTAAACAGTTCAAGAAAACAACCATAAGT
TGTTACTTACGTTGCTTAGATGGCCGCTCCTGCTGGACTACTTTAATAAGTGCCTTCAGAATACTATTAGAATCTGATGAAGACAGACTT
CTTGTTGTATTTAATCGAGGATTGATTCTAATGACAGAGTCTTTCAACACTTTGCACATGATGTATCACGAAGCTACAGCTTGCCATGTG
ACTGGAGATTTAGTAGAACTTCTGTCAATATTTCTTTCGGTTTTGAAGTCTACACGCCCTTATCTTCAGAGAAAAGATGTGAAACAAGCA
TTAATCCAGTGGCAGGAGCGAATTGAATTTGCCCATAAACTGTTAACTCTTCTTAATTCCTATAGTCCTCCAGAACTTAGAAATGCCTGT
ATAGATGTCCTCAAGGAACTTGTACTTTTGAGTCCCCATGATTTTCTTCATACTCTGGTTCCCTTTCTACAACACAACCATTGTACTTAC
CATCACAGTAATATACCAATGTCTCTTGGACCTTATTTCCCTTGTCGAGAAAATATCAAGCTAATAGGAGGGAAAAGCAATATTCGGCCT
CCGCGCCCTGAACTCAATATGTGCCTCTTGCCCACAATGGTGGAAACCAGTAAGGGCAAAGATGACGTTTATGATCGTATGCTGCTAGAC
TACTTCTTTTCTTATCATCAGTTCATCCATCTATTATGCCGAGTTGCAATCAACTGTGAAAAATTTACTGAAACATTAGTTAAGCTGAGT
GTCCTAGTTGCCTATGAAGGTTTGCCACTTCATCTTGCACTGTTCCCCAAACTTTGGACTGAGCTATGCCAGACTCAGTCTGCTATGTCA
AAAAACTGCATCAAGCTTTTGTGTGAAGATCCTGTTTTCGCAGAATATATTAAATGTATCCTAATGGATGAAAGAACTTTTTTAAACAAC
AACATTGTCTACACGTTCATGACACATTTCCTTCTAAAGGTTCAAAGTCAAGTGTTTTCTGAAGCAAACTGTGCCAATTTGATCAGCACT
CTTATTACAAACTTGATAAGCCAGTATCAGAACCTACAGTCTGATTTCTCCAACCGAGTTGAAATTTCCAAAGCAAGTGCTTCTTTAAAT
GGGGACCTGAGGGCACTCGCTTTGCTCCTGTCAGTACACACTCCCAAACAGTTAAACCCAGCTCTAATTCCAACTCTGCAAGAGCTTTTA
AGCAAATGCAGGACTTGTCTGCAACAGAGAAACTCACTCCAAGAGCAAGAAGCCAAAGAAAGAAAAACTAAAGATGATGAAGGAGCAACT
CCCATTAAAAGGCGGCGTGTTAGCAGTGATGAGGAGCACACTGTAGACAGCTGCATCAGTGACATGAAAACAGAAACCAGGGAGGTCCTG
ACCCCAACGAGCACTTCTGACAATGAGACCAGAGACTCCTCAATTATTGATCCAGGAACTGAGCAAGATCTTCCTTCCCCTGAAAATAGT
TCTGTTAAAGAATACCGAATGGAAGTTCCATCTTCGTTTTCAGAAGACATGTCAAATATCAGGTCACAGCATGCAGAAGAACAGTCCAAC
AATGGTAGATATGACGATTGTAAAGAATTTAAAGACCTCCACTGTTCCAAGGATTCTACCCTAGCTGAGGAAGAATCTGAGTTCCCTTCT
ACTTCTATCTCTGCAGTTCTGTCTGACTTAGCTGACTTGAGAAGCTGTGATGGCCAAGCTTTGCCCTCCCAGGACCCTGAGGTTGCTTTA
TCTCTCAGTTGTGGCCATTCCAGAGGACTCTTTAGTCATATGCAGCAACATGACATTTTAGATACCCTGTGTAGGACCATTGAATCTACA

>In-frame_UBAP2_ENST00000379238_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_5991nt
ATGATGACTTCAGTGAGCAGTGACCATTGTCGAGGTGCTCGGGAAAAACCACAGATTTCAGCAGCACAATCAACGCAACCACAGAAACAA
GTGGTACAGGTATTTCTTGTTCTTGTCCAAGGAACCAGTTTGATTCAGCGACTTATGTCTGTTGCTTATACGTATGATAATCTGGCTCCT
AGAGTTTTAAAAGCTCAGTCTGATCACAGGTCTAGACATGAAGTTTCACATTATTCAATGTGGCTCTTGGTGAGTTGGGCTCATTGCTGT
TCTTTAGTGAAATCTAGCCTTGCTGATAGCGATCATTTACAAGATTGGCTAAAGAAATTGACTCTCCTTATTCCTGAGACTGCAGTTCGT
CATGAATCATGCAGTGGTCTCTATAAGTTATCCCTGTCAGGGCTGGATGGAGGAGACTCAATCAATCGTTCTTTTCTGCTATTGGCTGCC
TCAACATTATTGAAATTTCTTCCTGATGCTCAAGCACTCAAACCTATTAGGATAGATGATTATGAGGAAGAACCAATATTAAAACCAGGA
TGTAAAGAGTATTTTTGGTTGTTATGCAAATTAGTTGACAACATACATATAAAGGACGCTAGTCAGACAACGCTCCTCGACTTAGATGCC
TTGGCAAGACATTTGGCTGACTGTATTCGAAGTAGGGAGATCCTTGATCATCAGGATGGTAATGTAGAAGATGATGGGCTTACAGGACTC
CTAAGGCTTGCAACAAGTGTTGTTAAACACAAACCACCCTTTAAATTTTCAAGGGAAGGACAGGAATTTTTGAGAGATATCTTCAATCTC
CTGTTTTTGTTGCCAAGTCTAAAGGACCGACAACAGCCAAAGTGCAAATCACATTCTTCAAGAGCTGCCGCTTACGATTTGTTAGTAGAG
ATGGTAAAGGGGTCTGTTGAGAACTACAGGCTAATACACAACTGGGTTATGGCACAACACATGCAGTCCCATGCACCTTATAAATGGGAT
TACTGGCCTCATGAAGATGTCCGTGCTGAATGTAGATTTGTTGGCCTTACTAACCTTGGAGCTACTTGTTACTTAGCTTCTACTATTCAG
CAACTTTATATGATACCTGAGGCAAGACAGGCTGTCTTCACTGCCAAGTATTCAGAGGATATGAAGCACAAGACCACTCTTCTGGAGCTT
CAGAAAATGTTTACATATTTAATGGAGAGTGAATGCAAAGCATATAATCCTAGACCTTTCTGTAAAACATACACCATGGATAAGCAGCCT
CTGAATACTGGGGAACAGAAAGATATGACAGAGTTTTTTACTGATCTAATTACCAAAATCGAAGAAATGTCTCCCGAACTGAAAAATACC
GTCAAAAGTTTATTTGGAGGTGTAATTACAAACAATGTTGTATCCTTGGATTGTGAACATGTTAGTCAAACTGCTGAAGAGTTTTATACT
GTGAGGTGCCAAGTGGCTGATATGAAGAACATTTATGAATCTCTTGATGAAGTTACTATAAAAGACACTTTGGAAGGTGATAACATGTAT
ACTTGTTCTCATTGTGGGAAGAAAGTACGAGCTGAAAAAAGGGCATGTTTTAAGAAATTGCCTCGCATTTTGAGTTTCAATACTATGAGA
TACACATTTAATATGGTCACGATGATGAAAGAGAAAGTGAATACACACTTTTCCTTCCCATTACGTTTGGACATGACGCCCTATACAGAA
GATTTTCTTATGGGAAAGAGTGAGAGGAAAGAAGGTTTTAAAGAAGTCAGTGATCATTCAAAAGACTCAGAGAGCTATGAATATGACTTG
ATAGGAGTGACTGTTCACACAGGAACGGCAGATGGTGGACACTATTATAGCTTTATCAGAGATATAGTAAATCCCCATGCTTATAAAAAC
AATAAATGGTATCTTTTTAATGATGCTGAGGTAAAACCTTTTGATTCTGCTCAACTTGCATCTGAATGTTTTGGTGGAGAGATGACGACC
AAGACCTATGATTCTGTTACAGATAAATTTATGGACTTCTCTTTTGAAAAGACACACAGTGCATATATGCTGTTTTACAAACGCATGGAA
CCAGAGGAAGAAAATGGCAGAGAATACAAATTTGATGTTTCGTCAGAGTTACTAGAGTGGATTTGGCATGATAACATGCAGTTTCTTCAA
GACAAAAACATTTTTGAACATACATATTTTGGATTTATGTGGCAATTGTGTAGTTGTATTCCCAGTACATTACCAGATCCTAAAGCTGTG
TCCTTAATGACAGCAAAGTTAAGCACTTCCTTTGTCCTAGAGACATTTATTCATTCTAAAGAAAAGCCCACGATGCTTCAGTGGATTGAA
CTGTTGACGAAACAGTTTAATAATAGTCAGGCAGCTTGTGAGTGGTTTTTAGATCGTATGGCTGATGACGACTGGTGGCCAATGCAGATA
CTAATTAAGTGCCCTAATCAAATTGTGAGACAGATGTTTCAGCGTTTGTGTATCCATGTGATTCAGAGGCTGAGACCTGTGCATGCTCAT
CTCTATTTGCAGCCAGGAATGGAAGATGGGTCAGATGATATGGATACCTCAGTAGAAGATATTGGTGGTCGTTCATGTGTCACTCGCTTT
GTGAGAACCCTGTTATTAATTATGGAACATGGTGTAAAACCTCACAGTAAACATCTTACAGAGTATTTTGCCTTCCTTTACGAATTTGCA
AAAATGGGTGAAGAAGAGAGCCAATTTTTGCTTTCATTGCAAGCTATATCTACAATGGTACATTTTTACATGGGAACAAAAGGACCTGAA
AATCCTCAAGTTGAAGTGTTATCAGAGGAAGAAGGGGAAGAAGAAGAGGAGGAAGAAGATATCCTCTCTCTGGCAGAAGAAAAATACAGG
CCAGCTGCCCTTGAAAAGATGATAGCTTTAGTTGCTCTTTTGGTTGAACAGTCTCGATCAGAAAGGCATTTGACATTATCACAGACTGAC
ATGGCAGCATTAACAGGAGGAAAGGGATTTCCCTTCTTGTTTCAACATATTCGTGATGGCATCAATATAAGACAAACTTGTAATCTGATT
TTCAGCCTGTGTCGATACAATAATCGACTTGCAGAACATATTGTATCTATGCTTTTCACATCAATAGCAAAGTTGACTCCTGAGGCAGCC
AATCCTTTCTTTAAGTTGTTGACTATGCTAATGGAGTTTGCTGGTGGACCTCCAGGAATGCCTCCCTTTGCATCTTATATTCTGCAGAGG
ATATGGGAGGTGATTGAATACAATCCTTCTCAGTGTCTAGATTGGTTGGCAGTGCAGACACCCCGAAATAAACTGGCACACAGCTGGGTC
TTACAGAATATGGAAAACTGGGTCGAGCGGTTTCTTTTGGCTCACAATTATCCTAGAGTGAGGACTTCTGCAGCTTATCTTCTGGTGTCC
CTTATACCAAGCAATTCATTCCGTCAGATGTTCCGGTCAACAAGGTCTTTGCACATCCCAACCCGTGACCTTCCACTCAGTCCAGACACA
ACAGTAGTCCTACATCAGGTCTACAACGTGCTCCTTGGTTTGCTCTCAAGAGCCAAACTTTATGTTGATGCTGCTGTTCATGGCACTACA
AAGCTAGTGCCCTATTTTAGCTTTATGACTTACTGTTTAATTTCCAAAACTGAGAAGCTGATGTTTTCCACATATTTCATGGATTTGTGG
AACCTTTTCCAGCCTAAACTTTCTGAGCCAGCAATAGCTACAAATCACAATAAACAGGCTTTGCTTTCATTTTGGTACAATGTCTGTGCT
GACTGTCCAGAGAATATCCGCCTTATTGTTCAGAACCCAGTGGTAACCAAGAACATTGCCTTCAATTACATCCTTGCTGACCATGATGAT
CAGGATGTGGTGCTTTTTAACCGTGGGATGCTGCCAGCGTACTATGGCATTCTGAGGCTCTGCTGTGAGCAGTCTCCTGCATTCACACGA
CAACTGGCTTCTCACCAGAACATCCAGTGGGCCTTTAAGAATCTTACACCACATGCCAGCCAATACCCTGGAGCAGTAGAAGAACTGTTT
AACCTGATGCAGCTGTTTATAGCTCAGAGGCCAGATATGAGAGAAGAAGAATTAGAAGATATTAAACAGTTCAAGAAAACAACCATAAGT
TGTTACTTACGTTGCTTAGATGGCCGCTCCTGCTGGACTACTTTAATAAGTGCCTTCAGAATACTATTAGAATCTGATGAAGACAGACTT
CTTGTTGTATTTAATCGAGGATTGATTCTAATGACAGAGTCTTTCAACACTTTGCACATGATGTATCACGAAGCTACAGCTTGCCATGTG
ACTGGAGATTTAGTAGAACTTCTGTCAATATTTCTTTCGGTTTTGAAGTCTACACGCCCTTATCTTCAGAGAAAAGATGTGAAACAAGCA
TTAATCCAGTGGCAGGAGCGAATTGAATTTGCCCATAAACTGTTAACTCTTCTTAATTCCTATAGTCCTCCAGAACTTAGAAATGCCTGT
ATAGATGTCCTCAAGGAACTTGTACTTTTGAGTCCCCATGATTTTCTTCATACTCTGGTTCCCTTTCTACAACACAACCATTGTACTTAC
CATCACAGTAATATACCAATGTCTCTTGGACCTTATTTCCCTTGTCGAGAAAATATCAAGCTAATAGGAGGGAAAAGCAATATTCGGCCT
CCGCGCCCTGAACTCAATATGTGCCTCTTGCCCACAATGGTGGAAACCAGTAAGGGCAAAGATGACGTTTATGATCGTATGCTGCTAGAC
TACTTCTTTTCTTATCATCAGTTCATCCATCTATTATGCCGAGTTGCAATCAACTGTGAAAAATTTACTGAAACATTAGTTAAGCTGAGT
GTCCTAGTTGCCTATGAAGGTTTGCCACTTCATCTTGCACTGTTCCCCAAACTTTGGACTGAGCTATGCCAGACTCAGTCTGCTATGTCA
AAAAACTGCATCAAGCTTTTGTGTGAAGATCCTGTTTTCGCAGAATATATTAAATGTATCCTAATGGATGAAAGAACTTTTTTAAACAAC
AACATTGTCTACACGTTCATGACACATTTCCTTCTAAAGGTTCAAAGTCAAGTGTTTTCTGAAGCAAACTGTGCCAATTTGATCAGCACT
CTTATTACAAACTTGATAAGCCAGTATCAGAACCTACAGTCTGATTTCTCCAACCGAGTTGAAATTTCCAAAGCAAGTGCTTCTTTAAAT
GGGGACCTGAGGGCACTCGCTTTGCTCCTGTCAGTACACACTCCCAAACAGTTAAACCCAGCTCTAATTCCAACTCTGCAAGAGCTTTTA
AGCAAATGCAGGACTTGTCTGCAACAGAGAAACTCACTCCAAGAGCAAGAAGCCAAAGAAAGAAAAACTAAAGATGATGAAGGAGCAACT
CCCATTAAAAGGCGGCGTGTTAGCAGTGATGAGGAGCACACTGTAGACAGCTGCATCAGTGACATGAAAACAGAAACCAGGGAGGTCCTG
ACCCCAACGAGCACTTCTGACAATGAGACCAGAGACTCCTCAATTATTGATCCAGGAACTGAGCAAGATCTTCCTTCCCCTGAAAATAGT
TCTGTTAAAGAATACCGAATGGAAGTTCCATCTTCGTTTTCAGAAGACATGTCAAATATCAGGTCACAGCATGCAGAAGAACAGTCCAAC
AATGGTAGATATGACGATTGTAAAGAATTTAAAGACCTCCACTGTTCCAAGGATTCTACCCTAGCTGAGGAAGAATCTGAGTTCCCTTCT
ACTTCTATCTCTGCAGTTCTGTCTGACTTAGCTGACTTGAGAAGCTGTGATGGCCAAGCTTTGCCCTCCCAGGACCCTGAGGTTGCTTTA
TCTCTCAGTTGTGGCCATTCCAGAGGACTCTTTAGTCATATGCAGCAACATGACATTTTAGATACCCTGTGTAGGACCATTGAATCTACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_UBAP2_ENST00000449054_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_6732nt
ATTGGCAGGTAACGAGCGGCGGCGGCGGCAGCGGGTCTTGGGTCCTCCGAGAGCAGCAGCGATTTTCTATTTTGTACATACATTATTTTG
TATATACTGTATATGATGACTTCAGTGAGCAGTGACCATTGTCGAGGTGCTCGGGAAAAACCACAGATTTCAGCAGCACAATCAACGCAA
CCACAGAAACAAGTGGTACAGGTATTTCTTGTTCTTGTCCAAGGAACCAGTTTGATTCAGCGACTTATGTCTGTTGCTTATACGTATGAT
AATCTGGCTCCTAGAGTTTTAAAAGCTCAGTCTGATCACAGGTCTAGACATGAAGTTTCACATTATTCAATGTGGCTCTTGGTGAGTTGG
GCTCATTGCTGTTCTTTAGTGAAATCTAGCCTTGCTGATAGCGATCATTTACAAGATTGGCTAAAGAAATTGACTCTCCTTATTCCTGAG
ACTGCAGTTCGTCATGAATCATGCAGTGGTCTCTATAAGTTATCCCTGTCAGGGCTGGATGGAGGAGACTCAATCAATCGTTCTTTTCTG
CTATTGGCTGCCTCAACATTATTGAAATTTCTTCCTGATGCTCAAGCACTCAAACCTATTAGGATAGATGATTATGAGGAAGAACCAATA
TTAAAACCAGGATGTAAAGAGTATTTTTGGTTGTTATGCAAATTAGTTGACAACATACATATAAAGGACGCTAGTCAGACAACGCTCCTC
GACTTAGATGCCTTGGCAAGACATTTGGCTGACTGTATTCGAAGTAGGGAGATCCTTGATCATCAGGATGGTAATGTAGAAGATGATGGG
CTTACAGGACTCCTAAGGCTTGCAACAAGTGTTGTTAAACACAAACCACCCTTTAAATTTTCAAGGGAAGGACAGGAATTTTTGAGAGAT
ATCTTCAATCTCCTGTTTTTGTTGCCAAGTCTAAAGGACCGACAACAGCCAAAGTGCAAATCACATTCTTCAAGAGCTGCCGCTTACGAT
TTGTTAGTAGAGATGGTAAAGGGGTCTGTTGAGAACTACAGGCTAATACACAACTGGGTTATGGCACAACACATGCAGTCCCATGCACCT
TATAAATGGGATTACTGGCCTCATGAAGATGTCCGTGCTGAATGTAGATTTGTTGGCCTTACTAACCTTGGAGCTACTTGTTACTTAGCT
TCTACTATTCAGCAACTTTATATGATACCTGAGGCAAGACAGGCTGTCTTCACTGCCAAGTATTCAGAGGATATGAAGCACAAGACCACT
CTTCTGGAGCTTCAGAAAATGTTTACATATTTAATGGAGAGTGAATGCAAAGCATATAATCCTAGACCTTTCTGTAAAACATACACCATG
GATAAGCAGCCTCTGAATACTGGGGAACAGAAAGATATGACAGAGTTTTTTACTGATCTAATTACCAAAATCGAAGAAATGTCTCCCGAA
CTGAAAAATACCGTCAAAAGTTTATTTGGAGGTGTAATTACAAACAATGTTGTATCCTTGGATTGTGAACATGTTAGTCAAACTGCTGAA
GAGTTTTATACTGTGAGGTGCCAAGTGGCTGATATGAAGAACATTTATGAATCTCTTGATGAAGTTACTATAAAAGACACTTTGGAAGGT
GATAACATGTATACTTGTTCTCATTGTGGGAAGAAAGTACGAGCTGAAAAAAGGGCATGTTTTAAGAAATTGCCTCGCATTTTGAGTTTC
AATACTATGAGATACACATTTAATATGGTCACGATGATGAAAGAGAAAGTGAATACACACTTTTCCTTCCCATTACGTTTGGACATGACG
CCCTATACAGAAGATTTTCTTATGGGAAAGAGTGAGAGGAAAGAAGGTTTTAAAGAAGTCAGTGATCATTCAAAAGACTCAGAGAGCTAT
GAATATGACTTGATAGGAGTGACTGTTCACACAGGAACGGCAGATGGTGGACACTATTATAGCTTTATCAGAGATATAGTAAATCCCCAT
GCTTATAAAAACAATAAATGGTATCTTTTTAATGATGCTGAGGTAAAACCTTTTGATTCTGCTCAACTTGCATCTGAATGTTTTGGTGGA
GAGATGACGACCAAGACCTATGATTCTGTTACAGATAAATTTATGGACTTCTCTTTTGAAAAGACACACAGTGCATATATGCTGTTTTAC
AAACGCATGGAACCAGAGGAAGAAAATGGCAGAGAATACAAATTTGATGTTTCGTCAGAGTTACTAGAGTGGATTTGGCATGATAACATG
CAGTTTCTTCAAGACAAAAACATTTTTGAACATACATATTTTGGATTTATGTGGCAATTGTGTAGTTGTATTCCCAGTACATTACCAGAT
CCTAAAGCTGTGTCCTTAATGACAGCAAAGTTAAGCACTTCCTTTGTCCTAGAGACATTTATTCATTCTAAAGAAAAGCCCACGATGCTT
CAGTGGATTGAACTGTTGACGAAACAGTTTAATAATAGTCAGGCAGCTTGTGAGTGGTTTTTAGATCGTATGGCTGATGACGACTGGTGG
CCAATGCAGATACTAATTAAGTGCCCTAATCAAATTGTGAGACAGATGTTTCAGCGTTTGTGTATCCATGTGATTCAGAGGCTGAGACCT
GTGCATGCTCATCTCTATTTGCAGCCAGGAATGGAAGATGGGTCAGATGATATGGATACCTCAGTAGAAGATATTGGTGGTCGTTCATGT
GTCACTCGCTTTGTGAGAACCCTGTTATTAATTATGGAACATGGTGTAAAACCTCACAGTAAACATCTTACAGAGTATTTTGCCTTCCTT
TACGAATTTGCAAAAATGGGTGAAGAAGAGAGCCAATTTTTGCTTTCATTGCAAGCTATATCTACAATGGTACATTTTTACATGGGAACA
AAAGGACCTGAAAATCCTCAAGTTGAAGTGTTATCAGAGGAAGAAGGGGAAGAAGAAGAGGAGGAAGAAGATATCCTCTCTCTGGCAGAA
GAAAAATACAGGCCAGCTGCCCTTGAAAAGATGATAGCTTTAGTTGCTCTTTTGGTTGAACAGTCTCGATCAGAAAGGCATTTGACATTA
TCACAGACTGACATGGCAGCATTAACAGGAGGAAAGGGATTTCCCTTCTTGTTTCAACATATTCGTGATGGCATCAATATAAGACAAACT
TGTAATCTGATTTTCAGCCTGTGTCGATACAATAATCGACTTGCAGAACATATTGTATCTATGCTTTTCACATCAATAGCAAAGTTGACT
CCTGAGGCAGCCAATCCTTTCTTTAAGTTGTTGACTATGCTAATGGAGTTTGCTGGTGGACCTCCAGGAATGCCTCCCTTTGCATCTTAT
ATTCTGCAGAGGATATGGGAGGTGATTGAATACAATCCTTCTCAGTGTCTAGATTGGTTGGCAGTGCAGACACCCCGAAATAAACTGGCA
CACAGCTGGGTCTTACAGAATATGGAAAACTGGGTCGAGCGGTTTCTTTTGGCTCACAATTATCCTAGAGTGAGGACTTCTGCAGCTTAT
CTTCTGGTGTCCCTTATACCAAGCAATTCATTCCGTCAGATGTTCCGGTCAACAAGGTCTTTGCACATCCCAACCCGTGACCTTCCACTC
AGTCCAGACACAACAGTAGTCCTACATCAGGTCTACAACGTGCTCCTTGGTTTGCTCTCAAGAGCCAAACTTTATGTTGATGCTGCTGTT
CATGGCACTACAAAGCTAGTGCCCTATTTTAGCTTTATGACTTACTGTTTAATTTCCAAAACTGAGAAGCTGATGTTTTCCACATATTTC
ATGGATTTGTGGAACCTTTTCCAGCCTAAACTTTCTGAGCCAGCAATAGCTACAAATCACAATAAACAGGCTTTGCTTTCATTTTGGTAC
AATGTCTGTGCTGACTGTCCAGAGAATATCCGCCTTATTGTTCAGAACCCAGTGGTAACCAAGAACATTGCCTTCAATTACATCCTTGCT
GACCATGATGATCAGGATGTGGTGCTTTTTAACCGTGGGATGCTGCCAGCGTACTATGGCATTCTGAGGCTCTGCTGTGAGCAGTCTCCT
GCATTCACACGACAACTGGCTTCTCACCAGAACATCCAGTGGGCCTTTAAGAATCTTACACCACATGCCAGCCAATACCCTGGAGCAGTA
GAAGAACTGTTTAACCTGATGCAGCTGTTTATAGCTCAGAGGCCAGATATGAGAGAAGAAGAATTAGAAGATATTAAACAGTTCAAGAAA
ACAACCATAAGTTGTTACTTACGTTGCTTAGATGGCCGCTCCTGCTGGACTACTTTAATAAGTGCCTTCAGAATACTATTAGAATCTGAT
GAAGACAGACTTCTTGTTGTATTTAATCGAGGATTGATTCTAATGACAGAGTCTTTCAACACTTTGCACATGATGTATCACGAAGCTACA
GCTTGCCATGTGACTGGAGATTTAGTAGAACTTCTGTCAATATTTCTTTCGGTTTTGAAGTCTACACGCCCTTATCTTCAGAGAAAAGAT
GTGAAACAAGCATTAATCCAGTGGCAGGAGCGAATTGAATTTGCCCATAAACTGTTAACTCTTCTTAATTCCTATAGTCCTCCAGAACTT
AGAAATGCCTGTATAGATGTCCTCAAGGAACTTGTACTTTTGAGTCCCCATGATTTTCTTCATACTCTGGTTCCCTTTCTACAACACAAC
CATTGTACTTACCATCACAGTAATATACCAATGTCTCTTGGACCTTATTTCCCTTGTCGAGAAAATATCAAGCTAATAGGAGGGAAAAGC
AATATTCGGCCTCCGCGCCCTGAACTCAATATGTGCCTCTTGCCCACAATGGTGGAAACCAGTAAGGGCAAAGATGACGTTTATGATCGT
ATGCTGCTAGACTACTTCTTTTCTTATCATCAGTTCATCCATCTATTATGCCGAGTTGCAATCAACTGTGAAAAATTTACTGAAACATTA
GTTAAGCTGAGTGTCCTAGTTGCCTATGAAGGTTTGCCACTTCATCTTGCACTGTTCCCCAAACTTTGGACTGAGCTATGCCAGACTCAG
TCTGCTATGTCAAAAAACTGCATCAAGCTTTTGTGTGAAGATCCTGTTTTCGCAGAATATATTAAATGTATCCTAATGGATGAAAGAACT
TTTTTAAACAACAACATTGTCTACACGTTCATGACACATTTCCTTCTAAAGGTTCAAAGTCAAGTGTTTTCTGAAGCAAACTGTGCCAAT
TTGATCAGCACTCTTATTACAAACTTGATAAGCCAGTATCAGAACCTACAGTCTGATTTCTCCAACCGAGTTGAAATTTCCAAAGCAAGT
GCTTCTTTAAATGGGGACCTGAGGGCACTCGCTTTGCTCCTGTCAGTACACACTCCCAAACAGTTAAACCCAGCTCTAATTCCAACTCTG
CAAGAGCTTTTAAGCAAATGCAGGACTTGTCTGCAACAGAGAAACTCACTCCAAGAGCAAGAAGCCAAAGAAAGAAAAACTAAAGATGAT
GAAGGAGCAACTCCCATTAAAAGGCGGCGTGTTAGCAGTGATGAGGAGCACACTGTAGACAGCTGCATCAGTGACATGAAAACAGAAACC
AGGGAGGTCCTGACCCCAACGAGCACTTCTGACAATGAGACCAGAGACTCCTCAATTATTGATCCAGGAACTGAGCAAGATCTTCCTTCC
CCTGAAAATAGTTCTGTTAAAGAATACCGAATGGAAGTTCCATCTTCGTTTTCAGAAGACATGTCAAATATCAGGTCACAGCATGCAGAA
GAACAGTCCAACAATGGTAGATATGACGATTGTAAAGAATTTAAAGACCTCCACTGTTCCAAGGATTCTACCCTAGCTGAGGAAGAATCT
GAGTTCCCTTCTACTTCTATCTCTGCAGTTCTGTCTGACTTAGCTGACTTGAGAAGCTGTGATGGCCAAGCTTTGCCCTCCCAGGACCCT
GAGGTTGCTTTATCTCTCAGTTGTGGCCATTCCAGAGGACTCTTTAGTCATATGCAGCAACATGACATTTTAGATACCCTGTGTAGGACC
ATTGAATCTACAATCCATGTCGTCACAAGGATATCTGGCAAAGGAAACCAAGCTGCTTCTTGACATTAGGTGTAGCATGTCTACTTTTAA
GTCCCTCACCCCCAACCCCCATGCTGTTTGTATAAGTTTTGCTTATTTGTTTTTGTGCTTCAGTTTGTCCAGTGCTCTCTGCTTGAATGG
CAAGATAGATTTATAGGCTTAATTCTTGGTCAGGCAGAACTCCAGATGAAAAAAACTTGCATCTTCAGTATACTTCCTAAAGGGCAATCA
GATAATGGATATGTTTTATGTAATTAAGAGTTCACTTTAGTGGCTTTCATTTAATATGGCTGTCTGGGAAGAACAGGGTTGCCTAGCCCT
GTACAATGTAATTTAAACTTACAGCATTTTTACTGTGTATGATATGGTGTCCTCTGTGCCAGTTTTGTACCTTATAGAGGCAGATTGCCT
CCGATCGCTGTGGTTCTTATTATCAAAATTAAGTTTACTTGTATACGGAACAACCACAAGAAATTTGATTCTGTAAAGAATCCTCTTTAG
CTGTGGCCTGGCAGTATATAAATGGTGCTTTATTTAACAGAATACCTGTGGAGGAAATAAAGCACACTTGATGTAAAAATAATTGTTTTA

>In-frame_UBAP2_ENST00000379238_chr9_34017048_-_USP34_ENST00000398571_chr2_61512092_-_6748nt
GCTTTGTAAGAGGCACATTGGCAGGTAACGAGCGGCGGCGGCGGCAGCGGGTCTTGGGTCCTCCGAGAGCAGCAGCGATTTTCTATTTTG
TACATACATTATTTTGTATATACTGTATATGATGACTTCAGTGAGCAGTGACCATTGTCGAGGTGCTCGGGAAAAACCACAGATTTCAGC
AGCACAATCAACGCAACCACAGAAACAAGTGGTACAGGTATTTCTTGTTCTTGTCCAAGGAACCAGTTTGATTCAGCGACTTATGTCTGT
TGCTTATACGTATGATAATCTGGCTCCTAGAGTTTTAAAAGCTCAGTCTGATCACAGGTCTAGACATGAAGTTTCACATTATTCAATGTG
GCTCTTGGTGAGTTGGGCTCATTGCTGTTCTTTAGTGAAATCTAGCCTTGCTGATAGCGATCATTTACAAGATTGGCTAAAGAAATTGAC
TCTCCTTATTCCTGAGACTGCAGTTCGTCATGAATCATGCAGTGGTCTCTATAAGTTATCCCTGTCAGGGCTGGATGGAGGAGACTCAAT
CAATCGTTCTTTTCTGCTATTGGCTGCCTCAACATTATTGAAATTTCTTCCTGATGCTCAAGCACTCAAACCTATTAGGATAGATGATTA
TGAGGAAGAACCAATATTAAAACCAGGATGTAAAGAGTATTTTTGGTTGTTATGCAAATTAGTTGACAACATACATATAAAGGACGCTAG
TCAGACAACGCTCCTCGACTTAGATGCCTTGGCAAGACATTTGGCTGACTGTATTCGAAGTAGGGAGATCCTTGATCATCAGGATGGTAA
TGTAGAAGATGATGGGCTTACAGGACTCCTAAGGCTTGCAACAAGTGTTGTTAAACACAAACCACCCTTTAAATTTTCAAGGGAAGGACA
GGAATTTTTGAGAGATATCTTCAATCTCCTGTTTTTGTTGCCAAGTCTAAAGGACCGACAACAGCCAAAGTGCAAATCACATTCTTCAAG
AGCTGCCGCTTACGATTTGTTAGTAGAGATGGTAAAGGGGTCTGTTGAGAACTACAGGCTAATACACAACTGGGTTATGGCACAACACAT
GCAGTCCCATGCACCTTATAAATGGGATTACTGGCCTCATGAAGATGTCCGTGCTGAATGTAGATTTGTTGGCCTTACTAACCTTGGAGC
TACTTGTTACTTAGCTTCTACTATTCAGCAACTTTATATGATACCTGAGGCAAGACAGGCTGTCTTCACTGCCAAGTATTCAGAGGATAT
GAAGCACAAGACCACTCTTCTGGAGCTTCAGAAAATGTTTACATATTTAATGGAGAGTGAATGCAAAGCATATAATCCTAGACCTTTCTG
TAAAACATACACCATGGATAAGCAGCCTCTGAATACTGGGGAACAGAAAGATATGACAGAGTTTTTTACTGATCTAATTACCAAAATCGA
AGAAATGTCTCCCGAACTGAAAAATACCGTCAAAAGTTTATTTGGAGGTGTAATTACAAACAATGTTGTATCCTTGGATTGTGAACATGT
TAGTCAAACTGCTGAAGAGTTTTATACTGTGAGGTGCCAAGTGGCTGATATGAAGAACATTTATGAATCTCTTGATGAAGTTACTATAAA
AGACACTTTGGAAGGTGATAACATGTATACTTGTTCTCATTGTGGGAAGAAAGTACGAGCTGAAAAAAGGGCATGTTTTAAGAAATTGCC
TCGCATTTTGAGTTTCAATACTATGAGATACACATTTAATATGGTCACGATGATGAAAGAGAAAGTGAATACACACTTTTCCTTCCCATT
ACGTTTGGACATGACGCCCTATACAGAAGATTTTCTTATGGGAAAGAGTGAGAGGAAAGAAGGTTTTAAAGAAGTCAGTGATCATTCAAA
AGACTCAGAGAGCTATGAATATGACTTGATAGGAGTGACTGTTCACACAGGAACGGCAGATGGTGGACACTATTATAGCTTTATCAGAGA
TATAGTAAATCCCCATGCTTATAAAAACAATAAATGGTATCTTTTTAATGATGCTGAGGTAAAACCTTTTGATTCTGCTCAACTTGCATC
TGAATGTTTTGGTGGAGAGATGACGACCAAGACCTATGATTCTGTTACAGATAAATTTATGGACTTCTCTTTTGAAAAGACACACAGTGC
ATATATGCTGTTTTACAAACGCATGGAACCAGAGGAAGAAAATGGCAGAGAATACAAATTTGATGTTTCGTCAGAGTTACTAGAGTGGAT
TTGGCATGATAACATGCAGTTTCTTCAAGACAAAAACATTTTTGAACATACATATTTTGGATTTATGTGGCAATTGTGTAGTTGTATTCC
CAGTACATTACCAGATCCTAAAGCTGTGTCCTTAATGACAGCAAAGTTAAGCACTTCCTTTGTCCTAGAGACATTTATTCATTCTAAAGA
AAAGCCCACGATGCTTCAGTGGATTGAACTGTTGACGAAACAGTTTAATAATAGTCAGGCAGCTTGTGAGTGGTTTTTAGATCGTATGGC
TGATGACGACTGGTGGCCAATGCAGATACTAATTAAGTGCCCTAATCAAATTGTGAGACAGATGTTTCAGCGTTTGTGTATCCATGTGAT
TCAGAGGCTGAGACCTGTGCATGCTCATCTCTATTTGCAGCCAGGAATGGAAGATGGGTCAGATGATATGGATACCTCAGTAGAAGATAT
TGGTGGTCGTTCATGTGTCACTCGCTTTGTGAGAACCCTGTTATTAATTATGGAACATGGTGTAAAACCTCACAGTAAACATCTTACAGA
GTATTTTGCCTTCCTTTACGAATTTGCAAAAATGGGTGAAGAAGAGAGCCAATTTTTGCTTTCATTGCAAGCTATATCTACAATGGTACA
TTTTTACATGGGAACAAAAGGACCTGAAAATCCTCAAGTTGAAGTGTTATCAGAGGAAGAAGGGGAAGAAGAAGAGGAGGAAGAAGATAT
CCTCTCTCTGGCAGAAGAAAAATACAGGCCAGCTGCCCTTGAAAAGATGATAGCTTTAGTTGCTCTTTTGGTTGAACAGTCTCGATCAGA
AAGGCATTTGACATTATCACAGACTGACATGGCAGCATTAACAGGAGGAAAGGGATTTCCCTTCTTGTTTCAACATATTCGTGATGGCAT
CAATATAAGACAAACTTGTAATCTGATTTTCAGCCTGTGTCGATACAATAATCGACTTGCAGAACATATTGTATCTATGCTTTTCACATC
AATAGCAAAGTTGACTCCTGAGGCAGCCAATCCTTTCTTTAAGTTGTTGACTATGCTAATGGAGTTTGCTGGTGGACCTCCAGGAATGCC
TCCCTTTGCATCTTATATTCTGCAGAGGATATGGGAGGTGATTGAATACAATCCTTCTCAGTGTCTAGATTGGTTGGCAGTGCAGACACC
CCGAAATAAACTGGCACACAGCTGGGTCTTACAGAATATGGAAAACTGGGTCGAGCGGTTTCTTTTGGCTCACAATTATCCTAGAGTGAG
GACTTCTGCAGCTTATCTTCTGGTGTCCCTTATACCAAGCAATTCATTCCGTCAGATGTTCCGGTCAACAAGGTCTTTGCACATCCCAAC
CCGTGACCTTCCACTCAGTCCAGACACAACAGTAGTCCTACATCAGGTCTACAACGTGCTCCTTGGTTTGCTCTCAAGAGCCAAACTTTA
TGTTGATGCTGCTGTTCATGGCACTACAAAGCTAGTGCCCTATTTTAGCTTTATGACTTACTGTTTAATTTCCAAAACTGAGAAGCTGAT
GTTTTCCACATATTTCATGGATTTGTGGAACCTTTTCCAGCCTAAACTTTCTGAGCCAGCAATAGCTACAAATCACAATAAACAGGCTTT
GCTTTCATTTTGGTACAATGTCTGTGCTGACTGTCCAGAGAATATCCGCCTTATTGTTCAGAACCCAGTGGTAACCAAGAACATTGCCTT
CAATTACATCCTTGCTGACCATGATGATCAGGATGTGGTGCTTTTTAACCGTGGGATGCTGCCAGCGTACTATGGCATTCTGAGGCTCTG
CTGTGAGCAGTCTCCTGCATTCACACGACAACTGGCTTCTCACCAGAACATCCAGTGGGCCTTTAAGAATCTTACACCACATGCCAGCCA
ATACCCTGGAGCAGTAGAAGAACTGTTTAACCTGATGCAGCTGTTTATAGCTCAGAGGCCAGATATGAGAGAAGAAGAATTAGAAGATAT
TAAACAGTTCAAGAAAACAACCATAAGTTGTTACTTACGTTGCTTAGATGGCCGCTCCTGCTGGACTACTTTAATAAGTGCCTTCAGAAT
ACTATTAGAATCTGATGAAGACAGACTTCTTGTTGTATTTAATCGAGGATTGATTCTAATGACAGAGTCTTTCAACACTTTGCACATGAT
GTATCACGAAGCTACAGCTTGCCATGTGACTGGAGATTTAGTAGAACTTCTGTCAATATTTCTTTCGGTTTTGAAGTCTACACGCCCTTA
TCTTCAGAGAAAAGATGTGAAACAAGCATTAATCCAGTGGCAGGAGCGAATTGAATTTGCCCATAAACTGTTAACTCTTCTTAATTCCTA
TAGTCCTCCAGAACTTAGAAATGCCTGTATAGATGTCCTCAAGGAACTTGTACTTTTGAGTCCCCATGATTTTCTTCATACTCTGGTTCC
CTTTCTACAACACAACCATTGTACTTACCATCACAGTAATATACCAATGTCTCTTGGACCTTATTTCCCTTGTCGAGAAAATATCAAGCT
AATAGGAGGGAAAAGCAATATTCGGCCTCCGCGCCCTGAACTCAATATGTGCCTCTTGCCCACAATGGTGGAAACCAGTAAGGGCAAAGA
TGACGTTTATGATCGTATGCTGCTAGACTACTTCTTTTCTTATCATCAGTTCATCCATCTATTATGCCGAGTTGCAATCAACTGTGAAAA
ATTTACTGAAACATTAGTTAAGCTGAGTGTCCTAGTTGCCTATGAAGGTTTGCCACTTCATCTTGCACTGTTCCCCAAACTTTGGACTGA
GCTATGCCAGACTCAGTCTGCTATGTCAAAAAACTGCATCAAGCTTTTGTGTGAAGATCCTGTTTTCGCAGAATATATTAAATGTATCCT
AATGGATGAAAGAACTTTTTTAAACAACAACATTGTCTACACGTTCATGACACATTTCCTTCTAAAGGTTCAAAGTCAAGTGTTTTCTGA
AGCAAACTGTGCCAATTTGATCAGCACTCTTATTACAAACTTGATAAGCCAGTATCAGAACCTACAGTCTGATTTCTCCAACCGAGTTGA
AATTTCCAAAGCAAGTGCTTCTTTAAATGGGGACCTGAGGGCACTCGCTTTGCTCCTGTCAGTACACACTCCCAAACAGTTAAACCCAGC
TCTAATTCCAACTCTGCAAGAGCTTTTAAGCAAATGCAGGACTTGTCTGCAACAGAGAAACTCACTCCAAGAGCAAGAAGCCAAAGAAAG
AAAAACTAAAGATGATGAAGGAGCAACTCCCATTAAAAGGCGGCGTGTTAGCAGTGATGAGGAGCACACTGTAGACAGCTGCATCAGTGA
CATGAAAACAGAAACCAGGGAGGTCCTGACCCCAACGAGCACTTCTGACAATGAGACCAGAGACTCCTCAATTATTGATCCAGGAACTGA
GCAAGATCTTCCTTCCCCTGAAAATAGTTCTGTTAAAGAATACCGAATGGAAGTTCCATCTTCGTTTTCAGAAGACATGTCAAATATCAG
GTCACAGCATGCAGAAGAACAGTCCAACAATGGTAGATATGACGATTGTAAAGAATTTAAAGACCTCCACTGTTCCAAGGATTCTACCCT
AGCTGAGGAAGAATCTGAGTTCCCTTCTACTTCTATCTCTGCAGTTCTGTCTGACTTAGCTGACTTGAGAAGCTGTGATGGCCAAGCTTT
GCCCTCCCAGGACCCTGAGGTTGCTTTATCTCTCAGTTGTGGCCATTCCAGAGGACTCTTTAGTCATATGCAGCAACATGACATTTTAGA
TACCCTGTGTAGGACCATTGAATCTACAATCCATGTCGTCACAAGGATATCTGGCAAAGGAAACCAAGCTGCTTCTTGACATTAGGTGTA
GCATGTCTACTTTTAAGTCCCTCACCCCCAACCCCCATGCTGTTTGTATAAGTTTTGCTTATTTGTTTTTGTGCTTCAGTTTGTCCAGTG
CTCTCTGCTTGAATGGCAAGATAGATTTATAGGCTTAATTCTTGGTCAGGCAGAACTCCAGATGAAAAAAACTTGCATCTTCAGTATACT
TCCTAAAGGGCAATCAGATAATGGATATGTTTTATGTAATTAAGAGTTCACTTTAGTGGCTTTCATTTAATATGGCTGTCTGGGAAGAAC
AGGGTTGCCTAGCCCTGTACAATGTAATTTAAACTTACAGCATTTTTACTGTGTATGATATGGTGTCCTCTGTGCCAGTTTTGTACCTTA
TAGAGGCAGATTGCCTCCGATCGCTGTGGTTCTTATTATCAAAATTAAGTTTACTTGTATACGGAACAACCACAAGAAATTTGATTCTGT
AAAGAATCCTCTTTAGCTGTGGCCTGGCAGTATATAAATGGTGCTTTATTTAACAGAATACCTGTGGAGGAAATAAAGCACACTTGATGT


Top

FusionGenePPI for UBAP2_USP34


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
UBAP2G3BP2, CUL3, UBAP2L, DLD, NUP50, VDAC1, TOMM40, PRDX5, ZFR, VPS29, THY1, S100A10, ZC3H14, ITCH, WWOX, FXR1, FUS, KLHL20, GLUL, QPCT, RBFOX2, CDKL5, NTRK1, CDH1, HSPBP1, HAO2, GORASP2, RAVER1, SCYL2, TRIM25, G3BP1, BRCA1USP34ATM, SIRT7, UBE2C, UFC1, UFM1, ZRANB2, UBE2V2, SRXN1, STAM, AHCYL1, UBE4B, UBQLN1, UBXN7, UBA2, UBE2L3, UBE2V1, TTLL12, UCHL3, UBQLN2, UBXN1, ZFYVE19, SULT1A1, UBE2D1, UBQLN4, ATP6V1B2, LAGE3, SSSCA1, UBL7, USP9X, SEC24A, UNK, VPS4B, SOX2, CD2AP, ELP2, KIAA1033, SNRNP200, CSNK1A1, ZNF707, EIF3M, PCGF1, DPPA4, NANOG, POU5F1, EGFR, EPHA1, ZNF214, ZNF785, ZNF764, SUV39H1, ZNF669, ERMAP, ZNF550, LYPD4, TSPYL6, ZNF354C, ZNF211, RBM3, MTNR1A, MTNR1B, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UBAP2_USP34


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UBAP2_USP34


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneUBAP2C0001973Alcoholic Intoxication, Chronic1PSYGENET