FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4030

FusionGeneSummary for BCL2L1_RHAG

check button Fusion gene summary
Fusion gene informationFusion gene name: BCL2L1_RHAG
Fusion gene ID: 4030
HgeneTgene
Gene symbol

BCL2L1

RHAG

Gene ID

598

6005

Gene nameBCL2 like 1Rh associated glycoprotein
SynonymsBCL-XL/S|BCL2L|BCLX|Bcl-X|PPP1R52CD241|OHS|OHST|RH2|RH50A|RHNR|Rh50|Rh50GP|SLC42A1
Cytomap

20q11.21

6p12.3

Type of geneprotein-codingprotein-coding
Descriptionbcl-2-like protein 1apoptosis regulator Bcl-Xprotein phosphatase 1, regulatory subunit 52ammonium transporter Rh type ARh 50 glycoproteinRhesus associated polypeptide, 50-KDRhesus blood group-associated glycoproteinerythrocyte membrane glycoprotein Rh50erythrocyte plasma membrane 50 kDa glycoproteinrh family type A glycoproteinrh type
Modification date2018052720180523
UniProtAcc

Q07817

Q02094

Ensembl transtripts involved in fusion geneENST00000376062, ENST00000376055, 
ENST00000307677, ENST00000420653, 
ENST00000371175, ENST00000229810, 
Fusion gene scores* DoF score7 X 6 X 4=1683 X 2 X 3=18
# samples 83
** MAII scorelog2(8/168*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BCL2L1 [Title/Abstract] AND RHAG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCL2L1

GO:0001836

release of cytochrome c from mitochondria

9843949

HgeneBCL2L1

GO:0019050

suppression by virus of host apoptotic process

15231831

HgeneBCL2L1

GO:0034097

response to cytokine

9184696

HgeneBCL2L1

GO:0043066

negative regulation of apoptotic process

7650367|9388232

HgeneBCL2L1

GO:0046902

regulation of mitochondrial membrane permeability

9843949

HgeneBCL2L1

GO:0051881

regulation of mitochondrial membrane potential

9843949

HgeneBCL2L1

GO:1900118

negative regulation of execution phase of apoptosis

20673843

HgeneBCL2L1

GO:1902042

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

26582200

HgeneBCL2L1

GO:1902230

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

16608847

HgeneBCL2L1

GO:1903077

negative regulation of protein localization to plasma membrane

21041309

HgeneBCL2L1

GO:2001243

negative regulation of intrinsic apoptotic signaling pathway

12011449

TgeneRHAG

GO:0006873

cellular ion homeostasis

15856280

TgeneRHAG

GO:0015670

carbon dioxide transport

16574458|17712059|19273840

TgeneRHAG

GO:0015672

monovalent inorganic cation transport

18931342

TgeneRHAG

GO:0015696

ammonium transport

15856280|15929723|16574458|16866382|17712059|19273840


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-13-0924-01ABCL2L1chr20

30309458

-RHAGchr6

49583484

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376062ENST00000371175BCL2L1chr20

30309458

-RHAGchr6

49583484

-
In-frameENST00000376062ENST00000229810BCL2L1chr20

30309458

-RHAGchr6

49583484

-
intron-3CDSENST00000376055ENST00000371175BCL2L1chr20

30309458

-RHAGchr6

49583484

-
intron-3CDSENST00000376055ENST00000229810BCL2L1chr20

30309458

-RHAGchr6

49583484

-
Frame-shitENST00000307677ENST00000371175BCL2L1chr20

30309458

-RHAGchr6

49583484

-
Frame-shitENST00000307677ENST00000229810BCL2L1chr20

30309458

-RHAGchr6

49583484

-
Frame-shitENST00000420653ENST00000371175BCL2L1chr20

30309458

-RHAGchr6

49583484

-
Frame-shitENST00000420653ENST00000229810BCL2L1chr20

30309458

-RHAGchr6

49583484

-

Top

FusionProtFeatures for BCL2L1_RHAG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCL2L1

Q07817

RHAG

Q02094

Potent inhibitor of cell death. Inhibits activation ofcaspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing therelease of the caspase activator, CYC1, from the mitochondrialmembrane. Also acts as a regulator of G2 checkpoint andprogression to cytokinesis during mitosis. Isoform Bcl-X(L) also regulates presynaptic plasticity,including neurotransmitter release and recovery, number of axonalmitochondria as well as size and number of synaptic vesicleclusters. During synaptic stimulation, increases ATP availabilityfrom mitochondria through regulation of mitochondrial membrane ATPsynthase F(1)F(0) activity and regulates endocytic vesicleretrieval in hippocampal neurons through association with DMN1Land stimulation of its GTPase activity in synaptic vesicles. Mayattenuate inflammation impairing NLRP1-inflammasome activation,hence CASP1 activation and IL1B release (PubMed:17418785).{ECO:0000269|PubMed:17418785}. Isoform Bcl-X(S) promotes apoptosis. Associated with rhesus blood group antigen expression(PubMed:19744193). May be part of an oligomeric complex which islikely to have a transport or channel function in the erythrocytemembrane (PubMed:11062476, PubMed:11861637). Involved in ammoniatransport across the erythrocyte membrane (PubMed:21849667,PubMed:22012326). Seems to act in monovalent cation transport(PubMed:18931342, PubMed:21849667). {ECO:0000269|PubMed:11062476,ECO:0000269|PubMed:11861637, ECO:0000269|PubMed:18931342,ECO:0000269|PubMed:19744193, ECO:0000269|PubMed:21849667,ECO:0000269|PubMed:22012326}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000307677-23129_148188234MotifNote=BH1
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000307677-234_24188234MotifNote=BH4
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000307677-2386_100188234MotifNote=BH3
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376062-12129_148188234MotifNote=BH1
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376062-124_24188234MotifNote=BH4
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376062-1286_100188234MotifNote=BH3
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000420653-23129_148188234MotifNote=BH1
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000420653-234_24188234MotifNote=BH4
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000420653-2386_100188234MotifNote=BH3
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29164_167164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29189_208164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29230_239164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29261_268164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29292_295164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29319_332164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29354_362164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29384_409164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210164_167164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210189_208164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210230_239164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210261_268164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210292_295164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210319_332164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210354_362164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210384_409164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29168_188164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29209_229164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29240_260164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29269_291164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29296_318164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29333_353164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29363_383164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210168_188164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210209_229164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210240_260164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210269_291164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210296_318164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210333_353164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210363_383164410TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000307677-23180_195188234MotifNote=BH2
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376055-13129_148-125171MotifNote=BH1
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376055-13180_195-125171MotifNote=BH2
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376055-134_24-125171MotifNote=BH4
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376055-1386_100-125171MotifNote=BH3
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376062-12180_195188234MotifNote=BH2
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000420653-23180_195188234MotifNote=BH2
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000307677-23210_226188234TransmembraneHelical
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376055-13210_226-125171TransmembraneHelical
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000376062-12210_226188234TransmembraneHelical
HgeneBCL2L1chr20:30309458chr6:49583484ENST00000420653-23210_226188234TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29101_113164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29135_142164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-291_2164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-2924_51164290Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-2973_79164290Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210101_113164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210135_142164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-2101_2164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-21024_51164410Topological domainExtracellular
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-21073_79164410Topological domainCytoplasmic
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29114_134164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-29143_163164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-293_23164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-2952_72164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000229810-2980_100164290TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210114_134164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-210143_163164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-2103_23164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-21052_72164410TransmembraneHelical
TgeneRHAGchr20:30309458chr6:49583484ENST00000371175-21080_100164410TransmembraneHelical


Top

FusionGeneSequence for BCL2L1_RHAG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000371175_chr6_49583484_-_434aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQAL
REAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFS
LAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGL

>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000229810_chr6_49583484_-_376aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQAL
REAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFS
LAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTVYGHAGSCTGFLYRNSSCWRS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000371175_chr6_49583484_-_1302nt
ATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTTTAGTGATGTG
GAAGAGAACAGGACTGAGGCCCCAGAAGGGACTGAATCGGAGATGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCA
GACAGCCCCGCGGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCCCGGGAGGTGATCCCCATGGCAGCAGTAAAGCAAGCGCTG
AGGGAGGCAGGCGACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACATCACCCCAGGGACAGCATAT
CAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGGGTAAACTGGGGTCGCATTGTGGCCTTTTTCTCCTTCGGCGGGGCACTG
TGCGTGGAAAGCGTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATCGCAGCTTGGATGGCCACTTACCTGAATGACCACCTAGAGCCT
TGGATCCAGGAGAACGGCGGCTGGGCCTCTGACATTGGAGCATCAATGACGATCCATGCCTTTGGGGCCTACTTTGGCTTGGCTGTAGCA
GGCATCTTGTATCGATCTGGACTGAGAAAGGGGCATGAAAATGAAGAGTCCGCATACTACTCAGACTTGTTTGCAATGATTGGGACTCTC
TTTCTGTGGATGTTTTGGCCCAGCTTTAACTCGGCCATTGCTGAACCTGGAGACAAACAGTGCAGGGCCATTGTAAACACGTACTTCTCT
CTCGCTGCCTGTGTGCTCACAGCCTTTGCCTTCTCCAGCCTAGTGGAGCACCGAGGCAAGCTCAACATGGTTCACATTCAGAATGCCACC
CTTGCTGGAGGAGTTGCTGTGGGCACTTGTGCGGATATGGCAATTCACCCATTTGGTTCTATGATTATTGGGAGCATTGCAGGAATGGTC
TCTGTGCTTGGATACAAGTTCCTGACTCCACTTTTTACTACTAAACTGAGGATCCATGATACATGTGGGGTCCATAACCTCCACGGCTTA
CCTGGTGTAGTGGGAGGCCTTGCAGGCATTGTGGCAGTAGCAATGGGCGCCTCCAACACGTCTATGGCCATGCAGGCAGCTGCACTGGGT
TCCTCTATCGGAACAGCAGTTGTTGGAGGTCTGATGACAGGTTTAATTCTAAAGTTGCCTCTCTGGGGACAGCCATCTGACCAGAACTGC

>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000229810_chr6_49583484_-_1128nt
ATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTTTAGTGATGTG
GAAGAGAACAGGACTGAGGCCCCAGAAGGGACTGAATCGGAGATGGAGACCCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCA
GACAGCCCCGCGGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCCCGGGAGGTGATCCCCATGGCAGCAGTAAAGCAAGCGCTG
AGGGAGGCAGGCGACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACATCACCCCAGGGACAGCATAT
CAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGGGTAAACTGGGGTCGCATTGTGGCCTTTTTCTCCTTCGGCGGGGCACTG
TGCGTGGAAAGCGTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATCGCAGCTTGGATGGCCACTTACCTGAATGACCACCTAGAGCCT
TGGATCCAGGAGAACGGCGGCTGGGCCTCTGACATTGGAGCATCAATGACGATCCATGCCTTTGGGGCCTACTTTGGCTTGGCTGTAGCA
GGCATCTTGTATCGATCTGGACTGAGAAAGGGGCATGAAAATGAAGAGTCCGCATACTACTCAGACTTGTTTGCAATGATTGGGACTCTC
TTTCTGTGGATGTTTTGGCCCAGCTTTAACTCGGCCATTGCTGAACCTGGAGACAAACAGTGCAGGGCCATTGTAAACACGTACTTCTCT
CTCGCTGCCTGTGTGCTCACAGCCTTTGCCTTCTCCAGCCTAGTGGAGCACCGAGGCAAGCTCAACATGGTTCACATTCAGAATGCCACC
CTTGCTGGAGGAGTTGCTGTGGGCACTTGTGCGGATATGGCAATTCACCCATTTGGTTCTATGATTATTGGGAGCATTGCAGGAATGGTC
TCTGTGCTTGGATACAAGTTCCTGACTGTCTATGGCCATGCAGGCAGCTGCACTGGGTTCCTCTATCGGAACAGCAGTTGTTGGAGGTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000371175_chr6_49583484_-_2336nt
GGAGTGGGGCGGGGGGGACTGCCCAGGGAGTGACTTTCCGAGGAAGGCATTTCGGAGAAGACGGGGGTAGAAAAGGCTGGTGGGAGATTC
AGAGTCCACTGGTGCTTTCGATTTGACTTAAGTGAAGTATCTTGGAACCTAGACCCAGACCTTCGTAAGACCCACAAAGAAACCAGTTCT
GGTACCTGGAGGGGGAATGGAATTTTTAGGGTAAATGGCATGCATATTAATTATTTTTTTTTCCTGAAGCTCTTTCTCTCCCTTCAGAAT
CTTATCTTGGCTTTGGATCTTAGAAGAGAATCACTAACCAGAGACGAGACTCAGTGAGTGAGCAGGTGTTTTGGACAATGGACTGGTTGA
GCCCATCCCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTG
GAGTCAGTTTAGTGATGTGGAAGAGAACAGGACTGAGGCCCCAGAAGGGACTGAATCGGAGATGGAGACCCCCAGTGCCATCAATGGCAA
CCCATCCTGGCACCTGGCAGACAGCCCCGCGGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCCCGGGAGGTGATCCCCATGGC
AGCAGTAAAGCAAGCGCTGAGGGAGGCAGGCGACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACAT
CACCCCAGGGACAGCATATCAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGGGTAAACTGGGGTCGCATTGTGGCCTTTTT
CTCCTTCGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATCGCAGCTTGGATGGCCACTTACCT
GAATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGGGCCTCTGACATTGGAGCATCAATGACGATCCATGCCTTTGGGGCCTA
CTTTGGCTTGGCTGTAGCAGGCATCTTGTATCGATCTGGACTGAGAAAGGGGCATGAAAATGAAGAGTCCGCATACTACTCAGACTTGTT
TGCAATGATTGGGACTCTCTTTCTGTGGATGTTTTGGCCCAGCTTTAACTCGGCCATTGCTGAACCTGGAGACAAACAGTGCAGGGCCAT
TGTAAACACGTACTTCTCTCTCGCTGCCTGTGTGCTCACAGCCTTTGCCTTCTCCAGCCTAGTGGAGCACCGAGGCAAGCTCAACATGGT
TCACATTCAGAATGCCACCCTTGCTGGAGGAGTTGCTGTGGGCACTTGTGCGGATATGGCAATTCACCCATTTGGTTCTATGATTATTGG
GAGCATTGCAGGAATGGTCTCTGTGCTTGGATACAAGTTCCTGACTCCACTTTTTACTACTAAACTGAGGATCCATGATACATGTGGGGT
CCATAACCTCCACGGCTTACCTGGTGTAGTGGGAGGCCTTGCAGGCATTGTGGCAGTAGCAATGGGCGCCTCCAACACGTCTATGGCCAT
GCAGGCAGCTGCACTGGGTTCCTCTATCGGAACAGCAGTTGTTGGAGGTCTGATGACAGGTTTAATTCTAAAGTTGCCTCTCTGGGGACA
GCCATCTGACCAGAACTGCTATGATGATTCTGTTTATTGGAAGGTCCCTAAGACGAGATAACTTGACAATCAGTTCCATGGACATGGTGA
CCACAGCCAGCTGGAACCTGAAGTCTAAACACCATTCCTGCTCTCCAGCTTCCTTTCCCATTATCCAGAATCAAGTCCAAATAAACAAAA
AGGGAGTAACCAAAGAGAGTATGGACCAGAGTGAATAGATCCTAAGTCCCAAATGGCCAGTGTAAAAATGTCCTTATGTCTGATGCTGTC
TCTTGCTCTTCAATGATTAATTGAGGGGATGTTACTCATAAAACAGATAATCAAATAGATCTTCTCCAGGATTCCCAAAAAGCTTTTGGC
AGTGAGTAAATACAGAGTAAACATGTCAGTTTCTTAATGTAGACACTATGTCTTCAATCCCAAAAATTATAAAACTGAAACCCATGAAGC
AAGAATAGATGTGAGAAATCTATGTAAAAAAATAATTAAAGAAATGCATGTGTGTAAAGTAGTAATATGATGATTTTAGGTAGTGCTTTT
TATTTTAAAAATAGTCTAGTTAGTAATGTTGTATCCTTGCATGAATATTATTCTTAATTCCTTTTGCATGTTGACTATTTGCAACGAGCT

>In-frame_BCL2L1_ENST00000376062_chr20_30309458_-_RHAG_ENST00000229810_chr6_49583484_-_1649nt
GGAGTGGGGCGGGGGGGACTGCCCAGGGAGTGACTTTCCGAGGAAGGCATTTCGGAGAAGACGGGGGTAGAAAAGGCTGGTGGGAGATTC
AGAGTCCACTGGTGCTTTCGATTTGACTTAAGTGAAGTATCTTGGAACCTAGACCCAGACCTTCGTAAGACCCACAAAGAAACCAGTTCT
GGTACCTGGAGGGGGAATGGAATTTTTAGGGTAAATGGCATGCATATTAATTATTTTTTTTTCCTGAAGCTCTTTCTCTCCCTTCAGAAT
CTTATCTTGGCTTTGGATCTTAGAAGAGAATCACTAACCAGAGACGAGACTCAGTGAGTGAGCAGGTGTTTTGGACAATGGACTGGTTGA
GCCCATCCCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCCTACAAGCTTTCCCAGAAAGGATACAGCTG
GAGTCAGTTTAGTGATGTGGAAGAGAACAGGACTGAGGCCCCAGAAGGGACTGAATCGGAGATGGAGACCCCCAGTGCCATCAATGGCAA
CCCATCCTGGCACCTGGCAGACAGCCCCGCGGTGAATGGAGCCACTGGCCACAGCAGCAGTTTGGATGCCCGGGAGGTGATCCCCATGGC
AGCAGTAAAGCAAGCGCTGAGGGAGGCAGGCGACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACAT
CACCCCAGGGACAGCATATCAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGGGTAAACTGGGGTCGCATTGTGGCCTTTTT
CTCCTTCGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATCGCAGCTTGGATGGCCACTTACCT
GAATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGGGCCTCTGACATTGGAGCATCAATGACGATCCATGCCTTTGGGGCCTA
CTTTGGCTTGGCTGTAGCAGGCATCTTGTATCGATCTGGACTGAGAAAGGGGCATGAAAATGAAGAGTCCGCATACTACTCAGACTTGTT
TGCAATGATTGGGACTCTCTTTCTGTGGATGTTTTGGCCCAGCTTTAACTCGGCCATTGCTGAACCTGGAGACAAACAGTGCAGGGCCAT
TGTAAACACGTACTTCTCTCTCGCTGCCTGTGTGCTCACAGCCTTTGCCTTCTCCAGCCTAGTGGAGCACCGAGGCAAGCTCAACATGGT
TCACATTCAGAATGCCACCCTTGCTGGAGGAGTTGCTGTGGGCACTTGTGCGGATATGGCAATTCACCCATTTGGTTCTATGATTATTGG
GAGCATTGCAGGAATGGTCTCTGTGCTTGGATACAAGTTCCTGACTGTCTATGGCCATGCAGGCAGCTGCACTGGGTTCCTCTATCGGAA
CAGCAGTTGTTGGAGGTCTGATGACAGGTTTAATTCTAAAGTTGCCTCTCTGGGGACAGCCATCTGACCAGAACTGCTATGATGATTCTG
TTTATTGGAAGGTCCCTAAGACGAGATAACTTGACAATCAGTTCCATGGACATGGTGACCACAGCCAGCTGGAACCTGAAGTCTAAACAC


Top

FusionGenePPI for BCL2L1_RHAG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCL2L1AVEN, BNIP3, RTN1, RTN4, BIK, BAK1, RAD9A, BID, PMAIP1, BCL2L11, BBC3, BAD, BAX, BCL2, HRK, VDAC1, BNIPL, SPNS1, BCL2L14, PPP1CA, CYCS, RAF1, BECN1, BLK, BCAP31, IRS1, CASP9, APAF1, MOAP1, MCL1, IKZF3, CFLAR, PSEN2, PSEN1, CASP2, CASP8, FKBP8, DYNLL1, BNIP1, PGAM5, BLID, UHRF2, PARK7, ZFYVE1, TP53, METTL23, PPHLN1, ZNF219, EDRF1, PDIA4, GLOD4, RBM5, PLD3, DOCK7, ZHX1, UBR1, FBP1, TLE1, ACTB, TP53BP2, LARP1, PTN, PPP1CC, BFAR, CLU, BMF, CRYAA, CRYAB, ATXN3, AKT1, PARK2, PINK1, TPT1, CDKN2A, CASP1, CASP8AP2, BCL2L1, MTOR, GIMAP5, ABL1, ATG5, PDS5A, HNRNPA1, BNIP3L, CREB3, MAPK8, USP14, MTNR1B, PLK1, MAPK9, GSK3A, GSK3B, MAPKAPK2, MAPK14, CDK1, CHEK1, AURKA, PLK3RHAGANK1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCL2L1_RHAG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCL2L1_RHAG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBCL2L1C2239176Liver carcinoma2CTD_human
HgeneBCL2L1C0001430Adenoma1CTD_human
HgeneBCL2L1C0010417Cryptorchidism1CTD_human
HgeneBCL2L1C0011853Diabetes Mellitus, Experimental1CTD_human
HgeneBCL2L1C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneBCL2L1C0018671Head and Neck Neoplasms1CTD_human
HgeneBCL2L1C0023895Liver diseases1CTD_human
HgeneBCL2L1C0023904Liver Neoplasms, Experimental1CTD_human
HgeneBCL2L1C0024121Lung Neoplasms1CTD_human
HgeneBCL2L1C0026764Multiple Myeloma1CTD_human
HgeneBCL2L1C0027051Myocardial Infarction1CTD_human
HgeneBCL2L1C0030297Pancreatic Neoplasm1CTD_human
HgeneBCL2L1C0038356Stomach Neoplasms1CTD_human
HgeneBCL2L1C0235032Neurotoxicity Syndromes1CTD_human
HgeneBCL2L1C0242350Erectile dysfunction1CTD_human
HgeneBCL2L1C1384666hearing impairment1CTD_human
HgeneBCL2L1C1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human
HgeneBCL2L1C2937358Cerebral Hemorrhage1CTD_human
TgeneRHAGC1849387Rh-Null, Regulator Type4CTD_human;UNIPROT
TgeneRHAGC1861455STOMATOCYTOSIS I3ORPHANET;UNIPROT