FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40260

FusionGeneSummary for TYW1_TRA2A

check button Fusion gene summary
Fusion gene informationFusion gene name: TYW1_TRA2A
Fusion gene ID: 40260
HgeneTgene
Gene symbol

TYW1

TRA2A

Gene ID

55253

29896

Gene nametRNA-yW synthesizing protein 1 homologtransformer 2 alpha homolog
SynonymsRSAFD1|TYW1A|YPL207WAWMS1|HSU53209
Cytomap

7q11.21

7p15.3

Type of geneprotein-codingprotein-coding
DescriptionS-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthaseradical S-adenosyl methionine and flavodoxin domain-containing protein 1radical S-adenosyl methionine and flavodoxin domains 1tRNA wybutosine-synthesizing protein 1 homologtRNA-yW synthetransformer-2 protein homolog alphaTRA-2 alphaTRA2-alphaTra2alphahtra-2 alphaputative MAPK activating protein PM24transformer-2 alphatransformer-2 protein homolog A
Modification date2018051920180523
UniProtAcc

Q9NV66

Q13595

Ensembl transtripts involved in fusion geneENST00000359626, ENST00000491969, 
ENST00000297071, ENST00000392502, 
ENST00000538367, ENST00000474586, 
Fusion gene scores* DoF score7 X 5 X 6=2105 X 6 X 5=150
# samples 77
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/150*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TYW1 [Title/Abstract] AND TRA2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTRA2A

GO:0000398

mRNA splicing, via spliceosome

9546399


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4443-01ATYW1chr7

66582605

+TRA2Achr7

23552701

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359626ENST00000297071TYW1chr7

66582605

+TRA2Achr7

23552701

-
In-frameENST00000359626ENST00000392502TYW1chr7

66582605

+TRA2Achr7

23552701

-
In-frameENST00000359626ENST00000538367TYW1chr7

66582605

+TRA2Achr7

23552701

-
5CDS-5UTRENST00000359626ENST00000474586TYW1chr7

66582605

+TRA2Achr7

23552701

-
intron-3CDSENST00000491969ENST00000297071TYW1chr7

66582605

+TRA2Achr7

23552701

-
intron-3CDSENST00000491969ENST00000392502TYW1chr7

66582605

+TRA2Achr7

23552701

-
intron-3CDSENST00000491969ENST00000538367TYW1chr7

66582605

+TRA2Achr7

23552701

-
intron-5UTRENST00000491969ENST00000474586TYW1chr7

66582605

+TRA2Achr7

23552701

-

Top

FusionProtFeatures for TYW1_TRA2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TYW1

Q9NV66

TRA2A

Q13595

Probable component of the wybutosine biosynthesispathway. Wybutosine is a hyper modified guanosine with a tricyclicbase found at the 3'-position adjacent to the anticodon ofeukaryotic phenylalanine tRNA. Catalyzes the condensation of N-methylguanine with 2 carbon atoms from pyruvate to form thetricyclic 4-demethylwyosine, an intermediate in wybutosinebiosynthesis (By similarity). {ECO:0000250}. Sequence-specific RNA-binding protein which participatesin the control of pre-mRNA splicing. {ECO:0000269|PubMed:9546399}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTYW1chr7:66582605chr7:23552701ENST00000359626+131679_237566733DomainFlavodoxin-like
HgeneTYW1chr7:66582605chr7:23552701ENST00000359626+1316176_208566733Nucleotide bindingFMN
HgeneTYW1chr7:66582605chr7:23552701ENST00000359626+131685_89566733Nucleotide bindingFMN
TgeneTRA2Achr7:66582605chr7:23552701ENST00000297071-28226_282112283Compositional biasNote=Arg/Ser-rich (RS2 domain)
TgeneTRA2Achr7:66582605chr7:23552701ENST00000297071-28119_197112283DomainRRM
TgeneTRA2Achr7:66582605chr7:23552701ENST00000297071-28198_225112283RegionNote=Linker

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTRA2Achr7:66582605chr7:23552701ENST00000297071-2830_112112283Compositional biasNote=Arg/Ser-rich (RS1 domain)


Top

FusionGeneSequence for TYW1_TRA2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000297071_chr7_23552701_-_737aa
MDPSADTWDLFSPLISLWINRFYITLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQDLMTNGTVSLQEKDIFVSGVKIFTGSQTGTA
KGFATVLAEAVTSLDLPVAIINLKETDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRTAVFGLG
NSATASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEE
REEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPAL
REALTKQGTQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFTGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAI
ENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLTVSVDASTKDS
LKKIDRPLFKDFWQRFLDSLKALAVKANPDPNTCLGVFGLSLYTTERDLREVFSRTGPLSGVNVVTDQRTGRSRGFAFVTFERIDDSKEA
MERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRRSPSPTTS

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000392502_chr7_23552701_-_736aa
MDPSADTWDLFSPLISLWINRFYITLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQDLMTNGTVSLQEKDIFVSGVKIFTGSQTGTA
KGFATVLAEAVTSLDLPVAIINLKETDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRTAVFGLG
NSATASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEE
REEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPAL
REALTKQGTQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFTGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAI
ENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLTVSVDASTKDS
LKKIDRPLFKDFWQRFLDSLKALAVKANPDPNTCLGVFGLSLYTTERDLREVFSRTGPLSGVNVVTDQRTGRSRGFAFVTFERIDDSKEA
MERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRSPSPTTSR

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000538367_chr7_23552701_-_737aa
MDPSADTWDLFSPLISLWINRFYITLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQDLMTNGTVSLQEKDIFVSGVKIFTGSQTGTA
KGFATVLAEAVTSLDLPVAIINLKETDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRTAVFGLG
NSATASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEE
REEGSHEQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPAL
REALTKQGTQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFTGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAI
ENHQNMIKQFKGVPGVKAERFEEGMTVKHCALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLTVSVDASTKDS
LKKIDRPLFKDFWQRFLDSLKALAVKANPDPNTCLGVFGLSLYTTERDLREVFSRTGPLSGVNVVTDQRTGRSRGFAFVTFERIDDSKEA
MERANGMELDGRRIRVDTSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYTDRGTDRGTDRTEDTDYRYRRRSPSPTTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000297071_chr7_23552701_-_2211nt
ATGGATCCTTCTGCGGATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTT
AGCATTAGCCTTTGGATTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGAT
TTGATGACAAATGGTTATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCG
AAGGGATTCGCAACAGTTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGAT
CATCTGATAGAAGAGGTGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGG
TTCTGCAAATGGTTAGAGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGA
AATTCTGCCTATGCTAGCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGA
GGGGAGGGCGACTGCGACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTG
CAGGCACTTCAGAAAGGGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAG
AGGGAGGAAGGATCTCATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTT
GGTGGTGAGGACCATCAGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAA
AAGGAACAGCAGGAAGAGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTC
CGAGAAGCCCTTACTAAACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGG
AGAGGAGGTTGTTACAAACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGT
GTCTTCTGTTGGCGGCACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATT
GAAAACCATCAGAACATGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGT
GCATTGTCCCTCGTGGGAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTG
GTCACAAACGCACAATTTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGC
CTGAAGAAAATCGACCGCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGAT
CCCAACACTTGCCTTGGAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGT
GGTGTCAATGTGGTTTATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCT
ATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGC
ATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCT
TACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGT

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000392502_chr7_23552701_-_2208nt
ATGGATCCTTCTGCGGATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTT
AGCATTAGCCTTTGGATTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGAT
TTGATGACAAATGGTTATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCG
AAGGGATTCGCAACAGTTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGAT
CATCTGATAGAAGAGGTGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGG
TTCTGCAAATGGTTAGAGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGA
AATTCTGCCTATGCTAGCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGA
GGGGAGGGCGACTGCGACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTG
CAGGCACTTCAGAAAGGGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAG
AGGGAGGAAGGATCTCATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTT
GGTGGTGAGGACCATCAGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAA
AAGGAACAGCAGGAAGAGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTC
CGAGAAGCCCTTACTAAACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGG
AGAGGAGGTTGTTACAAACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGT
GTCTTCTGTTGGCGGCACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATT
GAAAACCATCAGAACATGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGT
GCATTGTCCCTCGTGGGAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTG
GTCACAAACGCACAATTTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGC
CTGAAGAAAATCGACCGCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGAT
CCCAACACTTGCCTTGGAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGT
GGTGTCAATGTGGTTTATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCT
ATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGC
ATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCT
TACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGA

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000538367_chr7_23552701_-_2211nt
ATGGATCCTTCTGCGGATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTT
AGCATTAGCCTTTGGATTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGAT
TTGATGACAAATGGTTATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCG
AAGGGATTCGCAACAGTTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGAT
CATCTGATAGAAGAGGTGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGG
TTCTGCAAATGGTTAGAGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGA
AATTCTGCCTATGCTAGCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGA
GGGGAGGGCGACTGCGACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTG
CAGGCACTTCAGAAAGGGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAG
AGGGAGGAAGGATCTCATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTT
GGTGGTGAGGACCATCAGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAA
AAGGAACAGCAGGAAGAGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTC
CGAGAAGCCCTTACTAAACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGG
AGAGGAGGTTGTTACAAACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGT
GTCTTCTGTTGGCGGCACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATT
GAAAACCATCAGAACATGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGT
GCATTGTCCCTCGTGGGAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTG
GTCACAAACGCACAATTTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGC
CTGAAGAAAATCGACCGCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGAT
CCCAACACTTGCCTTGGAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGT
GGTGTCAATGTGGTTTATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCT
ATGGAAAGGGCAAATGGAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGC
ATCTACATGGGCAGACCAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCT
TACTATGATAGAGGATATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000297071_chr7_23552701_-_3154nt
GAACCAATCAGGACCGGCCTGGCAGTGTCATGGCTGCCCACAGGTCTGCAGGCACTCGGTACGCCGCTAACGCGGCGAGGTAGCTCGGTG
CGTCTCGCGGTACCAGTGCGAATCATCGGGCTATCCAGGTCCGAGATCCTAGTCTCCTGTCGGCTCTGAGGAGGATGGATCCTTCTGCGG
ATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTTAGCATTAGCCTTTGGA
TTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGATTTGATGACAAATGGTT
ATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCGAAGGGATTCGCAACAG
TTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGATCATCTGATAGAAGAGG
TGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGGTTCTGCAAATGGTTAG
AGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGAAATTCTGCCTATGCTA
GCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGAGGGGAGGGCGACTGCG
ACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTGCAGGCACTTCAGAAAG
GGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAGAGGGAGGAAGGATCTC
ATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTTGGTGGTGAGGACCATC
AGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAAAAGGAACAGCAGGAAG
AGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTCCGAGAAGCCCTTACTA
AACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGGAGAGGAGGTTGTTACA
AACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGTGTCTTCTGTTGGCGGC
ACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATTGAAAACCATCAGAACA
TGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGTGCATTGTCCCTCGTGG
GAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTGGTCACAAACGCACAAT
TTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGCCTGAAGAAAATCGACC
GCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGATCCCAACACTTGCCTTG
GAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGTGGTGTCAATGTGGTTT
ATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGAT
CAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTT
TTTAATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTT
GTGTTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAA
CCCCAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTT
TTTAAAGCTTCTTTTGTGTTAGATACTGTATTAGAGATCTGCATTTATCATGAGTTCCTTTTTTTTTTTAACTTTATTTTTGGGAAAGTA
ACACATGAAGTAGTTCAGTCATGTCAGGTTTGTCTGGGGTGGAATGGAACAGTCAGGTAGTTGAAAGTTTTTTTTTAGAGATGAAAAGCT
TGTGAACTCCTGTAAAACATGCTGTATTTGAAATACATCTGTTAAAACTTAAAAACTAAAGTGTGATTTTTTTTGTTGTTGTTAAGTTTA
TTGAAGTTTATTCCCTTAATCAGTGAAGGACAACCCTTATTTATTACCTAGAGCAGTTGTATAATTCGCTGTTAGAAATTTTGGTATTGG
GACAGTGGATAAGCAGGTTATCACATAGCATAGAATTCTTAAAAGATACATGTGGGGAAAAGTAGTCTCAAATAAAAGCTAATTTCTTTG

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000392502_chr7_23552701_-_2781nt
GAACCAATCAGGACCGGCCTGGCAGTGTCATGGCTGCCCACAGGTCTGCAGGCACTCGGTACGCCGCTAACGCGGCGAGGTAGCTCGGTG
CGTCTCGCGGTACCAGTGCGAATCATCGGGCTATCCAGGTCCGAGATCCTAGTCTCCTGTCGGCTCTGAGGAGGATGGATCCTTCTGCGG
ATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTTAGCATTAGCCTTTGGA
TTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGATTTGATGACAAATGGTT
ATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCGAAGGGATTCGCAACAG
TTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGATCATCTGATAGAAGAGG
TGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGGTTCTGCAAATGGTTAG
AGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGAAATTCTGCCTATGCTA
GCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGAGGGGAGGGCGACTGCG
ACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTGCAGGCACTTCAGAAAG
GGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAGAGGGAGGAAGGATCTC
ATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTTGGTGGTGAGGACCATC
AGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAAAAGGAACAGCAGGAAG
AGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTCCGAGAAGCCCTTACTA
AACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGGAGAGGAGGTTGTTACA
AACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGTGTCTTCTGTTGGCGGC
ACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATTGAAAACCATCAGAACA
TGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGTGCATTGTCCCTCGTGG
GAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTGGTCACAAACGCACAAT
TTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGCCTGAAGAAAATCGACC
GCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGATCCCAACACTTGCCTTG
GAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGTGGTGTCAATGTGGTTT
ATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGATCAA
GATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTTTTT
AATTCTGAGATTTCCCCAAGCTGTGGATTCTTCCTACTCCTTAAGAAAAAAACTTTGGTTTATTTAGCATCTACACTTTTGTCAGTTGTG
TTGCTGTTTTCCACCCATTTTATTATACTCTTAAAAGATGTAATTGTTGTCATTTTGAACAGTTAAACATCTTGAGTATAAAAAGAACCC
CAATGTTATGTTATGCTTTGTAAATTTTTTTTTTTGCTTTTACCTAGATAAACTTCTAGCTAATCAAATAAGGAAAGAAACTGTCTTTTT

>In-frame_TYW1_ENST00000359626_chr7_66582605_+_TRA2A_ENST00000538367_chr7_23552701_-_2475nt
GAACCAATCAGGACCGGCCTGGCAGTGTCATGGCTGCCCACAGGTCTGCAGGCACTCGGTACGCCGCTAACGCGGCGAGGTAGCTCGGTG
CGTCTCGCGGTACCAGTGCGAATCATCGGGCTATCCAGGTCCGAGATCCTAGTCTCCTGTCGGCTCTGAGGAGGATGGATCCTTCTGCGG
ATACATGGGACCTCTTCTCACCTTTAATATCATTATGGATAAACAGGTTTTACATTTATTTGGGCTTTGCTGTTAGCATTAGCCTTTGGA
TTTGTGTCCAGATTGTCATCAAGACGCAGGGCAAGAACTTACAGGAAAAATCTGTTCCAAAAGCAGCTCAGGATTTGATGACAAATGGTT
ATGTCTCCCTTCAAGAGAAAGACATCTTTGTGTCTGGAGTGAAGATTTTTTATGGTTCTCAGACTGGAACAGCGAAGGGATTCGCAACAG
TTCTTGCTGAAGCAGTTACATCCCTGGATCTGCCTGTGGCCATTATTAATCTAAAAGAATATGATCCAGATGATCATCTGATAGAAGAGG
TGACTAGTAAAAATGTCTGTGTCTTCCTGGTTGCGACATACACTGACGGCCTACCAACTGAAAGTGCAGAGTGGTTCTGCAAATGGTTAG
AGGAAGCATCCATTGATTTTCGATTTGGCAAAACTTACCTGAAGGGTATGAGATATGCGGTATTTGGCCTGGGAAATTCTGCCTATGCTA
GCCACTTCAACAAGGTTGGCAAAAATGTTGACAAGTGGCTCTGGATGCTTGGCGCGCATCGTGTGATGAGTCGAGGGGAGGGCGACTGCG
ACGTGGTTAAAAGCAAGCACGGCAGCATTGAGGCCGACTTCAGAGCATGGAAGACCAAGTTCATCTCCCAGCTGCAGGCACTTCAGAAAG
GGGAGAGAAAGAAGTCCTGTGGCGGCCACTGCAAGAAAGGCAAATGTGAATCTCACCAACATGGCTCAGAGGAGAGGGAGGAAGGATCTC
ATGAGCAGGATGAATTGCATCATAGAGACACCGAGGAGGAAGAACCCTTTGAGAGCTCCAGTGAAGAAGAGTTTGGTGGTGAGGACCATC
AGAGCCTAAATTCCATTGTTGATGTTGAAGATTTGGGCAAAATTATGGATCATGTGAAGAAAGAAAAGAGAGAAAAGGAACAGCAGGAAG
AGAAGTCTGGTTTGTTCAGGAACATGGGGAGGAATGAAGATGGTGAAAGAAGAGCTATGATAACTCCTGCTCTCCGAGAAGCCCTTACTA
AACAAGGTTATCAGTTGATTGGGAGCCACTCGGGGGTGAAGCTTTGCAGGTGGACAAAGTCCATGCTCCGAGGGAGAGGAGGTTGTTACA
AACACACATTCTATGGAATTGAGAGCCATCGCTGCATGGAAACCACCCCGAGCTTGGCGTGTGCTAATAAATGTGTCTTCTGTTGGCGGC
ACCACACCAACCCCGTGGGCACTGAGTGGCGGTGGAAGATGGACCAGCCTGAAATGATCTTGAAGGAAGCCATTGAAAACCATCAGAACA
TGATTAAGCAGTTTAAAGGAGTACCGGGCGTCAAAGCAGAACGCTTTGAAGAAGGAATGACGGTAAAGCACTGTGCATTGTCCCTCGTGG
GAGAACCAATAATGTACCCAGAGATCAACAGGTTTTTGAAGCTACTCCACCAGTGTAAAATTTCCAGCTTCCTGGTCACAAACGCACAAT
TTCCTGCGGAAATCAGGAACCTCGAGCCGGTTACTCAGCTGTATGTCAGTGTGGATGCCAGTACCAAAGACAGCCTGAAGAAAATCGACC
GCCCACTCTTCAAGGATTTCTGGCAGAGATTCCTTGACAGTTTAAAAGCCTTGGCAGTCAAGGCAAATCCAGATCCCAACACTTGCCTTG
GAGTGTTTGGCCTCAGTTTGTACACAACAGAGAGGGATCTTCGTGAAGTATTTTCTCGATATGGACCATTGAGTGGTGTCAATGTGGTTT
ATGATCAGCGAACTGGGCGATCTCGAGGATTTGCTTTTGTGTATTTTGAGAGAATAGATGACTCAAAGGAGGCTATGGAAAGGGCAAATG
GAATGGAGCTGGATGGTAGAAGAATTCGGGTGGATTATTCTATAACCAAGAGAGCGCACACACCAACACCAGGCATCTACATGGGCAGAC
CAACTCATAGTGGTGGGGGTGGTGGAGGAGGCGGCGGCGGTGGAGGTGGAGGTGGTGGCAGACGTCGAGATTCTTACTATGATAGAGGAT
ATGATCGTGGGTATGACAGATATGAAGACTATGATTACCGATACAGAAGACGATCACCTTCTCCTTATTATAGTCGATATAGATCACGAT
CAAGATCTCGTTCCTACAGCCCAAGACGCTATTGATAACGGAATGGTTGCAATTAAGGACATTTTTTTTCCTCTTTTTTTTTTTTTTTTT


Top

FusionGenePPI for TYW1_TRA2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TYW1ELAVL1, MMS19, LYN, FAM96B, CIAO1, SPINT2, TMEM59, TSPAN17, BTN2A1, FAM189A2, EVA1C, LRRTM2, ZNRF4, GDPD5, LRRTM1, KLHL40, DLK2, RGS20, KCNS3, KCNC4, PCDHA3, NMUR2, PCDHGB4, IL17RC, RNF170, PDGFRB, IL17RB, GPR156, TMPRSS3, CHRND, ADAM33, PCDHGA5, PMEL, PCDHAC1, ATP6V0A2TRA2ATADA2A, YWHAG, NUDT21, SELENBP1, CRABP1, TNNT1, CDK2AP2, C11orf58, ELAVL1, CUL3, CUL5, COPS5, SRSF10, RBM25, SRSF5, CDC5L, SEPT2, NFIA, NHP2L1, NCSTN, SF3A1, BUD31, SF3B3, PHGDH, S100A9, HNRNPC, HNRNPU, PRPF40A, SF3B6, HNRNPM, SAP18, PRPF6, IK, HP1BP3, SEPT7, SMARCB1, PLEC, BARD1, PAXIP1, MAGOH, EIF4A3, PPP1CC, DHX15, U2SURP, CDK6, LBP, NXF1, YTHDC1, CLK3, SRPK2, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, ZNF22, LARP7, SRRM1, MRPS9, MRPS26, THRAP3, LUC7L2, LUC7L, ZNF768, PTCD1, PTCD3, SRRM2, C17orf85, ZFR, PABPC4L, PABPC4, RBBP6, ELAVL2, RPL6, MRPS23, MRPS27, TRUB2, MRPS6, RPL26L1, MTERF3, PAIP1, MRPS18B, MRPL32, C10orf2, MRPS10, DAP3, MEPCE, UPF1, PPIG, LARP1, LARP1B, PHAX, MRPS31, MKRN1, MRPS18C, MRPS5, MRPS7, MRPS22, MRPS15, MRPS35, MRPS25, RRP9, NGRN, MRPS2, MOV10, MRPS33, SRRT, PRPF3, MRPS11, PNN, SRP14, GAR1, MRPS24, CASC3, WDR33, CSNK1E, CSNK1D, MRPS14, GAPDHS, ZCCHC3, MKRN2, ZC3H11A, NOA1, TRA2B, ISY1, SRSF8, CLK1, SRSF7, APOBEC3F, HIST1H2AG, SRSF12, CLK2, MRPL34, MRPS21, SNIP1, NTRK1, SRSF3, SRSF6, EWSR1, CNTRL, CDK2, FEN1, U2AF2, SNRNP70, ZC3H18, C11orf57, SNRPN, NCOA5, PABPC1, SYF2, APOBEC3D, NR3C1, FOXA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TYW1_TRA2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TYW1_TRA2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTRA2AC0037274Dermatologic disorders1CTD_human
TgeneTRA2AC0311375Arsenic Poisoning1CTD_human