FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 40175

FusionGeneSummary for TVP23C_USP20

check button Fusion gene summary
Fusion gene informationFusion gene name: TVP23C_USP20
Fusion gene ID: 40175
HgeneTgene
Gene symbol

TVP23C

USP20

Gene ID

201158

10868

Gene nametrans-golgi network vesicle protein 23 homolog Cubiquitin specific peptidase 20
SynonymsFAM18B2LSFR3A|VDU2|hVDU2
Cytomap

17p12

9q34.11

Type of geneprotein-codingprotein-coding
DescriptionGolgi apparatus membrane protein TVP23 homolog Cfamily with sequence similarity 18, member B2protein FAM18B2ubiquitin carboxyl-terminal hydrolase 20deubiquitinating enzyme 20pVHL-interacting deubiquitinating enzyme 2ubiquitin thioesterase 20ubiquitin thiolesterase 20ubiquitin-specific-processing protease 20
Modification date2018052320180523
UniProtAcc

Q96ET8

Q9Y2K6

Ensembl transtripts involved in fusion geneENST00000519970, ENST00000225576, 
ENST00000584811, ENST00000438826, 
ENST00000428082, ENST00000518321, 
ENST00000583206, 
ENST00000372429, 
ENST00000315480, ENST00000358355, 
ENST00000472108, 
Fusion gene scores* DoF score1 X 1 X 1=16 X 5 X 3=90
# samples 15
** MAII scorelog2(1/1*10)=3.32192809488736log2(5/90*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TVP23C [Title/Abstract] AND USP20 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneUSP20

GO:0016579

protein deubiquitination

19424180

TgeneUSP20

GO:0070536

protein K63-linked deubiquitination

19424180

TgeneUSP20

GO:0071108

protein K48-linked deubiquitination

19424180


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-IW-A3M4-01ATVP23Cchr17

15449099

-USP20chr9

132620329

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000519970ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
Frame-shiftENST00000519970ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
Frame-shiftENST00000519970ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000519970ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000225576ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000225576ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000225576ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000225576ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000584811ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000584811ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000584811ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000584811ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000438826ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000438826ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000438826ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000438826ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000428082ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000428082ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000428082ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000428082ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000518321ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000518321ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
In-frameENST00000518321ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
5CDS-intronENST00000518321ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+
intron-3CDSENST00000583206ENST00000372429TVP23Cchr17

15449099

-USP20chr9

132620329

+
intron-3CDSENST00000583206ENST00000315480TVP23Cchr17

15449099

-USP20chr9

132620329

+
intron-3CDSENST00000583206ENST00000358355TVP23Cchr17

15449099

-USP20chr9

132620329

+
intron-intronENST00000583206ENST00000472108TVP23Cchr17

15449099

-USP20chr9

132620329

+

Top

FusionProtFeatures for TVP23C_USP20


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TVP23C

Q96ET8

USP20

Q9Y2K6

Deubiquitinating enzyme involved in beta-2 adrenergicreceptor (ADRB2) recycling. Acts as a regulator of G-proteincoupled receptor (GPCR) signaling by mediating thedeubiquitination beta-2 adrenergic receptor (ADRB2). Plays acentral role in ADRB2 recycling and resensitization afterprolonged agonist stimulation by constitutively binding ADRB2,mediating deubiquitination of ADRB2 and inhibiting lysosomaltrafficking of ADRB2. Upon dissociation, it is probablytransferred to the translocated beta-arrestins, possibly leadingto beta-arrestins deubiquitination and disengagement from ADRB2.This suggests the existence of a dynamic exchange between theADRB2 and beta-arrestins. Deubiquitinates DIO2, thereby regulatingthyroid hormone regulation. Deubiquitinates HIF1A, leading tostabilize HIF1A and enhance HIF1A-mediated activity. Mediatesdeubiquitination of both 'Lys-48'- and 'Lys-63'-linkedpolyubiquitin chains. {ECO:0000269|PubMed:12056827,ECO:0000269|PubMed:12865408, ECO:0000269|PubMed:15776016,ECO:0000269|PubMed:19424180}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TVP23C_USP20


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_870aa
VACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESE
DDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFR
GYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPD
EAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKL
SSSPPRASPVRMAPSYVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQN
VPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIH
LKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNA
EGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLY
NRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSG

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_870aa
VACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESE
DDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFR
GYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPD
EAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKL
SSSPPRASPVRMAPSYVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQN
VPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIH
LKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNA
EGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLY
NRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSG

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_870aa
VACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESE
DDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFR
GYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPD
EAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKL
SSSPPRASPVRMAPSYVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQN
VPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIH
LKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNA
EGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLY
NRFGGGPAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSG

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_1024aa
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVCLLCELLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGL
RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVIFAFSALFSFTVKWLVACPYVGCGESFADHSTIHAQAKKHN
LTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQ
ALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPV
VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNS
EQVDEDADVDTAMAALDDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSYVLKKAQVLSA
GSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR
RFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLD
LRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCSICQVEIEALA
KRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_2610nt
GTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAAC
CTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCC
AAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAG
GACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAAT
TGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTG
GTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGA
GGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTG
GCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCC
TGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGAT
GAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGAC
GAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGC
CGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTG
TCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGG
CGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTA
TCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAAT
GTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTA
TCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGAC
AACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCAC
CTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTC
CTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATC
GCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCC
GAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCC
AGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTC
TGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTAC
AACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGG
ATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTC
CGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGC
CATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAG
ATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGA

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_2610nt
GTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAAC
CTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCC
AAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAG
GACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAAT
TGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTG
GTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGA
GGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTG
GCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCC
TGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGAT
GAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGAC
GAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGC
CGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTG
TCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGG
CGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTA
TCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAAT
GTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTA
TCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGAC
AACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCAC
CTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTC
CTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATC
GCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCC
GAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCC
AGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTC
TGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTAC
AACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGG
ATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTC
CGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGC
CATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAG
ATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGA

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_2610nt
GTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAAC
CTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCC
AAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAG
GACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAAT
TGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTG
GTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGA
GGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTG
GCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCC
TGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGAT
GAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGAC
GAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGC
CGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTG
TCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGG
CGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTA
TCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAAT
GTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTA
TCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGAC
AACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCAC
CTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTC
CTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATC
GCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCC
GAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCC
AGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTC
TGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTAC
AACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGG
ATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTC
CGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGC
CATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAG
ATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGA

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_3072nt
ATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAA
ATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGC
TTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTA
CGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCA
GAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACA
GTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAAC
TTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTG
GGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAG
TCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAG
GCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGC
TACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAAC
CCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTG
GTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGAT
GAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTG
CTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCG
GAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCC
TCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGC
CATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCT
GGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACC
TGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCC
ATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGA
CGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAG
TTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATC
CTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGAC
CTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGT
GGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTG
GTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCC
ATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAAC
CAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGG
GAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCC
AAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGC
ATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTC
AAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGA
GGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_4546nt
GCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGG
GCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAA
GCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGC
AGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTT
GGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACT
GTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCC
TTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAG
CACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCT
CTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAA
GGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCC
CTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGC
AAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTG
GTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAG
CCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCA
GAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACG
GAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACA
AACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCA
CGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCAC
GAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTG
AGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGT
CTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCAT
TCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTAC
ATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCT
GATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCC
GAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGG
CTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCA
GGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAG
ACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTG
GCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATC
ACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAAC
GTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCA
CTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGC
ATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCA
CAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTG
TATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCC
GAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCT
GCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGT
TGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACT
GTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAG
TAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCA
GAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAA
GTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCC
AGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTC
AGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGC
AAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGG
GGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAA
AGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGA
CCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCT
GAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAA
AGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCT

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_4723nt
GCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGG
GCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAA
GCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGC
AGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTT
GGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACT
GTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCC
TTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAG
CACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCT
CTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAA
GGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCC
CTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGC
AAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTG
GTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAG
CCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCA
GAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACG
GAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACA
AACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCA
CGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCAC
GAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTG
AGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGT
CTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCAT
TCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTAC
ATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCT
GATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCC
GAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGG
CTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCA
GGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAG
ACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTG
GCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATC
ACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAAC
GTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCA
CTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGC
ATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCA
CAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTG
TATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCC
GAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTGTAAGTCGCCCCGGCTGGTCCCTCCATGGCACTCTGGGTCCTCTCCTCACTCTCCA
GAGACCCTCACATGTCCTTTTGAACATCCAAAGAGCAGGTCCCTGAAAGCACCTTCCTGGAGGATGTGGGAGGGCCCTGGACATGGCCCG
GCCCCACTGCTGAGTGCCCGTGTCCCCACAGCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCT
GCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGA
AACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTC
CTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAG
CTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAA
GCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTC
CCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGT
GGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGC
AGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAA
GGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGC
TGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGC
CCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCC
CCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAG
GCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGC
CGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTC

>In-frame_TVP23C_ENST00000225576_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_4546nt
GCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGG
GCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAA
GCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGC
AGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTT
GGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACT
GTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCC
TTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAG
CACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCT
CTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAA
GGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCC
CTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGC
AAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTG
GTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAG
CCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCA
GAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACG
GAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACA
AACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCA
CGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCAC
GAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTG
AGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGT
CTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCAT
TCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTAC
ATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCT
GATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCC
GAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGG
CTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCA
GGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAG
ACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTG
GCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATC
ACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAAC
GTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCA
CTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGC
ATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCA
CAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTG
TATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCC
GAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCT
GCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGT
TGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACT
GTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAG
TAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCA
GAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAA
GTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCC
AGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTC
AGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGC
AAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGG
GGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAA
AGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGA
CCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCT
GAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAA
AGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCT

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_5674nt
CTGAGGGCGCGCTGGGAGGGTGGCGGCTCCTGGGACTGGCTCTGCAGGTTCCGTGGGACTGGAGCCCGCGTCCCCCGCGCCCGCTACTCG
AACTCGAGGAGGAGCGGGGCGGCCGGGAGTGGAGGGCTGTGGGTAGTTGTCTGAGGAGGGCTGCTGGGGGTTCTGAGGCCGCTGGGGGAG
GCGTGACCCGTGCGGCGCAGAGCAAGTACTTCTTGCGGCTGTGGGGACGCCCATTGTTAACCAGCGCGAGTGGGGGTCTCTCTTTCCTCA
ACCCTTATTGCCGGGGTGGAGTTGAGGAGGAGCGGCCTGCGGGCCTCTTAGCTTCCTGACACCCAGGGGTGCGATGCTATCTTGTAGGAA
TCGGCGACACCGCCAGAGCCTCGCTTTCAAATTGCTGTTTCCAAACTAATGTTGTTGGTGATTCTCTCCTTTGTGCTCTTAGAGTTAATT
GTAGTCCACATGTTGGCAACCAGAGACTCGTAAGATTAATAATATTTTTAGAAAAAACTACTGTTTATGGTCACTTAGATTGTCTTAAGT
GTTTTTTTCTTTCGGTTCACACAAAATTTGTTGAGGGATTACTATGACTCAGACACGGTTGTAGGCCCAGGGATAGGGTTGTGACCAGTA
CAGACAGGTTTCTTGCCCCGTATTTTCGGGTTAGGGAAGTGGGTTCTAGGAGATGGGGGTTGGGTGGGGAGACACGATAAATTGTATAAC
CAAAGATATTTTCAGATAATTGCAAAGGCAGGGTGATGAAATAACAAGTGTCCGAGGATAGGACAACTAAGATTTATGGTCAGGAAAGAC
TGCTTATGAGGAGATGCCTTGAGTGGAGAAAATCTAATAATGGTTAAATTCAGCTGTATTACAGGAAAGGTGTCCCGATCCAGACCCGAA
AAGAGGGTCCTTGGCCGGGCGTGGTGACTCAGGCCTGTAATCCCAGCACTTTGGGAGGACGAGGTGGGTGGATCATGAGGTCAAGAGATC
GAGACCATCCTGGCCAACTTGGTGAAACCCTGTCTCTACTAAAAATACAAAAATTAGTTGGGCGTGATGATGCACGCCTGTAGTCCCAGC
TACTCGGGAGGCTGAGGCAGGAGAATCGCTTGAACTGGGGAGGCCGAGGTTGCAGTGAGCCGCGGGCCACTGCACTCCATCCAGCCTGGC
TACAGAGGGAGACTCCGTCTCAAACAAAACAAAAAAAGTCTTGGATCAGGCAAGAAGGAATTCAGGGATAGTAATGATGACACTGAAGAT
GTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTC
TTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTG
TCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGC
CATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATT
GCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGC
GGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGT
TACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCG
CCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGC
CTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTC
TTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAA
CGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAA
GAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCA
GATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGT
GAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAG
AAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCC
ATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGAT
GCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGC
CCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGC
GTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAG
GACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGT
GGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGG
GGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGT
AAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTG
ATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAG
ATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAAT
GGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGG
AAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCC
CGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCC
CACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCC
GTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAG
TTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAG
GGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCT
GACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCG
CAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGT
GCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTT
GGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTC
CTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGA
TGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGG
AGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGG
TCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACT
CTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCG
TCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGG
GAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTC
CCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAG
CCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCA
GGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAG
AAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCC
TCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGA
CGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAATAAA

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_5851nt
CTGAGGGCGCGCTGGGAGGGTGGCGGCTCCTGGGACTGGCTCTGCAGGTTCCGTGGGACTGGAGCCCGCGTCCCCCGCGCCCGCTACTCG
AACTCGAGGAGGAGCGGGGCGGCCGGGAGTGGAGGGCTGTGGGTAGTTGTCTGAGGAGGGCTGCTGGGGGTTCTGAGGCCGCTGGGGGAG
GCGTGACCCGTGCGGCGCAGAGCAAGTACTTCTTGCGGCTGTGGGGACGCCCATTGTTAACCAGCGCGAGTGGGGGTCTCTCTTTCCTCA
ACCCTTATTGCCGGGGTGGAGTTGAGGAGGAGCGGCCTGCGGGCCTCTTAGCTTCCTGACACCCAGGGGTGCGATGCTATCTTGTAGGAA
TCGGCGACACCGCCAGAGCCTCGCTTTCAAATTGCTGTTTCCAAACTAATGTTGTTGGTGATTCTCTCCTTTGTGCTCTTAGAGTTAATT
GTAGTCCACATGTTGGCAACCAGAGACTCGTAAGATTAATAATATTTTTAGAAAAAACTACTGTTTATGGTCACTTAGATTGTCTTAAGT
GTTTTTTTCTTTCGGTTCACACAAAATTTGTTGAGGGATTACTATGACTCAGACACGGTTGTAGGCCCAGGGATAGGGTTGTGACCAGTA
CAGACAGGTTTCTTGCCCCGTATTTTCGGGTTAGGGAAGTGGGTTCTAGGAGATGGGGGTTGGGTGGGGAGACACGATAAATTGTATAAC
CAAAGATATTTTCAGATAATTGCAAAGGCAGGGTGATGAAATAACAAGTGTCCGAGGATAGGACAACTAAGATTTATGGTCAGGAAAGAC
TGCTTATGAGGAGATGCCTTGAGTGGAGAAAATCTAATAATGGTTAAATTCAGCTGTATTACAGGAAAGGTGTCCCGATCCAGACCCGAA
AAGAGGGTCCTTGGCCGGGCGTGGTGACTCAGGCCTGTAATCCCAGCACTTTGGGAGGACGAGGTGGGTGGATCATGAGGTCAAGAGATC
GAGACCATCCTGGCCAACTTGGTGAAACCCTGTCTCTACTAAAAATACAAAAATTAGTTGGGCGTGATGATGCACGCCTGTAGTCCCAGC
TACTCGGGAGGCTGAGGCAGGAGAATCGCTTGAACTGGGGAGGCCGAGGTTGCAGTGAGCCGCGGGCCACTGCACTCCATCCAGCCTGGC
TACAGAGGGAGACTCCGTCTCAAACAAAACAAAAAAAGTCTTGGATCAGGCAAGAAGGAATTCAGGGATAGTAATGATGACACTGAAGAT
GTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTC
TTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTG
TCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGC
CATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATT
GCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGC
GGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGT
TACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCG
CCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGC
CTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTC
TTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAA
CGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAA
GAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCA
GATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGT
GAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAG
AAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCC
ATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGAT
GCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGC
CCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGC
GTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAG
GACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGT
GGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGG
GGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGT
AAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTG
ATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAG
ATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAAT
GGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGG
AAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCC
CGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCC
CACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCC
GTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAG
TTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAG
GGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCT
GACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCG
CAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTGTAAGTCG
CCCCGGCTGGTCCCTCCATGGCACTCTGGGTCCTCTCCTCACTCTCCAGAGACCCTCACATGTCCTTTTGAACATCCAAAGAGCAGGTCC
CTGAAAGCACCTTCCTGGAGGATGTGGGAGGGCCCTGGACATGGCCCGGCCCCACTGCTGAGTGCCCGTGTCCCCACAGCCCCATGTGCC
CCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGT
TTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTG
GCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGC
TACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGC
CCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCC
CGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTG
GACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCC
TGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAA
CCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCT
TCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCT
CTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGA
TCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAG
CAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCC
CTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGC
AGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAATAAATGT

>In-frame_TVP23C_ENST00000584811_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_5674nt
CTGAGGGCGCGCTGGGAGGGTGGCGGCTCCTGGGACTGGCTCTGCAGGTTCCGTGGGACTGGAGCCCGCGTCCCCCGCGCCCGCTACTCG
AACTCGAGGAGGAGCGGGGCGGCCGGGAGTGGAGGGCTGTGGGTAGTTGTCTGAGGAGGGCTGCTGGGGGTTCTGAGGCCGCTGGGGGAG
GCGTGACCCGTGCGGCGCAGAGCAAGTACTTCTTGCGGCTGTGGGGACGCCCATTGTTAACCAGCGCGAGTGGGGGTCTCTCTTTCCTCA
ACCCTTATTGCCGGGGTGGAGTTGAGGAGGAGCGGCCTGCGGGCCTCTTAGCTTCCTGACACCCAGGGGTGCGATGCTATCTTGTAGGAA
TCGGCGACACCGCCAGAGCCTCGCTTTCAAATTGCTGTTTCCAAACTAATGTTGTTGGTGATTCTCTCCTTTGTGCTCTTAGAGTTAATT
GTAGTCCACATGTTGGCAACCAGAGACTCGTAAGATTAATAATATTTTTAGAAAAAACTACTGTTTATGGTCACTTAGATTGTCTTAAGT
GTTTTTTTCTTTCGGTTCACACAAAATTTGTTGAGGGATTACTATGACTCAGACACGGTTGTAGGCCCAGGGATAGGGTTGTGACCAGTA
CAGACAGGTTTCTTGCCCCGTATTTTCGGGTTAGGGAAGTGGGTTCTAGGAGATGGGGGTTGGGTGGGGAGACACGATAAATTGTATAAC
CAAAGATATTTTCAGATAATTGCAAAGGCAGGGTGATGAAATAACAAGTGTCCGAGGATAGGACAACTAAGATTTATGGTCAGGAAAGAC
TGCTTATGAGGAGATGCCTTGAGTGGAGAAAATCTAATAATGGTTAAATTCAGCTGTATTACAGGAAAGGTGTCCCGATCCAGACCCGAA
AAGAGGGTCCTTGGCCGGGCGTGGTGACTCAGGCCTGTAATCCCAGCACTTTGGGAGGACGAGGTGGGTGGATCATGAGGTCAAGAGATC
GAGACCATCCTGGCCAACTTGGTGAAACCCTGTCTCTACTAAAAATACAAAAATTAGTTGGGCGTGATGATGCACGCCTGTAGTCCCAGC
TACTCGGGAGGCTGAGGCAGGAGAATCGCTTGAACTGGGGAGGCCGAGGTTGCAGTGAGCCGCGGGCCACTGCACTCCATCCAGCCTGGC
TACAGAGGGAGACTCCGTCTCAAACAAAACAAAAAAAGTCTTGGATCAGGCAAGAAGGAATTCAGGGATAGTAATGATGACACTGAAGAT
GTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTC
TTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTG
TCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGC
CATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATT
GCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGC
GGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGT
TACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCG
CCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGC
CTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTC
TTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAA
CGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAA
GAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCA
GATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGT
GAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAG
AAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCC
ATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGAT
GCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGC
CCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGC
GTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAG
GACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGT
GGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGG
GGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGT
AAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTG
ATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAG
ATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAAT
GGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGG
AAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCC
CGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCC
CACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCC
GTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAG
TTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAG
GGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCT
GACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCG
CAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGT
GCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTT
GGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTC
CTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGA
TGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGG
AGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGG
TCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACT
CTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCG
TCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGG
GAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTC
CCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAG
CCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCA
GGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAG
AAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCC
TCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGA
CGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAATAAA

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_4538nt
TTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCAT
GTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAAT
CAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTT
TATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACG
TTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGA
GGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGT
AAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTT
GACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGG
CTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTC
TGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGC
CCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTA
CCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCC
AATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGT
GGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGA
GTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCT
GATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGA
GCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTC
CAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCA
TGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGG
CAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTG
TGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCAT
CTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACG
GTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTT
AAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCT
GTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCT
GCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGG
GCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGT
GCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCAT
GCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCA
GACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGA
GCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAA
GCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCAT
GCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAA
AGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGG
TGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCG
GGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGA
ACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGA
CCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTT
GCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCT
GCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCT
GGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGG
CTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGG
ATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTC
ATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAG
CTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGC
AGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTG
GAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCAC
ACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTC
ACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCG
CTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTT

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_4715nt
TTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCAT
GTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAAT
CAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTT
TATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACG
TTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGA
GGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGT
AAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTT
GACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGG
CTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTC
TGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGC
CCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTA
CCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCC
AATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGT
GGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGA
GTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCT
GATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGA
GCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTC
CAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCA
TGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGG
CAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTG
TGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCAT
CTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACG
GTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTT
AAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCT
GTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCT
GCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGG
GCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGT
GCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCAT
GCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCA
GACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGA
GCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAA
GCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCAT
GCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAA
AGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGG
TGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCG
GGCCGTGTGATCTGCTGGGCTAGTCTGTAAGTCGCCCCGGCTGGTCCCTCCATGGCACTCTGGGTCCTCTCCTCACTCTCCAGAGACCCT
CACATGTCCTTTTGAACATCCAAAGAGCAGGTCCCTGAAAGCACCTTCCTGGAGGATGTGGGAGGGCCCTGGACATGGCCCGGCCCCACT
GCTGAGTGCCCGTGTCCCCACAGCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACC
CCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCA
AGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCT
AGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCT
TCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGC
CAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTG
CTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATG
TTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATC
TTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTT
CCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGG
GTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAG
AAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACT
ACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACT
TTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTG
CAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGT

>In-frame_TVP23C_ENST00000438826_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_4538nt
TTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCAT
GTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAAT
CAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTT
TATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACG
TTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGA
GGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGT
AAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTT
GACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGG
CTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTC
TGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGC
CCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTA
CCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCC
AATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGT
GGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGA
GTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCT
GATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGA
GCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTC
CAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCA
TGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGG
CAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTG
TGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCAT
CTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACG
GTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTT
AAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCT
GTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCT
GCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGG
GCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGT
GCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCAT
GCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCA
GACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGA
GCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAA
GCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCAT
GCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAA
AGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGG
TGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCG
GGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGA
ACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGA
CCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTT
GCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCT
GCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCT
GGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGG
CTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGG
ATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTC
ATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAG
CTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGC
AGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTG
GAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCAC
ACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTC
ACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCG
CTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTT

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_4597nt
GCTCCCTCAAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGG
ACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAA
GATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTA
TTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTG
TTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAG
AGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTT
ATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGC
TGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGG
TGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCC
CCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGA
GGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTC
TTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAG
AAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACC
CAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGAC
TCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGG
GGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCT
GAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACT
GCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAAT
GATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCA
AGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGC
AGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTC
CAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCC
TGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTT
TGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGG
TGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAG
GTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCC
CAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATC
AATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTAC
AGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTG
TCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCG
CCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCC
GCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATC
AAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTC
AAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGA
GCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTG
GCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCA
TGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGG
TTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTT
GTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCC
CGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCC
CGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGG
TGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAG
ACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACC
GCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACC
AGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACT
TTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAG
CAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCA
TCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTG
TAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCT
CCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCG
CGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAAT

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_4774nt
GCTCCCTCAAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGG
ACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAA
GATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTA
TTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTG
TTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAG
AGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTT
ATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGC
TGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGG
TGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCC
CCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGA
GGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTC
TTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAG
AAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACC
CAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGAC
TCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGG
GGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCT
GAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACT
GCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAAT
GATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCA
AGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGC
AGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTC
CAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCC
TGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTT
TGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGG
TGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAG
GTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCC
CAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATC
AATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTAC
AGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTG
TCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCG
CCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCC
GCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATC
AAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTC
AAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGA
GCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTG
GCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTGTAAG
TCGCCCCGGCTGGTCCCTCCATGGCACTCTGGGTCCTCTCCTCACTCTCCAGAGACCCTCACATGTCCTTTTGAACATCCAAAGAGCAGG
TCCCTGAAAGCACCTTCCTGGAGGATGTGGGAGGGCCCTGGACATGGCCCGGCCCCACTGCTGAGTGCCCGTGTCCCCACAGCCCCATGT
GCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTT
GGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTC
CTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGA
TGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGG
AGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGG
TCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACT
CTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCG
TCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGG
GAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTC
CCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAG
CCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCA
GGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAG
AAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCC
TCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGA
CGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAATAAA

>In-frame_TVP23C_ENST00000428082_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_4597nt
GCTCCCTCAAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGG
ACCCGTACGCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAA
GATGTTTCACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTA
TTCTTTCGAGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTG
TTGTCGTGTGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAG
AGCCATTGGGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTT
ATTGCCTGTTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGC
TGCGGAGAATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGG
TGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCC
CCGCCACCCTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGA
GGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTC
TTCTTGGAGTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAG
AAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACC
CAAGAGTTCCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGAC
TCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGG
GGTGAGGGTGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCT
GAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACT
GCCATGGCTGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAAT
GATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCA
AGCCCCGTGAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGC
AGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTC
CAGGACTTATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCC
TGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTT
TGGGGGCCTGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGG
TGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAG
GTGATGTACTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCC
CAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATC
AATGGGCAGTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTAC
AGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTG
TCCCGCGAGTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCG
CCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCC
GCCGTGAACCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATC
AAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTC
AAGGGGAAGGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGA
GCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTG
GCGCAGCCGCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCA
TGTGCCCCACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGG
TTTGGTTTGCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTT
GTCCTGGCAGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCC
CGATGCTACCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCC
CGGAGCCCCGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGG
TGGTCCCGCCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAG
ACTCTGGACTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACC
GCGTCCTGCTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACC
AGGGAACCGGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACT
TTCCCTTCCTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAG
CAGCCTCTGGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCA
TCAGGATCAAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTG
TAGAAGCAGGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCT
CCCTCCCTGCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCG
CGACGCAGAGAGGCTTCTGTGCAGGCTGGGATCGGGCCCCATGTCTGTGCTGTCTAGTTTGTGTTCAAAATGTCAGAATAAACACAGAAT

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000372429_chr9_132620329_+_4589nt
AAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTAC
GCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTC
ACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCG
AGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTG
TGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTG
GGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTG
TTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGA
ATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGC
CTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACC
CTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCAC
GGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGA
GTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCC
AAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTT
CCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTC
GAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGG
TGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGA
GCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGC
TGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCA
CCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGT
GAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCAT
CTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTT
ATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGA
CAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCC
TGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAA
GCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTA
CTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCAC
CACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCA
GTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAG
CAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGA
GTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAA
ATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAA
CCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAA
CAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAA
GGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTA
CGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCC
GCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCC
ACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTT
GCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGC
AGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTA
CCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCC
CGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCG
CCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGA
CTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTG
CTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACC
GGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTC
CTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCT
GGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATC
AAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCA
GGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCT
GCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAG

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000315480_chr9_132620329_+_4766nt
AAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTAC
GCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTC
ACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCG
AGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTG
TGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTG
GGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTG
TTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGA
ATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGC
CTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACC
CTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCAC
GGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGA
GTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCC
AAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTT
CCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTC
GAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGG
TGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGA
GCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGC
TGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCA
CCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGT
GAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCAT
CTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTT
ATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGA
CAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCC
TGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAA
GCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTA
CTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCAC
CACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCA
GTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAG
CAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGA
GTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAA
ATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAA
CCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAA
CAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAA
GGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTA
CGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCC
GCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTGTAAGTCGCCCCG
GCTGGTCCCTCCATGGCACTCTGGGTCCTCTCCTCACTCTCCAGAGACCCTCACATGTCCTTTTGAACATCCAAAGAGCAGGTCCCTGAA
AGCACCTTCCTGGAGGATGTGGGAGGGCCCTGGACATGGCCCGGCCCCACTGCTGAGTGCCCGTGTCCCCACAGCCCCATGTGCCCCACC
CCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTTGCA
GTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGCAGT
GCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTACCC
CTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCCCGA
AGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCGCCG
CACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGACTC
ATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTGCTG
AGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACCGGA
TGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTCCTC
CCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCTGGA
TGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATCAAA
GCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCAGGT
GGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCTGCT
GAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAGAGA

>In-frame_TVP23C_ENST00000518321_chr17_15449099_-_USP20_ENST00000358355_chr9_132620329_+_4589nt
AAAGCGGAGGTGAGGCCGGACTGAGGCTCTTACAGTGGTCCCTGCTGGCCCTTGGTGACGGGTCGCGTCAGTTCCGACCCGGACCCGTAC
GCTGCTGCGCTGACGTGGCTCCTGGAAGCAGGGCTGGCGTAGGGCCGCCATGTTGCAGCAGGATAGTAATGATGACACTGAAGATGTTTC
ACTGTTTGATGCGGAAGAGGAGACGACTAATAGACCAAGAAAAGCCAAAATCAGACATCCAGTAGCATCGTTTTTCCACTTATTCTTTCG
AGTCAGTGCAATCATCGTCTGTCTTCTCTGTGAGTTGCTCAGCAGCAGCTTTATTACCTGTATGGTTACAATTATCTTGTTGTTGTCGTG
TGACTTTTGGGCAGTGAAGAATGTCACAGGTAGACTAATGGTTGGCCTACGTTGGTGGAATCACATTGATGAAGATGGAAAGAGCCATTG
GGTGTTTGAATCTAGAAAGGAGTCCTCTCAAGAGAATAAAACTGTGTCAGAGGCTGAATCAAGAATCTTTTGGTTGGGACTTATTGCCTG
TTCAGTACTGTGGGTGATATTTGCCTTTAGTGCACTCTTCTCCTTCACAGTAAAGTGGCTGGTTGCCTGCCCCTATGTTGGCTGCGGAGA
ATCCTTTGCTGACCACAGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGACTGTGGTGTTACGC
CTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTGCTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACC
CTCCCACCCTCTGAAAGCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAACCTCGAGGCCTCAC
GGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTGCAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGA
GTGTGGCGGCCTGGTGCGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGGCATAAGAAACGGCC
AAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTCAACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTT
CCTTCGCTGCCTGATGGACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCTCGGGACTCAGATTC
GAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAAGATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGG
TGACGGGCAGGGGCGTGGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCCATCTCTGAGAAGGA
GCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAACTCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGC
TGCCCTTGACGACCAGCCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCGGACAATGATGCTCA
CCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAGGGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGT
GAGGATGGCACCGTCGTACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGCTACCGCAGCGTCAT
CTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTCACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTT
ATCACTGCCCATTCCTGGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCAGGCGCCTGTGGGGA
CAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATCCGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCC
TGTCGTCACCCTGGAAGACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGTGAGCGGTGTAAGAA
GCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAGATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTA
CTCATTCAAGATCAACAGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGCACATCCCAGATCAC
CACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCA
GTGGTACGAGTTTGATGACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTCTTCTACAGGAAGAG
CAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGA
GTGGCTCAACAAGTTCAACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGCATCCCGCCCCACAA
ATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTCTGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAA
CCACCTGTACGTGTGCTCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACCTTCATCAAGTTGAA
CAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATCAGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAA
GGACAACGAGCCCCCCGGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAGCAGGGAGCTGACTA
CGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTATGGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCC
GCTGGGCCCAGAGAACCTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGATCTGCTGGGCTAGTCTCCCCATGTGCCCC
ACCCCGCGGAAGGCGTGTTTGTGCCCAGAAGAGAGGCCGGGCTGCTGCAGAACCCCGCCGTGTAAAGAGGCAGAAAAGTTGGTTTGGTTT
GCAGTAACGCTGCAACTAGAAAATATATGCACTTCAGGCTTGTTGAAACGACCAAGACTCTGTGACGTTAATTTGGGTCTTTGTCCTGGC
AGTGCCTCTGCCAGTCACTGTCATCGTTGTGTCCCCCACAACTGTCCTCTTGCTAGCTCGGCCCAGCTTTGTCCCTGGAGCCCGATGCTA
CCCCTGTCAGACAGAGGCTGCGGCCTGGGCCAGAGTCAGGGAGTAGCTGCTGCTTCACGGCGTCTCCACTGTGCGATTGGCCCGGAGCCC
CGAAGACTCGGAGGGAGCTGCTCAGGGCCGGTGAGCGCAGCCAGAAGCCCTGGCCAGTGAGGAGCTCACAGGTCCTCCCTGGTGGTCCCG
CCGCACCTCTGCATCTCCTGGGCGTCACCAGGAAGGCTCTGAAGTCCCGGGCTGCTCTCAGCACTTCTCCTGCAGACTGAAGACTCTGGA
CTCATTGCTGATTGGAACACCAGGAGGAGGTTGGATTTCTGCCAGTGGGGGATGTTTCTGGAGGCAGCTGGTCCCCCACACCGCGTCCTG
CTGAGCCTGCCCCCTGGATTGGCTGTAATTTGCCTCGAAGTTCAGCAGTTCATCTTCATGGGAAATTTGCTGAGCCCCCACCAGGGAACC
GGATGATGAAACAGGGATACCTCACAGCTTGGCCATTTGAGGCAAAGGCAGCTTCCCGAGCTGATGCTAAAGAAGACAGACTTTCCCTTC
CTCCCAGCAGCAGCAGTGCAGAGCCCACCTGGAGGGATGTGGGGGCTGTGCAGGGTGCAGCGCTCAGGTGGATCCTGGGAAGCAGCCTCT
GGATGCTGAGTGGAGGGAGCCACTGAGCACAGCAAGGCACCAAAGCCCCTGGAGAAACCGCCAGGGCGAGGTGCGACCATCATCAGGATC
AAAGCAGACGGGGCGTGGGTGGGGAAGGGGCTCTGGGACCAGACCCCCCACACTACTGCGTCTTTGTTTCTATCAGTCTTTGTAGAAGCA
GGTGGTGGTGGAAATTCCAGCAGGTGGGTCCCGCAGAGGCCCTGAGGCCTCACTTTTCGGATCTTCTGTCCCAGATCCTGCTCCCTCCCT
GCTGAGCCTGGGGTTCCCCTGGCATTGGCCCCAGCCTTCTGAAAGCCGGCGCTGCAGCCAGAGGCCGCACGCTGCACTGTCGCGACGCAG


Top

FusionGenePPI for TVP23C_USP20


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TVP23CTSPAN5, VSIG4, IL13RA2, SLC7A1, SPPL2B, SLC5A8, HTR2C, RANBP6, BZW2, SLC15A1, EDEM2, FUCA2USP20DIO2, ACADM, APBA2, CALM1, FECH, EIF3E, MYO1A, MYO1C, PLEC, PLK1, PSMD7, PSMD11, PSMD12, RAD17, RFC2, RFC3, RFC4, UCHL3, EIF3C, HERC2, VAPB, VAPA, PSMD6, NUP153, ATP6AP2, ECI2, USP21, N4BP3, SUN2, ZNF770, LRRC59, MAP7D1, ATAD3B, RGPD5, POLDIP3, NEURL4, GPT2, SYTL4, PLEKHA7, HERC2P2, HIF1A, VHL, PJA1, USP15, USP28, ADRB2, CCP110, USP33, USP20, PLA2G2A, ALAS1, TRIM23, MAGEA11, MDFI, SPRY2, BEND5, FATE1, BEND7, CCDC36, CBX7, VSX2, DBNL, PRKACA, TRAF6, CLSPN, ATR, TMEM173, MAPK6, CRAMP1L, MAP7D2, LMNA, GTF2IRD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TVP23C_USP20


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TVP23C_USP20


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource