FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4016

FusionGeneSummary for BCL2L11_CCDC170

check button Fusion gene summary
Fusion gene informationFusion gene name: BCL2L11_CCDC170
Fusion gene ID: 4016
HgeneTgene
Gene symbol

BCL2L11

CCDC170

Gene ID

10018

80129

Gene nameBCL2 like 11coiled-coil domain containing 170
SynonymsBAM|BIM|BODC6orf97|bA282P11.1
Cytomap

2q13

6q25.1

Type of geneprotein-codingprotein-coding
Descriptionbcl-2-like protein 11BCL2-like 11 (apoptosis facilitator)bcl-2 interacting mediator of cell deathbcl-2 interacting protein Bimbcl-2-related ovarian death agonistcoiled-coil domain-containing protein 170
Modification date2018052720180519
UniProtAcc

O43521

Q8IYT3

Ensembl transtripts involved in fusion geneENST00000337565, ENST00000393253, 
ENST00000357757, ENST00000308659, 
ENST00000393256, ENST00000405953, 
ENST00000239374, ENST00000367290, 
ENST00000544131, 
Fusion gene scores* DoF score4 X 2 X 4=324 X 4 X 4=64
# samples 44
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCL2L11 [Title/Abstract] AND CCDC170 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCL2L11

GO:0008630

intrinsic apoptotic signaling pathway in response to DNA damage

11546872

HgeneBCL2L11

GO:0032464

positive regulation of protein homooligomerization

21041309

HgeneBCL2L11

GO:0034976

response to endoplasmic reticulum stress

22761832

HgeneBCL2L11

GO:2000271

positive regulation of fibroblast apoptotic process

11997495


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-1323-01ABCL2L11chr2

111907724

+CCDC170chr6

151894309

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000337565ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
intron-3CDSENST00000337565ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
intron-intronENST00000337565ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000393253ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000393253ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
5CDS-intronENST00000393253ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000357757ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000357757ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
5CDS-intronENST00000357757ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000308659ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000308659ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
5CDS-intronENST00000308659ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000393256ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
In-frameENST00000393256ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
5CDS-intronENST00000393256ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
intron-3CDSENST00000405953ENST00000239374BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
intron-3CDSENST00000405953ENST00000367290BCL2L11chr2

111907724

+CCDC170chr6

151894309

+
intron-intronENST00000405953ENST00000544131BCL2L11chr2

111907724

+CCDC170chr6

151894309

+

Top

FusionProtFeatures for BCL2L11_CCDC170


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCL2L11

O43521

CCDC170

Q8IYT3


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for BCL2L11_CCDC170


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_534aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSE

>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_541aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKASAWLHFIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNM
IEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDTEIIKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_624aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLS
RSSSGTFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSE

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_631aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLS
RSSSGTFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKASAWLHFIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNM
IEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDTEIIKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_564aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQ
ELRRIGDEFNAYTARRDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAA
LLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLR
DNLNFEKQKTLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIA
QLEEEKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLM
SVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDTEIIKCLERLVHSHQHHFVT

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_571aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQ
ELRRIGDEFNAYTARRDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAA
LLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLR
DNLNFEKQKTLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIA
QLEEEKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKASAWLHFIKTLEQTKAIEDLNKSRDQLEKMKE
KAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDTEIIKCLERLVHS

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_624aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLS
RSSSGTFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSE

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_631aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLS
RSSSGTFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHTLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYTARRDLLSAVEAKEALER
EVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESR
DRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKTLKFLDQLSQKMKLDQMAAEL
GFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKV
ERLQKELNTCRDLHTELKAKLADTNELKASAWLHFIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNM
IEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDTEIIKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_1602nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGATTAAA
ACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATG
TCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAA
ATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGC
TTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACC

>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_1623nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGGCAAGT
GCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAG
AAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATG
ATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAG
GTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCA
CATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCAT

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_1872nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGCCCT
CAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTGTCT
CGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGATTAAA
ACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATG
TCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAA
ATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGC
TTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACC

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_1893nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGCCCT
CAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTGTCT
CGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGGCAAGT
GCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAG
AAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATG
ATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAG
GTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCA
CATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCAT

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_1692nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGATTAAA
ACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATG
TCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAA
ATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGC
TTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACC

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_1713nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGGCAAGT
GCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAG
AAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATG
ATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAG
GTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCA
CATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCAT

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_1872nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGCCCT
CAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTGTCT
CGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGATTAAA
ACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATG
TCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAA
ATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGC
TTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACC

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_1893nt
ATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGACCT
GGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGCCCT
CAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTGTCT
CGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCTCCT
TGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCCCAA
GAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAAAGG
GAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGCTCT
TCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCAGCC
CTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGCAGG
GACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTCCAG
AGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTGCGA
GACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAACTT
GGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACCATT
GCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATAGCC
CAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAGGTG
GAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGGCAAGT
GCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAG
AAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATG
ATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAG
GTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCA
CATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_4936nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAA
GCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATA
GAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTG
GTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACAT
CAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCATTGA
ACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCATGTCTTTGAGATTTGATCAGTT
TGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCAGCCTTAGATAAACGTTCAGCA
TTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGTTAGATTGGGAAATGGGAGTGG
GAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACCATGTGGAGAAGCTGTGACATT
TTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTGGGACCAGGATGGACAACTCAT
TGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGATGCTGGTGGGAATTGTTTGCAT
AGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAATCCCAGCACTTTGGGAGTCCA
AGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTACTAAAAATACAAAAATAAGCC
AGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAGGCGGCAGTGAGCCAAGATTGT
GCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAATGTCCAAAAATGA
CAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATCAAACTTACATAGGTCTCAGGT
CCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCAGCAGGGCTGGTCTCAGTCCTT
TAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCAATATATCCAATACACCCACAG
CAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTTCTATTTTACAAATTTTTCAGG
GAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCATATAAGATGTATTTTTTTATTG
TCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATTAGGAGAAAATGAAAAATATAC
AACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGCAAAAAATACAAAAATGAGCCC
GGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGGGAGGCGGAGGTTGCAATGAGC
CGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACAAAAAGTCAAAGTCATAATAAG
CAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCAAAACTAGATTGGATCTTGGTT
TGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGATTATATTAAAATATTTTTAATT
TTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTACAGACAATAAGTGATAAAATG
GGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAAAAAAAAAAAAGAAGAAAGAGA
GAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACCACACAGAGGGAGAGTGACCAG
GCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTATTTTGCATGTGAGTAAACACAC
CTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGGGGAGGCCTGCAGTTTTCCCCA
CCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGTGGAGGAAGTGACTTCACTGGG
TCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTATGGGTGGATGTGGGTGTATGAG
AGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTTAGTTTCTTGGGAAATTTATTT
TCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTGATATCATTAATTTTATATCAG
GATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATTACATTCCATTTATCCAAATAT
ATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGATCTTTAACATACTCAGAAATAT
GAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATTCTGTACATGTATACAGTCCAT

>In-frame_BCL2L11_ENST00000393253_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_4957nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGGCAAGTGCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAA
CTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAA
GAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAG
CTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTT
GAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGC
CATTTACAGCTTCTTCATTGAACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCAT
GTCTTTGAGATTTGATCAGTTTGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCA
GCCTTAGATAAACGTTCAGCATTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGT
TAGATTGGGAAATGGGAGTGGGAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACC
ATGTGGAGAAGCTGTGACATTTTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTG
GGACCAGGATGGACAACTCATTGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGAT
GCTGGTGGGAATTGTTTGCATAGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAA
TCCCAGCACTTTGGGAGTCCAAGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTA
CTAAAAATACAAAAATAAGCCAGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAG
GCGGCAGTGAGCCAAGATTGTGCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAA
AAAGTTAATGTCCAAAAATGACAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATC
AAACTTACATAGGTCTCAGGTCCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCA
GCAGGGCTGGTCTCAGTCCTTTAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCA
ATATATCCAATACACCCACAGCAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTT
CTATTTTACAAATTTTTCAGGGAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCAT
ATAAGATGTATTTTTTTATTGTCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATT
AGGAGAAAATGAAAAATATACAACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGC
AAAAAATACAAAAATGAGCCCGGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGG
GAGGCGGAGGTTGCAATGAGCCGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACA
AAAAGTCAAAGTCATAATAAGCAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCA
AAACTAGATTGGATCTTGGTTTGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGAT
TATATTAAAATATTTTTAATTTTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTA
CAGACAATAAGTGATAAAATGGGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAA
AAAAAAAAAAGAAGAAAGAGAGAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACC
ACACAGAGGGAGAGTGACCAGGCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTAT
TTTGCATGTGAGTAAACACACCTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGG
GGAGGCCTGCAGTTTTCCCCACCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGT
GGAGGAAGTGACTTCACTGGGTCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTAT
GGGTGGATGTGGGTGTATGAGAGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTT
AGTTTCTTGGGAAATTTATTTTCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTG
ATATCATTAATTTTATATCAGGATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATT
ACATTCCATTTATCCAAATATATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGAT
CTTTAACATACTCAGAAATATGAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATT
CTGTACATGTATACAGTCCATATACACATTAAGTGTTTGTCATTTGGACAAATTGAAAACTTTTAATAAAGCCATTTTCTTCTTTGTTAA

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_5206nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGC
TGCCCCCACGGCAGCCCTCAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGA
AGATCCTCCCTGCTGTCTCGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACA
CAAACCCCAAGTCCTCCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAA
GCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATA
GAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTG
GTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACAT
CAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCATTGA
ACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCATGTCTTTGAGATTTGATCAGTT
TGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCAGCCTTAGATAAACGTTCAGCA
TTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGTTAGATTGGGAAATGGGAGTGG
GAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACCATGTGGAGAAGCTGTGACATT
TTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTGGGACCAGGATGGACAACTCAT
TGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGATGCTGGTGGGAATTGTTTGCAT
AGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAATCCCAGCACTTTGGGAGTCCA
AGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTACTAAAAATACAAAAATAAGCC
AGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAGGCGGCAGTGAGCCAAGATTGT
GCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAATGTCCAAAAATGA
CAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATCAAACTTACATAGGTCTCAGGT
CCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCAGCAGGGCTGGTCTCAGTCCTT
TAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCAATATATCCAATACACCCACAG
CAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTTCTATTTTACAAATTTTTCAGG
GAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCATATAAGATGTATTTTTTTATTG
TCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATTAGGAGAAAATGAAAAATATAC
AACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGCAAAAAATACAAAAATGAGCCC
GGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGGGAGGCGGAGGTTGCAATGAGC
CGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACAAAAAGTCAAAGTCATAATAAG
CAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCAAAACTAGATTGGATCTTGGTT
TGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGATTATATTAAAATATTTTTAATT
TTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTACAGACAATAAGTGATAAAATG
GGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAAAAAAAAAAAAGAAGAAAGAGA
GAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACCACACAGAGGGAGAGTGACCAG
GCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTATTTTGCATGTGAGTAAACACAC
CTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGGGGAGGCCTGCAGTTTTCCCCA
CCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGTGGAGGAAGTGACTTCACTGGG
TCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTATGGGTGGATGTGGGTGTATGAG
AGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTTAGTTTCTTGGGAAATTTATTT
TCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTGATATCATTAATTTTATATCAG
GATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATTACATTCCATTTATCCAAATAT
ATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGATCTTTAACATACTCAGAAATAT
GAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATTCTGTACATGTATACAGTCCAT

>In-frame_BCL2L11_ENST00000357757_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_5227nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGC
TGCCCCCACGGCAGCCCTCAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGA
AGATCCTCCCTGCTGTCTCGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACA
CAAACCCCAAGTCCTCCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGGCAAGTGCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAA
CTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAA
GAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAG
CTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTT
GAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGC
CATTTACAGCTTCTTCATTGAACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCAT
GTCTTTGAGATTTGATCAGTTTGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCA
GCCTTAGATAAACGTTCAGCATTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGT
TAGATTGGGAAATGGGAGTGGGAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACC
ATGTGGAGAAGCTGTGACATTTTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTG
GGACCAGGATGGACAACTCATTGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGAT
GCTGGTGGGAATTGTTTGCATAGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAA
TCCCAGCACTTTGGGAGTCCAAGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTA
CTAAAAATACAAAAATAAGCCAGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAG
GCGGCAGTGAGCCAAGATTGTGCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAA
AAAGTTAATGTCCAAAAATGACAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATC
AAACTTACATAGGTCTCAGGTCCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCA
GCAGGGCTGGTCTCAGTCCTTTAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCA
ATATATCCAATACACCCACAGCAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTT
CTATTTTACAAATTTTTCAGGGAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCAT
ATAAGATGTATTTTTTTATTGTCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATT
AGGAGAAAATGAAAAATATACAACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGC
AAAAAATACAAAAATGAGCCCGGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGG
GAGGCGGAGGTTGCAATGAGCCGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACA
AAAAGTCAAAGTCATAATAAGCAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCA
AAACTAGATTGGATCTTGGTTTGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGAT
TATATTAAAATATTTTTAATTTTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTA
CAGACAATAAGTGATAAAATGGGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAA
AAAAAAAAAAGAAGAAAGAGAGAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACC
ACACAGAGGGAGAGTGACCAGGCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTAT
TTTGCATGTGAGTAAACACACCTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGG
GGAGGCCTGCAGTTTTCCCCACCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGT
GGAGGAAGTGACTTCACTGGGTCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTAT
GGGTGGATGTGGGTGTATGAGAGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTT
AGTTTCTTGGGAAATTTATTTTCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTG
ATATCATTAATTTTATATCAGGATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATT
ACATTCCATTTATCCAAATATATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGAT
CTTTAACATACTCAGAAATATGAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATT
CTGTACATGTATACAGTCCATATACACATTAAGTGTTTGTCATTTGGACAAATTGAAAACTTTTAATAAAGCCATTTTCTTCTTTGTTAA

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_5026nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACA
CAAACCCCAAGTCCTCCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAA
GCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATA
GAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTG
GTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACAT
CAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCATTGA
ACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCATGTCTTTGAGATTTGATCAGTT
TGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCAGCCTTAGATAAACGTTCAGCA
TTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGTTAGATTGGGAAATGGGAGTGG
GAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACCATGTGGAGAAGCTGTGACATT
TTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTGGGACCAGGATGGACAACTCAT
TGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGATGCTGGTGGGAATTGTTTGCAT
AGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAATCCCAGCACTTTGGGAGTCCA
AGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTACTAAAAATACAAAAATAAGCC
AGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAGGCGGCAGTGAGCCAAGATTGT
GCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAATGTCCAAAAATGA
CAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATCAAACTTACATAGGTCTCAGGT
CCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCAGCAGGGCTGGTCTCAGTCCTT
TAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCAATATATCCAATACACCCACAG
CAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTTCTATTTTACAAATTTTTCAGG
GAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCATATAAGATGTATTTTTTTATTG
TCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATTAGGAGAAAATGAAAAATATAC
AACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGCAAAAAATACAAAAATGAGCCC
GGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGGGAGGCGGAGGTTGCAATGAGC
CGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACAAAAAGTCAAAGTCATAATAAG
CAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCAAAACTAGATTGGATCTTGGTT
TGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGATTATATTAAAATATTTTTAATT
TTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTACAGACAATAAGTGATAAAATG
GGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAAAAAAAAAAAAGAAGAAAGAGA
GAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACCACACAGAGGGAGAGTGACCAG
GCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTATTTTGCATGTGAGTAAACACAC
CTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGGGGAGGCCTGCAGTTTTCCCCA
CCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGTGGAGGAAGTGACTTCACTGGG
TCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTATGGGTGGATGTGGGTGTATGAG
AGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTTAGTTTCTTGGGAAATTTATTT
TCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTGATATCATTAATTTTATATCAG
GATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATTACATTCCATTTATCCAAATAT
ATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGATCTTTAACATACTCAGAAATAT
GAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATTCTGTACATGTATACAGTCCAT

>In-frame_BCL2L11_ENST00000308659_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_5047nt
ACTTCGCTCCGCGCAGCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCG
GTTCGCTGCGTTCCCGCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAAC
GCAAGAAAAAAAGACCAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGG
CCTCCCCAGCTCAGACCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACA
CAAACCCCAAGTCCTCCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCA
GAGATATGGATCGCCCAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCA
AAAGAAGCTCTTGAAAGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGC
CTCCTGAAGAAAAGCTCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTT
AGGGAGAAAATCGCAGCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGAC
AGCCGGGAAGAAAGCAGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTT
CACCAGAAAGCTCTCCAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTT
TCTGGAGGTGTTTTGCGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGAC
CAGATGGCTGCCGAACTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTC
ATTGAGAACAAGACCATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTC
CTCCGGCAGAAAATAGCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGG
AACTTGCAGAAGAAGGTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACC
AATGAACTGAAGGCAAGTGCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAA
CTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAA
GAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAG
CTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTT
GAAAGATTGGTCCATTCACATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGC
CATTTACAGCTTCTTCATTGAACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCAT
GTCTTTGAGATTTGATCAGTTTGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCA
GCCTTAGATAAACGTTCAGCATTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGT
TAGATTGGGAAATGGGAGTGGGAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACC
ATGTGGAGAAGCTGTGACATTTTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTG
GGACCAGGATGGACAACTCATTGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGAT
GCTGGTGGGAATTGTTTGCATAGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAA
TCCCAGCACTTTGGGAGTCCAAGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTA
CTAAAAATACAAAAATAAGCCAGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAG
GCGGCAGTGAGCCAAGATTGTGCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAA
AAAGTTAATGTCCAAAAATGACAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATC
AAACTTACATAGGTCTCAGGTCCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCA
GCAGGGCTGGTCTCAGTCCTTTAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCA
ATATATCCAATACACCCACAGCAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTT
CTATTTTACAAATTTTTCAGGGAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCAT
ATAAGATGTATTTTTTTATTGTCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATT
AGGAGAAAATGAAAAATATACAACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGC
AAAAAATACAAAAATGAGCCCGGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGG
GAGGCGGAGGTTGCAATGAGCCGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACA
AAAAGTCAAAGTCATAATAAGCAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCA
AAACTAGATTGGATCTTGGTTTGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGAT
TATATTAAAATATTTTTAATTTTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTA
CAGACAATAAGTGATAAAATGGGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAA
AAAAAAAAAAGAAGAAAGAGAGAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACC
ACACAGAGGGAGAGTGACCAGGCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTAT
TTTGCATGTGAGTAAACACACCTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGG
GGAGGCCTGCAGTTTTCCCCACCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGT
GGAGGAAGTGACTTCACTGGGTCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTAT
GGGTGGATGTGGGTGTATGAGAGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTT
AGTTTCTTGGGAAATTTATTTTCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTG
ATATCATTAATTTTATATCAGGATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATT
ACATTCCATTTATCCAAATATATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGAT
CTTTAACATACTCAGAAATATGAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATT
CTGTACATGTATACAGTCCATATACACATTAAGTGTTTGTCATTTGGACAAATTGAAAACTTTTAATAAAGCCATTTTCTTCTTTGTTAA

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000239374_chr6_151894309_+_5191nt
GCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCC
GCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCGGTTCGCTGCGTTCCC
GCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAACGCAAGAAAAAAAGAC
CAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGA
CCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGC
CCTCAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTG
TCTCGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCT
CCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCC
CAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAA
AGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGC
TCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCA
GCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGC
AGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTC
CAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTG
CGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAA
CTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACC
ATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATA
GCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAG
GTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGATT
AAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAGGAGAAAGCTGAGAAAAAGCTC
ATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAACATGATAGAAGTGGTAACCAGT
GAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGGGAGGTGGTGTCGCAGATGCTA
GGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCATTCACATCAGCATCACTTTGTT
ACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTTCATTGAACACTGTATCTCTTG
AGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCATGTCTTTGAGATTTGATCAGTTTGTGAATATTTTATG
CTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCAGCCTTAGATAAACGTTCAGCATTAAAAACGCCTATT
ATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGTTAGATTGGGAAATGGGAGTGGGAGATAATATTGGGA
GGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACCATGTGGAGAAGCTGTGACATTTTTAATTTACAACCT
TTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTGGGACCAGGATGGACAACTCATTGGCCCTGCCTCAAA
AGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGATGCTGGTGGGAATTGTTTGCATAGAGGAAGGACAATA
ACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAATCCCAGCACTTTGGGAGTCCAAGGCAGGCATATCAT
TTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTACTAAAAATACAAAAATAAGCCAGGTGTGGTGGTGCA
TGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAGGCGGCAGTGAGCCAAGATTGTGCCACTGCACTCCAG
CCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAATGTCCAAAAATGACAGATTTACAAGTGT
AAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATCAAACTTACATAGGTCTCAGGTCCTGTAAGAAACTTG
CCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCAGCAGGGCTGGTCTCAGTCCTTTAAAATGGAAAGCTT
TATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCAATATATCCAATACACCCACAGCAATGGTACCTTTTT
AAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTTCTATTTTACAAATTTTTCAGGGAATCATATTCTTAA
CTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCATATAAGATGTATTTTTTTATTGTCCTTAAAAGAAGCT
CTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATTAGGAGAAAATGAAAAATATACAACCAACCGTTCGTG
AGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGCAAAAAATACAAAAATGAGCCCGGTATGTTGGCATAT
GCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGGGAGGCGGAGGTTGCAATGAGCCGAGATCGCGCTACT
GCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACAAAAAGTCAAAGTCATAATAAGCAAATTATTGGCTTC
TTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCAAAACTAGATTGGATCTTGGTTTGAATGAAAAAAAGC
ATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGATTATATTAAAATATTTTTAATTTTTTAAGCTTGACAA
ATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTACAGACAATAAGTGATAAAATGGGAAAAAATAGTGAA
GATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAAAAAAAAAAAAGAAGAAAGAGAGAAAGAAAGAAACAG
AAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACCACACAGAGGGAGAGTGACCAGGCTTTGCTTGTGGAG
CGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTATTTTGCATGTGAGTAAACACACCTGCGCAGCCCTGGC
TGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGGGGAGGCCTGCAGTTTTCCCCACCAACCCCTTTTCAC
ATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGTGGAGGAAGTGACTTCACTGGGTCTCTGGAGGCTCTC
GGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTATGGGTGGATGTGGGTGTATGAGAGTGGAGATTGTTTT
TGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTTAGTTTCTTGGGAAATTTATTTTCTACGCTATTCAAA
GATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTGATATCATTAATTTTATATCAGGATTCATGTAAGAGA
CTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATTACATTCCATTTATCCAAATATATGTTTATATAATAT
TTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGATCTTTAACATACTCAGAAATATGAAAAATGTTTGAAT
ATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATTCTGTACATGTATACAGTCCATATACACATTAAGTGT

>In-frame_BCL2L11_ENST00000393256_chr2_111907724_+_CCDC170_ENST00000367290_chr6_151894309_+_5212nt
GCCGCCTGGTCTGCAGTTTGTTGGAGCTCTGCGTCCAGCGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCC
GCCACTACCACCACTTGATTCTTGCAGCCACCCTGCGAACCCTGCCACACTGCGATCGCATCATCGCGGTATTCGGTTCGCTGCGTTCCC
GCCGCCACCGCCTCGGCGCCCTTTCTTGGCCCTTGTTCCCCCAAATGTCTGACTCTGACTCTCGGACTGAGAAACGCAAGAAAAAAAGAC
CAAATGGCAAAGCAACCTTCTGATGTAAGTTCTGAGTGTGACCGAGAAGGTAGACAATTGCAGCCTGCGGAGAGGCCTCCCCAGCTCAGA
CCTGGGGCCCCTACCTCCCTACAGACAGAGCCACAAGGTAATCCTGAAGGCAATCACGGAGGTGAAGGGGACAGCTGCCCCCACGGCAGC
CCTCAGGGCCCGCTGGCCCCACCTGCCAGCCCTGGCCCTTTTGCTACCAGATCCCCGCTTTTCATCTTTATGAGAAGATCCTCCCTGCTG
TCTCGATCCTCCAGTGGGTATTTCTCTTTTGACACAGACAGGAGCCCAGCACCCATGAGTTGTGACAAATCAACACAAACCCCAAGTCCT
CCTTGCCAGGCCTTCAACCACTATCTCAGTGCAATGGCTTCCATGAGGCAGGCTGAACCTGCAGATATGCGCCCAGAGATATGGATCGCC
CAAGAGTTGCGGCGTATTGGAGACGAGTTTAACGCTTACTATGCAAGGAGGGACCTGCTCAGTGCTGTAGAAGCAAAAGAAGCTCTTGAA
AGGGAAGTTAAGATCTTCCAAGAAAGGCTGCTTGCTGGCCAGCAGGTCTGGGATGCCTCAAAGCAGGAAGTGAGCCTCCTGAAGAAAAGC
TCTTCTGAGTTGGAGAAGAGTTTGAAGGCCAGTCAGGATGCAGTCACAACCTCACAAAGCCAGTACTTCTCATTTAGGGAGAAAATCGCA
GCCCTCCTTAGGGGCAGATTGAGCATGACTGGGTCCACTGAGGACACCATTTTGGAGAAGATTCGAGAAATGGACAGCCGGGAAGAAAGC
AGGGACCGGATGGTCTCCCAGCTTGAAGCCCAAATATCTGAGCTTGTTGAACAGTTGGGAAAGGAGTCTGGGTTTCACCAGAAAGCTCTC
CAGAGGGCCCAGAAAGCAGAGAATATGTTGGAGACTCTTCAGGGTCAGCTGACACACCTGGAGGCAGAGCTGGTTTCTGGAGGTGTTTTG
CGAGACAACTTGAATTTTGAGAAACAAAAATATCTTAAATTTCTGGATCAGCTTTCTCAGAAAATGAAGTTGGACCAGATGGCTGCCGAA
CTTGGCTTTGACATGCGGCTGGACGTGGTTTTAGCTCGAACAGAGCAGCTGGTTCGTCTTGAGAGCAATGCAGTCATTGAGAACAAGACC
ATTGCCCACAATTTGCAGAGAAAGCTAAAGACACAGAAAGAGAGACTGGAGAGCAAAGAATTACACATGAGCCTCCTCCGGCAGAAAATA
GCCCAGCTGGAGGAGGAGAAGCAGGCACGCACGGCCTTGGTGGTTGAGAGGGACAACGCGCATCTTACCATCAGGAACTTGCAGAAGAAG
GTGGAGAGGCTGCAGAAAGAGCTGAACACGTGTCGAGACTTGCACACCGAGCTCAAAGCCAAACTGGCCGACACCAATGAACTGAAGGCA
AGTGCTTGGCTTCATTTTATTAAAACTTTGGAACAGACTAAAGCCATTGAAGATCTAAACAAATCCAGAGACCAACTGGAGAAGATGAAG
GAGAAAGCTGAGAAAAAGCTCATGTCTGTCAAGTCAGAACTGGATACCACAGAACATGAGGCTAAGGAGAATAAAGAAAGGGCCAGAAAC
ATGATAGAAGTGGTAACCAGTGAAATGAAGACACTAAAAAAATCTCTGGAAGAAGCAGAAAAGAGAGAAAAGCAGCTGGCAGACTTCAGG
GAGGTGGTGTCGCAGATGCTAGGCTTGAACGTGACCAGCCTTGCTCTTCCTGATTATGAAATCATCAAGTGTCTTGAAAGATTGGTCCAT
TCACATCAGCATCACTTTGTTACCTGTGCCTGCCTCAAAGATGTGACTACTGGGCAAGAGAGGCACCCACAAGGCCATTTACAGCTTCTT
CATTGAACACTGTATCTCTTGAGAGAGGTGGCCATAAGACATGGCACACAATTCCCAATTTCACAAATTCCTCATGTCTTTGAGATTTGA
TCAGTTTGTGAATATTTTATGCTTTGATGATATAGTGAGAATGCATCACTTGCAAAAACGATCTCAAAAGTGTCAGCCTTAGATAAACGT
TCAGCATTAAAAACGCCTATTATTTCATTTACTAGCATTTTAGGATCCAGAAGAATTCCACCAGATTGCATGAGTTAGATTGGGAAATGG
GAGTGGGAGATAATATTGGGAGGTATCTATTTTAAGTCAGGGGCTTTACTAGCCGATTTAGTTCTCACAATAACCATGTGGAGAAGCTGT
GACATTTTTAATTTACAACCTTTCTGGGGCTCAGACATAAAGTTACCTATCCAAGGTTGCAGTTGGGTAGTGGTGGGACCAGGATGGACA
ACTCATTGGCCCTGCCTCAAAAGCCATACCTCTTCTCCTGCTATGCAGAATCTGTTTCTCCTGAATCTCTGTGATGCTGGTGGGAATTGT
TTGCATAGAGGAAGGACAATAACCCTGCCATCGTGAGTTAATGTCCGGGCTGGTCACAGTGGTTCATGCCTGTAATCCCAGCACTTTGGG
AGTCCAAGGCAGGCATATCATTTGAGGTCAGGAGTTTAAGACCAGCCTGGCTAACATAGTGAGACCCTGTTTCTACTAAAAATACAAAAA
TAAGCCAGGTGTGGTGGTGCATGACTGTAATCCCAACTACTCAGCAGGAGAAGCACTTGAACCCAGGAGACGGAGGCGGCAGTGAGCCAA
GATTGTGCCACTGCACTCCAGCCTGGGCGACAGAGTGAAACTACATCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAGTTAATGTCCAA
AAATGACAGATTTACAAGTGTAAGCTATATGATTTCTTCAAAAAGCAAAAGCAATATACCTAATTCATTTGGATCAAACTTACATAGGTC
TCAGGTCCTGTAAGAAACTTGCCTGTTCTAACTGTTGCTACCAGATTATATCTGGTGGTAATTGTTAATGTTTCAGCAGGGCTGGTCTCA
GTCCTTTAAAATGGAAAGCTTTATTTGGAGCCCAACCCTATAAGATGAAGAAATCCTATATAGTCTTATTCACCAATATATCCAATACAC
CCACAGCAATGGTACCTTTTTAAGATCAGGATTTTATTATGAATTCCTGTCACTTTCTGTTTTCCATTTAAATTTCTATTTTACAAATTT
TTCAGGGAATCATATTCTTAACTTCACTGAGAAAAATGTGTTACTCTTTTGGACAATTTATCTTATTTCTATCATATAAGATGTATTTTT
TTATTGTCCTTAAAAGAAGCTCTAGCATGAAATTAAAGGAAAGGGAAAGAAATAGATCTGGTGCACCCGAACATTAGGAGAAAATGAAAA
ATATACAACCAACCGTTCGTGAGTCATCAAAAAGTCAAAGTCAGCCTGGCCAACATGGCAAAACTCCGTCTCTGCAAAAAATACAAAAAT
GAGCCCGGTATGTTGGCATATGCCTGTAATCCCAGCTACTCGAGAGGCTGAGACACGAAAATTGCTTGAACCTGGGAGGCGGAGGTTGCA
ATGAGCCGAGATCGCGCTACTGCACTCCAGCCTGGGCAACAGAGAGAGACCTTGTCTCAAAAAACAACAACAACAAAAAGTCAAAGTCAT
AATAAGCAAATTATTGGCTTCTTTCTTCTAGACTAAAAGAAATTAAAGAGATGAAACAATCAATTGCAAGGGTCAAAACTAGATTGGATC
TTGGTTTGAATGAAAAAAAGCATAAAATATTCTTGCAATAATTGTAAAAATTTGAATGTGGACTAAGTCCTAGATTATATTAAAATATTT
TTAATTTTTTAAGCTTGACAAATGCACTGATTGTTATACTTTAAATAACTAAAAATCTGAGAATCCACAGTGCTACAGACAATAAGTGAT
AAAATGGGAAAAAATAGTGAAGATCTTCTTTTAGGAAAACTACCAATAAATGTAGAATGGATGATTCCAAAAAAAAAAAAAAAAAGAAGA
AAGAGAGAAAGAAAGAAACAGAAAAACCTAAAAGAAAGCGAATGAATTTGACACCTGTTGGTTGGATGACAGACCACACAGAGGGAGAGT
GACCAGGCTTTGCTTGTGGAGCGGGCATCCCTGCCTAGCTATCTCCTTCATGTGCAAGGACAGTATAAGTAGTATTTTGCATGTGAGTAA
ACACACCTGCGCAGCCCTGGCTGAGGTCACTAGGCTGGCCAGAGGCAGGACAGGCAGTCTTGAATTTCCTCTAGGGGAGGCCTGCAGTTT
TCCCCACCAACCCCTTTTCACATGCTCCAAAGATGTAGTAGTGTCTGCTGTTTTGGATCGAAAATCACCTTGAGTGGAGGAAGTGACTTC
ACTGGGTCTCTGGAGGCTCTCGGAGCTTGAGTGGCTCTGCCCCACCCTGAATCATGCACCCATAAATGCAGTTATGGGTGGATGTGGGTG
TATGAGAGTGGAGATTGTTTTTGTACATTCTCTTTGTTTTCATTTTCCAAATATAATCTTTAATAAACTTGATTTAGTTTCTTGGGAAAT
TTATTTTCTACGCTATTCAAAGATATTTTAAATAATATTTTAAAAACATGAAATTTTTTTTTCATTTTTGATTTGATATCATTAATTTTA
TATCAGGATTCATGTAAGAGACTAAAAATGATCCATAGTGGTTAGTACTGTAATTTCTGTTTATTACATGAAATTACATTCCATTTATCC
AAATATATGTTTATATAATATTTCCACTGTGTGACTCTAGTGATCTTTAACATACACAGAATGATCTACAGTGATCTTTAACATACTCAG
AAATATGAAAAATGTTTGAATATGATCTTTAGGGACTTCTAATGAAAAGGGTATATGAAATGGGAACAATAAATTCTGTACATGTATACA


Top

FusionGenePPI for BCL2L11_CCDC170


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCL2L11BCL2L2, BCL2, BCL2L1, MCL1, DYNLL2, DYNLL1, VDAC1, BCL2A1, BTK, SMARCB1, GTF2I, TRIM2, UBQLN2, BTRC, HSPA4, CUL2, CISH, TCEB2, VHL, GNB2L1, CD302, FBXW11, APP, MAPK8, BAG3, YWHAB, AURKA, ATP6V1G1, FGL1, RIOK3, AURKB, FEM1C, NDRG1, MAGEA11, GIMAP5, EDNRA, ATP2A3, ANKLE2, MTHFR, RHPN2, BAX, KIF22, USP27X, MAPK1, MAPK3, SLC39A12, KLHL10, P4HA3, SLC18A1, MTA2, ADAM32, PCDHB11CCDC170RAD21, CCNH, MIS18A, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCL2L11_CCDC170


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCL2L11_CCDC170


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBCL2L11C0008313Cholangitis, Sclerosing1CTD_human