FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3975

FusionGeneSummary for BCAS3_ZMYND8

check button Fusion gene summary
Fusion gene informationFusion gene name: BCAS3_ZMYND8
Fusion gene ID: 3975
HgeneTgene
Gene symbol

BCAS3

ZMYND8

Gene ID

54828

23613

Gene nameBCAS3, microtubule associated cell migration factorzinc finger MYND-type containing 8
SynonymsGAOB1|MAABPRKCBP1|PRO2893|RACK7
Cytomap

17q23.2

20q13.12

Type of geneprotein-codingprotein-coding
Descriptionbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1protein kinase C-binding protein 1CTCL tumor antigen se14-3cutaneous T-cell lymphoma-associated antigen se14-3predicted protein of HQ2893zinc finger MYND domain-containing protein 8
Modification date2018052320180526
UniProtAcc

Q9H6U6

Q9ULU4

Ensembl transtripts involved in fusion geneENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
ENST00000311275, ENST00000360911, 
ENST00000458360, ENST00000262975, 
ENST00000471951, ENST00000352431, 
ENST00000396281, ENST00000446994, 
ENST00000536340, ENST00000355972, 
ENST00000540497, ENST00000461685, 
ENST00000372023, ENST00000468376, 
Fusion gene scores* DoF score40 X 23 X 15=138005 X 5 X 4=100
# samples 475
** MAII scorelog2(47/13800*10)=-4.87586369998789
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCAS3 [Title/Abstract] AND ZMYND8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

HgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

HgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-FD-A43P-01ABCAS3chr17

59161925

+ZMYND8chr20

45891172

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000589222ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000589222ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000589222ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000589222ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000589222ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000589222ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000407086ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000407086ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000407086ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000407086ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000407086ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000390652ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000390652ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000390652ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000390652ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000390652ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000408905ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000408905ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000408905ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000408905ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000408905ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588462ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588462ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588462ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588462ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000588462ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000585744ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000585744ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000585744ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000585744ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000585744ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
In-frameENST00000588874ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588874ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588874ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-intronENST00000588874ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
5CDS-5UTRENST00000588874ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000311275BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000360911BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000458360BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000262975BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000471951BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000352431BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000396281BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000446994BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000536340BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-3CDSENST00000585812ENST00000355972BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-intronENST00000585812ENST00000540497BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-intronENST00000585812ENST00000461685BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-intronENST00000585812ENST00000372023BCAS3chr17

59161925

+ZMYND8chr20

45891172

-
intron-5UTRENST00000585812ENST00000468376BCAS3chr17

59161925

+ZMYND8chr20

45891172

-

Top

FusionProtFeatures for BCAS3_ZMYND8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCAS3

Q9H6U6

ZMYND8

Q9ULU4


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-11241089_10924731169Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-1124838_8544731169Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-10221089_10924731187Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-1022838_8544731187Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-10221089_10924931161Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-1022838_8544931161Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-11241089_10924731215Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-1124838_8544731215Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-10221089_10924681136Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-1022838_8544681136Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-10231089_10924931189Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-1023838_8544931189Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-10231089_10924931235Compositional biasNote=Poly-Ser
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-1023838_8544931235Compositional biasNote=Poly-Gln
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-11241028_10624731169Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-10221028_10624731187Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-10221028_10624931161Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-11241028_10624731215Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-10221028_10624681136Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-10231028_10624931189Zinc fingerMYND-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-10231028_10624931235Zinc fingerMYND-type

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-112443_474731169Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-102243_474731187Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-102243_474931161Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-112443_474731215Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-102243_474681136Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-102343_474931189Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-102343_474931235Compositional biasNote=Poly-Lys
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-1124165_2354731169DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-1124277_3274731169DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-1022165_2354731187DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-1022277_3274731187DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-1022165_2354931161DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-1022277_3274931161DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-1124165_2354731215DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-1124277_3274731215DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-1022165_2354681136DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-1022277_3274681136DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-1023165_2354931189DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-1023277_3274931189DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-1023165_2354931235DomainBromo
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-1023277_3274931235DomainPWWP
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-112488_1334731169Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-102288_1334731187Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-102288_1334931161Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-112488_1334731215Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-102288_1334681136Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-102388_1334931189Zinc fingerPHD-type
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-102388_1334931235Zinc fingerPHD-type


Top

FusionGeneSequence for BCAS3_ZMYND8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1395aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDAVQQ
KEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRR
LRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQ
AHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSD

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1395aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDAVQQ
KEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRR
LRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQ
AHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSD

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1537aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESR

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1491aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1410aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYND
LSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIF
YCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSR

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1519aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1491aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1537aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESR

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1519aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1395aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDAVQQ
KEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRR
LRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQ
AHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSD

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1476aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSW

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1522aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1504aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPST
STITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQ
WLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKS
CTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPA

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1550aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASAS
PASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIE
SCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS
EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGK
TPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQ
KMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAAD
IAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEK
QQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASK
EKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1537aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESR

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1491aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1410aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYND
LSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIF
YCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSR

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1519aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1491aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1537aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESR

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1519aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGST
IAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1565aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKR
QIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNK
KEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVN
ADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQER
DRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSS
SSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWS

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1308aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKA
VQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYP
CQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQ

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1262aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPI
ATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIA
EVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQS
APSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESRLDTFW

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1181aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLV
SSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSL
EQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSS
QGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLP

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1290aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPI
ATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIA
EVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQS
APSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEK

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1336aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKA
VQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYP
CQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQ

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1262aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPI
ATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIA
EVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQS
APSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSSDEKRGSTRSDHNTSTSTKSLLPKESRLDTFW

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1308aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKA
VQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYP
CQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQ

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1290aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPI
ATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIA
EVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQS
APSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEK

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1336aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKA
VQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYP
CQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQ

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1336aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKT
STTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSD
SETISDDEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDK
LKGKDETDSPTVHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATT
STSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKA
VQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAE
IRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYP
CQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQ

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_1293aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTI
TLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLH
QQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQ
SATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSS

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_1247aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYT
SKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD
ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETS

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_1166aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDAVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASAD
VAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQL
ELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETA

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_1275aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYT
SKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD
ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETS
AEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNTSTSTK

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_1321aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTI
TLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLH
QQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQ
SATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAP

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_1247aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYT
SKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD
ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETS

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_1293aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTI
TLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLH
QQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQ
SATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSDHSRSNKSSWSSS

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_1275aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYT
SKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD
ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETS
AEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAPTTTDHQPHPNYPAQKYHSRSNKSSWSSSDEKRGSTRSDHNTSTSTK

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_1321aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTI
TLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLH
QQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQ
SATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAP

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_1321aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASASPASTKTGQAGSLSGSPKPFSPQLSAPITTKTDKTSTTGSILNLNLDRSK
AEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVTTAVEHSDSEDSEKSDSSDSETISDDEQKSKNEP
EDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHLG
LDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKTPPSTTVGSHSPPETPVLTRSSAQTSAAGATATTSTSSTVTVTAPAPAA
TGSPVKKQRPLLPKETAPAVQRVVWNSSSKFQTSSQKWHMQKMQRQQQQQQQQNQQQQPQSSQGTRTQTRQAVKAVQQKEITQSPSTSTI
TLVTSTQSSPLVTSSGSMSTLVSSVNADLPIATASADVAADIAKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLH
QQELSEMKHNLELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQ
SATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKEKETSAEKSKESGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPATAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4185nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAG
AAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATG
AGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAA
ATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGG
CTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATG
CGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACC
AAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAA
GCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTA
AATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAG
AAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4185nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAG
AAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATG
AGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAA
ATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGG
CTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATG
CGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACC
AAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAA
GCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTA
AATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAG
AAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_4611nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_4473nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4230nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTG
ACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACT
GCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGAT
CTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAG
CTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTG
AAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTT
TACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACT
GCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCT
TCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGA
GAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAG
AGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4557nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4473nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4611nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4557nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4185nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAG
AAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATG
AGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAA
ATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGG
CTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATG
CGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACC
AAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAA
GCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTA
AATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAG
AAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4428nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4566nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4512nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4650nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_4611nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_4473nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4230nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTG
ACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACT
GCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGAT
CTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAG
CTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTG
AAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTT
TACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACT
GCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCT
TCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGA
GAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAG
AGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4557nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4473nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4611nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4557nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4695nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_3924nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGT
CAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCT
GTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCG
GGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTAC
ACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAG
ATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATG
GCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTG
GATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCC
TGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACA
GAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACG
TCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAA
GGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_3786nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACC
CTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATC
GCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATAC
AACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAG
CAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCC
GAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCC
ATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCA
GCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCA
GCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGC
TCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGAT
GAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_3543nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACA
CAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTG
TCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCA
ATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAG
ATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTG
GAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAG
TGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCT
GAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCC
CAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAG
AGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGT
AATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_3870nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACC
CTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATC
GCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATAC
AACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAG
CAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCC
GAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCC
ATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCA
GCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCA
GCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGC
TCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACC
ACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAG
AGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4008nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGT
CAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCT
GTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCG
GGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTAC
ACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAG
ATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATG
GCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTG
GATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCC
TGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACA
GAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACG
TCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAA
GGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAG
TACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_3786nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACC
CTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATC
GCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATAC
AACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAG
CAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCC
GAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCC
ATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCA
GCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCA
GCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGC
TCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGAT
GAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_3924nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGT
CAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCT
GTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCG
GGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTAC
ACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAG
ATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATG
GCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTG
GATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCC
TGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACA
GAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACG
TCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAA
GGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_3870nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACC
CTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATC
GCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATAC
AACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAG
CAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCC
GAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCC
ATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCA
GCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCA
GCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGC
TCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACC
ACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAG
AGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4008nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGT
CAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCT
GTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCG
GGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTAC
ACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAG
ATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATG
GCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTG
GATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCC
TGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACA
GAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACG
TCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAA
GGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAG
TACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACG

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4008nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACC
AAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACC
TCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAG
TCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCA
CAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGAT
AGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCA
TCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGAC
CCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAA
CTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAA
GACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCC
ACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACC
AGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAG
ACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGT
CAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCT
GTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCG
GGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTAC
ACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAG
ATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATG
GCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTG
GATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCC
TGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACA
GAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACG
TCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAA
GGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAG
TACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACG

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_3879nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAG
TTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAG
TCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATC
ACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCC
ATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATA
TACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCAC
CAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATC
GCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAG
GCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAG
TCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAA
TCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCT
GGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGT
GATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_3741nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTC
CAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGG
TCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACT
AGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATT
CGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCG
GAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGAT
GAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGC
CAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAA
ACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCA
GCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGC
TCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_3498nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAG
TCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGAT
GTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAAC
ACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATG
AAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTG
GAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGG
AACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAG
GAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCC
AGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCC
TCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACA

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_3825nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTC
CAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGG
TCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACT
AGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATT
CGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCG
GAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGAT
GAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGC
CAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAA
ACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCA
GCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGC
TCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_3963nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAG
TTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAG
TCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATC
ACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCC
ATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATA
TACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCAC
CAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATC
GCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAG
GCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAG
TCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAA
TCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCT
GGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCA
ACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAG
AAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGAC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_3741nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTC
CAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGG
TCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACT
AGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATT
CGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCG
GAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGAT
GAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGC
CAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAA
ACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCA
GCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGC
TCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_3879nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAG
TTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAG
TCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATC
ACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCC
ATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATA
TACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCAC
CAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATC
GCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAG
GCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAG
TCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAA
TCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCT
GGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGT
GATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_3825nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTC
CAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGG
TCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACT
AGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATT
CGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCG
GAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGAT
GAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGC
CAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAA
ACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCA
GCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGC
TCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_3963nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAG
TTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAG
TCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATC
ACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCC
ATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATA
TACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCAC
CAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATC
GCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAG
GCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAG
TCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAA
TCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCT
GGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCA
ACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAG
AAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGAC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_3963nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTC
TCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAA
GCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGC
AGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTA
GAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCA
GAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATT
AAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGAC
TTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGC
CTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAA
GAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACC
CGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCC
ACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAG
TTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAG
TCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATC
ACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCC
ATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATA
TACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCAC
CAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATC
GCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAG
GCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAG
TCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAA
TCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCT
GGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCA
ACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAG
AAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_6181nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGC
AGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGA
AGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGA
GCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAA
TGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGC
TGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGC
GGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCA
AGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAG
CCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAA
ATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGA
AAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACC
ATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGA
GCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCC
AGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCC
CGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAA
TAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGA
AAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTT
AGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGA
ACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCT
ACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGAC
TCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGA
AAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAG
ATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATA
TGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGC
TGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGA
TATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAG
TTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAAT
AGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAAC
TTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_6043nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCA
GCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCT
CAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTT
CTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCT
CCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGA
AGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACT
GCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTC
CTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAG
AAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGA
CGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGG
GATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGT
GAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTT
CAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACT
GCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTT
TTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACA
ACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTT
TCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTT
TCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGAC
ACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAA
CAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGC
TTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGA
GGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGA
GAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAA
AGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCT
CTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAG
AGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGA
AGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGA
CTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTTCTTTACCTTTTTTTAATTAAACTGT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4767nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCAT
CCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCA
ACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAA
CAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGC
TCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGC
GGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCA
ACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGA
AGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCT
CCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGA
CCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCA
GTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTC
GGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAA
CAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACT
ACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGT
CATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAA
AAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4928nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCA
GCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCT
CAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTT
CTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCT
CCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGA
AGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACT
GCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTC
CTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAG
AAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGA
CGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACC
ACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGA
CACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCG
GGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACT
TGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGAC
TGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATAT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_5039nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGC
AGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGA
AGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGA
GCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAA
TGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGC
TGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGC
GGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCA
AGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAG
CCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAA
ATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGA
AAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTA
GCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCC
GGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCC
TCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGC
CAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGC
GGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4816nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCA
GCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCT
CAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTT
CTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCT
CCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGA
AGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACT
GCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTC
CTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAG
AAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGA
CGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGG
GATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGT
GAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTT
CAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACT
GCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTT

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4935nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGC
AGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGA
AGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGA
GCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAA
TGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGC
TGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGC
GGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCA
AGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAG
CCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAA
ATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGA
AAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACC
ATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGA
GCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCC
AGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCC
CGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAA

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4636nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCA
GCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCT
CAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTT
CTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCT
CCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGA
AGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACT
GCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTC
CTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAG
AAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGA
CGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACC
ACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGA
CACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4774nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGC
AGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGA
AGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGA
GCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAA
TGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGC
TGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGC
GGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCA
AGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAG
CCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAA
ATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGA
AAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTA
GCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCC
GGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCC
TCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4774nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGAC
AAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCG
GCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTG
TTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCA
TAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATA
TCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTA
AAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAG
TCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAA
AAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTG
GGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGG
GCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCT
CCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGG
CCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGC
AGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGA
AGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGA
GCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAA
TGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGC
TGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGC
GGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCA
AGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAG
CCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAA
ATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGA
AAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTA
GCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCC
GGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCC
TCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_6161nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAG
CAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCA
TCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTC
AACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGA
ACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAG
CTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAG
CGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCC
AACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATG
AAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGC
TCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCG
ACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCC
AGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCT
CGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAA
ACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACAC
TACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATG
TCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAA
AAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACG
GAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTC
TGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTA
AAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAA
AACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACT
CTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGC
AAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTT
ATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGT
TGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTG
TTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAA
ATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTG
TGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGT
GGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGA

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_6023nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC
AACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACC
CACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAA
CCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACG
AGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTA
ACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGT
ATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCC
TTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATC
AAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCT
TTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCT
CAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACAC
ACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATG
AAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCAT
GCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTA
TATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGC
GAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATT
GCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCT
TTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTT

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4747nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTG
GTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCC
ACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAAC
GATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAA
GAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAG
GTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATC
TTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCT
ACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCA
CCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCC
AGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAG
AAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGAC
TAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAG
CCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGC
TTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTT
CCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAAC
CCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4908nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC
AGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCC
ATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCA
GTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCT
GTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTAT

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_5019nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAG
CAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCA
TCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTC
AACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGA
ACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAG
CTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAG
CGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCC
AACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATG
AAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGC
TCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCG
ACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAA
CCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG
GACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACA
AAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGG
ACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4796nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC
AACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACC
CACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAA
CCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACG
AGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTA

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4915nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAG
CAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCA
TCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTC
AACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGA
ACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAG
CTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAG
CGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCC
AACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATG
AAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGC
TCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCG
ACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCC
AGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCT
CGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAA
ACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACAC
TACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4616nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC
AGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4754nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAG
CAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCA
TCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTC
AACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGA
ACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAG
CTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAG
CGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCC
AACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATG
AAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGC
TCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCG
ACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAA
CCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4754nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGC
AGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAAC
CTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAG
CGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGAT
GTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAG
TCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACA
AACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCT
GAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCA
ACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAAT
AAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAA
ACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCC
CCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGG
AACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAG
CAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCA
TCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTC
AACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGA
ACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAG
CTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAG
CGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCC
AACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATG
AAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGC
TCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCG
ACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAA
CCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_6189nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCA
GCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGT
CCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGG
GTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACAC
TAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGAT
TCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGC
GGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGA
TGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTG
CCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGA
AACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTC
AGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGG
CTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAG
CACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAG
AAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCC
TGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTT
GGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAA
AAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGAT
GGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGG
GAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCC
TTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAA
ATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAG
AACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTT
GGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTAT
TATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACT
ACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAA
TTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTT
CCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAA
AAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTG
TATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_6051nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCT
GGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGC
CACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAA
CGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCA
AGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGA
GGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCAT
CTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGC
TACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGC
ACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTC
CAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGA
GAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGA
CTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACA
GCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGG
CTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTT
TCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAA
CCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGG
GACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGAT
CGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACC
AGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAG
AAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTT
ATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTG
CACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGG
CAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATT
GATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTT
TACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAA
AACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAG
CATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAG
CCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTTCTTTACCTTTTTTTAAT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4775nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACA
GAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTC
CTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAAT
AAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGAT
AGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGA
GCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTG
GTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGA
GCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCA
GGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAG
TGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAA
TAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAA
AGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAA
AGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCT
GCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTT
GTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGA
TTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCA
CACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4936nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCT
GGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGC
CACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAA
CGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCA
AGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGA
GGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCAT
CTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGC
TACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGC
ACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTC
CAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCAC
CACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAG
GGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCA
GTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACT
TTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGA
CTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_5047nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCA
GCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGT
CCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGG
GTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACAC
TAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGAT
TCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGC
GGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGA
TGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTG
CCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGA
AACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTC
AGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGG
CTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTA
CCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAA
GAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAAC
CCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCC
CCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTA
AATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAA

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4824nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCT
GGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGC
CACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAA
CGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCA
AGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGA
GGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCAT
CTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGC
TACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGC
ACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTC
CAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGA
GAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGA
CTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACA
GCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGG
CTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4943nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCA
GCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGT
CCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGG
GTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACAC
TAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGAT
TCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGC
GGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGA
TGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTG
CCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGA
AACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTC
AGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGG
CTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAG
CACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAG
AAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCC
TGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTT

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4644nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCT
GGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGC
CACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAA
CGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCA
AGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGA
GGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCAT
CTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGC
TACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGC
ACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTC
CAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCAC
CACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAG
GGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCA

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4782nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCA
GCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGT
CCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGG
GTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACAC
TAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGAT
TCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGC
GGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGA
TGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTG
CCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGA
AACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTC
AGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGG
CTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTA
CCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAA
GAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAAC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4782nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAA
GACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTC
CACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTC
CACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACA
ATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAG
TGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATC
TGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCC
TGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACT
GAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGA
CCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCAC
GACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAG
CACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGAC
TGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCA
GCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGT
CCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGG
GTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACAC
TAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGAT
TCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGC
GGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGA
TGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTG
CCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGA
AACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTC
AGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGG
CTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTA
CCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAA
GAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAAC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_6113nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC
AACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACC
CACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAA
CCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACG
AGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTA
ACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGT
ATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCC
TTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATC
AAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCT
TTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCT
CAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACAC
ACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATG
AAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCAT
GCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTA
TATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGC
GAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATT
GCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCT
TTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_5975nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG
GACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACA
AAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGG
ACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTG
AATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAA
AAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGG
ATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACG
CAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGC
AAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAAT
ATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAA
AAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGAC
TCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAA
GCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTA
AAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTAC
ATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGA
GAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGC
ATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTT
TCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTTCTT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4699nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAG
AAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATG
AGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAA
ATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGG
CTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATG
CGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACC
AAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAA
GCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTA
AATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAG
AAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGAC
CATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAG
AGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACC
CAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCC
CCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAA
ATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAG
AAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGT
TAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4860nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC
TTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCA
GGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCC
AGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTA
GAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAA

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4971nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC
AGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCC
ATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCA
GTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCT
GTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTAT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4748nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGG
AGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTG
GACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACA
AAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGG
ACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4867nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCAC
AACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACC
CACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAA
CCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACG
AGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTA

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4568nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACG
TCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCT
GACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATG
ACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAG
TGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGAC
CGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGC
AAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCC
TGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCG
AGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTT
GACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCC
TATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGC
AGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4706nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC
AGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4706nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCA
CCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAA
ACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCG
GTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAG
AGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCA
GATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATG
GACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGC
GAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCC
ATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATA
GATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAA
ACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCC
ACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTT
TTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAG
AAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG
GCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTG
GTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGAT
ATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGC
ACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTA
GAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAG
CAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTAC
TGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCT
GAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAA
GAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTA
GGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTAC
CCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACC
AGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_6158nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG
CTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACA
ACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTAC
AGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCA
TTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAA
AAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAA
TGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGT
ACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAA
CGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAAC
AATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTG
AAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAG
GACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATG
TAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGT
GTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTG
TACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATA
AGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGA
AGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGT
GTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_6020nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC
ACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCAC
CCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCC
TCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGC
CCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACT
TATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATT
GGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTG
GATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAG
CCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTC
ATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAG
TCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACT
CACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAG
CATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCT
GTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATAT
GAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAA
CTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCA
GTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTG
TATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4744nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTG
ACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACT
GCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGAT
CTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAG
CTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTG
AAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTT
TACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACT
GCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCT
TCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGA
GAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAG
AGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAG
CAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCA
CTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTT
GACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCC
CTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCC
AACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4905nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT
ACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATT
GGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTT
GAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTG
CTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAA

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_5016nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC
ACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAG
GCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACA
CCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAAT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4793nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAAC
ACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCAC
CCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCC
TCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGC
CCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4912nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGT
TGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGG
CTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACA
ACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTAC
AGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCA

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4613nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTC
ACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATT
GCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACA
ATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAG
CTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAG
CAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGT
GACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAG
GTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAG
AAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGC
TCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCC
GCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGT
ACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4751nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4751nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGC
CCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTG
GATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGC
CAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTC
TATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCT
AAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAAC
CCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAG
CCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACA
GTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAG
AAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACA
CCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCG
GCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAAC
TCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAG
CAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCC
ACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAAC
GCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACA
ATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTC
CAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGG
GACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAAC
TGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAG
TCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCC
TCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACC
CTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCT
GCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGC
AGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGAC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_5574nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCA
GAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACA
GGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCT
GGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGA
TATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAG
CACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTT
AGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAA
GCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTA
CTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGC
TGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAA
AGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTT
AGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCA
CAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCAC
CCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAA
ACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACAC
GAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTT
AACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGG
TATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATC
CTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCAT
CAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTC
TTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGC
TCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACA
CACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGAT
GAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCA
TGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGT
ATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATG
CGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAAT
TGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTC
TTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTT

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_5436nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCAC
GTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGC
TGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAAT
GACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCA
GTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGA
CCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTG
CAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTC
CTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTC
GAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCT
TGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTG
GAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCT
GGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAAC
AAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAG
GACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATT
GAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAA
AAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATG
GATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTAC
GCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACG
CAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAA
TATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAA
AAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGA
CTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTA
AGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGT
AAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTA
CATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAG
AGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAG
CATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGT
TTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTTCT

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4160nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCA
GAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCAT
GAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAA
AATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAG
GCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGAT
GCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGAC
CAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCA
AGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACT
AAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGA
GAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGA
CCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAA
GAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAAC
CCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCC
CCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTA
AATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAA
GAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAG
TTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4321nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCAC
GTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGC
TGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAAT
GACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCA
GTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGA
CCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTG
CAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTC
CTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTC
GAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCT
TGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGC
CTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAG
CAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACAC
CTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGC
AGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACC
CAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCT
AGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAA

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4432nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCA
GAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACA
GGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCT
GGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGA
TATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAG
CACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTT
AGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAA
GCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTA
CTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGC
TGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAA
AGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTT
AGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTA
CCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACAC
CAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCC
CATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTC
AGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCC
TGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTA

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4209nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCAC
GTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGC
TGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAAT
GACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCA
GTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGA
CCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTG
CAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTC
CTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTC
GAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCT
TGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTG
GAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCT
GGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAAC
AAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAG
GACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATT

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4328nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCA
GAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACA
GGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCT
GGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGA
TATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAG
CACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTT
AGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAA
GCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTA
CTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGC
TGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAA
AGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTT
AGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCA
CAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCAC
CCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAA
ACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACAC
GAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTT

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4029nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCAC
GTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGC
TGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAAT
GACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCA
GTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGA
CCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTG
CAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTC
CTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTC
GAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCT
TGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGC
CTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAG
CAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACAC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4167nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCA
GAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACA
GGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCT
GGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGA
TATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAG
CACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTT
AGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAA
GCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTA
CTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGC
TGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAA
AGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTT
AGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTA
CCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACAC
CAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4167nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTC
ACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAAAGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAA
AACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATCGAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTC
GGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGATTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGA
GAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATACGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTC
AGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGAACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGAT
GGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAGTGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAG
CGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTGAGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCC
CATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCCATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCAT
AGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGGAACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAA
AACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGGTGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGC
CACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCCCCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCT
TTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCA
GAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACA
GGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCT
GGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGA
TATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAG
CACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTT
AGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAA
GCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTA
CTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGC
TGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAA
AGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTT
AGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTA
CCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACAC
CAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000311275_chr20_45891172_-_5614nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGC
AGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGT
CCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTG
ACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGA
CAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGT
GGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACC
GGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCA
AGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCT
GCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGA
GCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTG
ACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGA
GCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGG
ACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAA
AGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGA
CACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGA
ATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAA
AAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGA
TACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATACCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGC
AGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGTTGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCA
AGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGTGATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATA
TCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCACAGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAA
AAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACACACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACT
CAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATGTACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAG
CATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCCGTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAA
AACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGAAAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACA
TTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGTACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAG
AGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTGTCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCA
TAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTT
CTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTGCCCGTTCCTTCCCCCACCCCCCCAGTTTTTTCAGATTTCTTT

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000360911_chr20_45891172_-_5476nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCA
GCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCA
AGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAG
CTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGA
CCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGG
CGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACT
ACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGA
ACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGG
AGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCA
ACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCA
GTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCA
TTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAG
TTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTG
TGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATT
AAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACAACAAAAAAGAATGTTTTGGTATTGGAG
AAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTTTCATACTCACGTCCTCATCCTTGGATA
CCCAGGGGAGGGCGAACCGTTTTCGCTCGTGTGTCTGTACGCAGCATGTTGGGATCGGGAGTTTCGGCACAGACTATCCCATCAAGCCGT
TGGCTCCTTTCAGCTACTACGTTACCACGTTCCTAAAACGCAAGCTCTCCGGACCAGACGGACACAGGGAGAAGCTAGTTTCTTTCATGT
GATTGAAATGATGACTCTACTCCTAAAAGGGAAAAAACAATATCCTTGTTTACAGAAGAGAAACAAACAAGCCCCACTCAGCTCAGTCAC
AGGAGAGAACACAGAAAGTCTTAGGATCATGAACTCTGAAAAAAAGAGAAACCTTATCTTTGCTTTGTGGTTCCTTTAAACACACTCACA
CACACTTGGTCAGAGATGCTGTGCTTCTTGGAAGCAAGGACTCAAAGGCAAGGTGCACGCAGAGGACGTTTGAGTCTGGGATGAAGCATG
TACGTATTATTTATATGATGGAATTTCACGTTTTTATGTAAGCATGAAACACAGGCAGTATGAGAGAAAGCAAGGCCCGTCATGCTGTCC
GTACACTACGTATGCTGTAGAGCCATTTTGTATGTTGTGTAAAACAAAAAGCATTGATGAAAAAGCAAAAGGTGATGTATGTATATGAGA
AAATTAATTGTACGATATCATTCCAGTACGTTTTGTTGTACATTTTAGTCTTGTTTACTTTCTCTTCATTGTTAAGAGGATGCGAACTGT
ACAGTTTCCAGCTAGTTACCCATATTAGAGAAGAAATAAGAGAGTATTAGAAGAAAACAGGAGAGAAAGAACATTTGTGAATTGCAGTTG
TCAAAAAAAAAAAATAGCCTAGCTGGCCTTATTTGTGAAGCATAATTGCTTTTAGCATATGGAAGTATTTTTTCACATTTTCTTTGTATA
AAATTTGTATTAAACTTAAATATCTTTTTGATGGTGGTGTTTCTTTGTGACTGAGCCAGTAGACTCACACTATATGCTTTTTTGGGTTTG

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000458360_chr20_45891172_-_4200nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCA
GCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCT
CAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTT
CTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCT
CCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGA
AGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACT
GCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTC
CTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAG
AAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGA
CGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGG
GATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGT
GAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTT
CAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACT
GCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTT
TTATATTTGTATTAACTTTAACTTATTAAAAAAAAAAAAAGAAAAAGAAAAACGATTTAAAAAAAAAAAAAAAAGCAACCAACCCCAACA
ACAAAAAAGAATGTTTTGGTATTGGAGAAGGGATGGTCAGTTAGCCTGTCTGTCACACGACGGAATGGATACTGGGCCCGGGGACCACTT

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000262975_chr20_45891172_-_4361nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCA
GCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCA
AGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAG
CTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGA
CCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGG
CGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACT
ACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGA
ACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGG
AGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCA
ACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCC
AGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCA
GCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGA
GAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGC
CTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTT
TGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATTAAAAAA

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000471951_chr20_45891172_-_4472nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGC
AGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGT
CCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTG
ACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGA
CAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGT
GGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACC
GGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCA
AGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCT
GCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGA
GCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTG
ACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCT
ATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCA
GTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCT
TCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAG
GAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCA
GCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAG

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000352431_chr20_45891172_-_4249nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCA
GCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCA
AGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAG
CTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGA
CCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGG
CGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACT
ACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGA
ACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGG
AGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCA
ACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCA
GTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCA
TTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAAAGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAG
TTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGACACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTG
TGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGAATCTAGAGGACTTTCCCCTTTTTATATTTGTATTAACTTTAACTTATT

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000396281_chr20_45891172_-_4368nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGC
AGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGT
CCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTG
ACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGA
CAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGT
GGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACC
GGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCA
AGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCT
GCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGA
GCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTG
ACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGACCATTCCCGGAGTAATAAATCCAGTTGGA
GCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGG
ACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGAGAAAAACCCAGACGCCAGGAAAAGAAGAAACAACAA
AGGCAGGAGAACAGCCACTTTCAGACTTGAAAATGACAAAACCCTCAGTTGAGCCTGAGCCCCCGGCGCGGGGGCTGCTACACTACAGGA
CACCCAGCATCGGCTTTGACTGCAGACTGTTCACCCACACGAGCCCTGTGCTTTTGGTGTAAATAATGTACAATTTGTGGATGTCATTGA

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000446994_chr20_45891172_-_4069nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAACTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGTCCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCA
GCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTGACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCA
AGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGACAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAG
CTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGTGGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGA
CCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACCGGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGG
CGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCAAGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACT
ACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCTGCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGA
ACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGAGCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGG
AGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTGACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCA
ACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCTATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCC
AGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCAGTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCA
GCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCTTCTGGGACTAGCAGTGAATCGGGACACAAACCACCCACCCCATTGGGA

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000536340_chr20_45891172_-_4207nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGC
AGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGT
CCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTG
ACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGA
CAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGT
GGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACC
GGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCA
AGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCT
GCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGA
GCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTG
ACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCT
ATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCA
GTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCT

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_ZMYND8_ENST00000355972_chr20_45891172_-_4207nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGCTTCACCAGCCTCCACCAAGACGGGACAAGCAGGGAGTTTATCCGGCAGCCCAA
AGCCCTTCTCTCCTCAACTGTCAGCTCCTATCACGACGAAAACGGACAAAACCTCCACCACCGGCAGCATCCTGAATCTTAACCTGGATC
GAAGCAAAGCTGAGATGGATTTGAAGGAGCTGAGCGAGTCGGTCCAGCAACAGTCCACCCCTGTTCCTCTCATCTCTCCCAAGCGCCAGA
TTCGTAGCAGGTTCCAGCTGAATCTTGACAAGACCATAGAGAGTTGCAAAGCACAATTAGGCATAAATGAAATCTCGGAAGATGTCTATA
CGGCCGTAGAGCACAGCGATTCGGAGGATTCTGAGAAGTCAGATAGTAGCGATAGTGAGTATATCAGTGATGATGAGCAGAAGTCTAAGA
ACGAGCCAGAAGACACAGAGGACAAAGAAGGTTGTCAGATGGACAAAGAGCCATCTGCTGTTAAAAAAAAGCCCAAGCCTACAAACCCAG
TGGAGATTAAAGAGGAGCTGAAAAGCACGTCACCAGCCAGCGAGAAGGCAGACCCTGGAGCAGTCAAGGACAAGGCCAGCCCTGAGCCTG
AGAAGGACTTTTCCGAAAAGGCAAAACCTTCACCTCACCCCATAAAGGATAAACTGAAGGGAAAAGATGAGACGGATTCCCCAACAGTCC
ATTTGGGCCTGGACTCTGATTCAGAGAGCGAACTTGTCATAGATTTAGGAGAAGACCATTCTGGGCGGGAGGGTCGAAAAAATAAGAAGG
AACCCAAAGAACCATCTCCCAAACAGGATGTTGTAGGTAAAACTCCACCATCCACGACGGTGGGCAGCCATTCTCCCCCGGAAACACCGG
TGCTCACCCGCTCTTCCGCCCAAACTTCCGCGGCTGGCGCCACAGCCACCACCAGCACGTCCTCCACGGTCACCGTCACGGCCCCGGCCC
CCGCCGCCACAGGAAGCCCAGTGAAAAAGCAGAGGCCGCTTTTACCGAAGGAGACTGCCCCGGCCGTGCAGCGGGTCGTGTGGAACTCAT
CAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAAAACCAGCAGCAGC
AGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAGCTGTCCAGCAGAAGGAGATCACACAGAGCCCATCCACGT
CCACCATCACCCTGGTGACCAGCACACAGTCATCGCCCCTGGTCACCAGCTCGGGGTCCATGAGCACCCTTGTGTCCTCAGTCAACGCTG
ACCTGCCCATCGCCACTGCCTCAGCTGATGTCGCCGCTGATATTGCCAAGTACACTAGCAAAATGATGGATGCAATAAAAGGAACAATGA
CAGAAATATACAACGATCTTTCTAAAAACACTACTGGAAGCACAATAGCTGAGATTCGCAGGCTGAGGATCGAGATAGAGAAGCTCCAGT
GGCTGCACCAGCAAGAGCTCTCCGAAATGAAACACAACTTAGAGCTGACCATGGCGGAGATGCGGCAGAGCCTGGAGCAGGAGCGGGACC
GGCTCATCGCCGAGGTGAAGAAGCAGCTGGAGTTGGAGAAGCAGCAGGCGGTGGATGAGACCAAGAAGAAGCAGTGGTGCGCCAACTGCA
AGAAGGAGGCCATCTTTTACTGCTGTTGGAACACTAGCTACTGTGACTACCCCTGCCAGCAAGCCCACTGGCCTGAGCACATGAAGTCCT
GCACCCAGTCAGCTACTGCTCCTCAGCAGGAAGCGGATGCTGAGGTGAACACAGAAACACTAAATAAGTCCTCCCAGGGGAGCTCCTCGA
GCACACAATCAGCACCTTCAGAAACGGCCAGCGCCTCCAAAGAGAAGGAGACGTCAGCTGAGAAAAGCAAGGAGAGTGGCTCGACCCTTG
ACCTTTCTGGCTCCAGAGAGACGCCCTCCTCCATTCTCTTAGGCTCCAACCAAGGCTCTGTTAGCAAAAGGTGTGACAAGCAACCTGCCT
ATGCCCCAACCACCACAGACCACCAGCCGCACCCCAACTACCCCGCCCAGAAGTACCATTCCCGGAGTAATAAATCCAGTTGGAGCAGCA
GTGATGAGAAGAGGGGATCGACACGTTCCGATCACAACACCAGTACCAGCACGAAGAGCCTCCTCCCGAAAGAGTCTCGGCTGGACACCT


Top

FusionGenePPI for BCAS3_ZMYND8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2BZMYND8FHOD1, E2F6, SMARCA4, INTS1, INTS3, INTS5, INTS6, BCL6, CSNK1E, ATN1, RERE, USP7, SUPT4H1, ZFYVE9, SOX2, HDAC1, PBXIP1, ZBTB7A, HECW2, KCTD17, CSNK2A2, CHD4, HDAC2, KRAS, PSMD5, RBBP7, TSPYL1, MBD2, MTA1, MTA2, ZNF592, CHERP, MGA, CDK2AP1, RBM8A, ZNF687, VWA9, KDM5C, RPS27L, ZCCHC17, ESF1, MBD3, GATAD2A, ZNF532, DDX24, GATAD2B, MTA3, TSPYL2, FOXJ2, P4HA3, LLGL2, ZNF408


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-11241147_11864731169PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-10221147_11864731187PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-10221147_11864931161PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-11241147_11864731215PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-10221147_11864681136PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-10231147_11864931189PRKCB1
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-10231147_11864931235PRKCB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-112475_4064731169histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-102275_4064731187histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-102275_4064931161histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-112475_4064731215histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-102275_4064681136histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-102375_4064931189histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-102375_4064931235histone H3K14ac
TgeneZMYND8chr17:59161925chr20:45891172ENST00000262975-112475_2684731169histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000311275-102275_2684731187histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000352431-102275_2684931161histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000355972-112475_2684731215histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000360911-102275_2684681136histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000461685-102375_2684931189histone H3K4me0
TgeneZMYND8chr17:59161925chr20:45891172ENST00000471951-102375_2684931235histone H3K4me0


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCAS3_ZMYND8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCAS3_ZMYND8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource