FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3965

FusionGeneSummary for BCAS3_SCN4A

check button Fusion gene summary
Fusion gene informationFusion gene name: BCAS3_SCN4A
Fusion gene ID: 3965
HgeneTgene
Gene symbol

BCAS3

SCN4A

Gene ID

54828

6329

Gene nameBCAS3, microtubule associated cell migration factorsodium voltage-gated channel alpha subunit 4
SynonymsGAOB1|MAABCMS16|HOKPP2|HYKPP|HYPP|NAC1A|Na(V)1.4|Nav1.4|SkM1
Cytomap

17q23.2

17q23.3

Type of geneprotein-codingprotein-coding
Descriptionbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1sodium channel protein type 4 subunit alphaCTC-264K15.6skeletal muscle sodium channel alpha subunitskeletal muscle voltage-dependent sodium channel type IV alpha subunitsodium channel protein skeletal muscle subunit alphasodium channel protein type I
Modification date2018052320180523
UniProtAcc

Q9H6U6

P35499

Ensembl transtripts involved in fusion geneENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
ENST00000435607, ENST00000578147, 
Fusion gene scores* DoF score40 X 23 X 15=138004 X 4 X 3=48
# samples 478
** MAII scorelog2(47/13800*10)=-4.87586369998789
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/48*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BCAS3 [Title/Abstract] AND SCN4A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

HgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

HgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDESCATCGA-L5-A8NL-01ABCAS3chr17

59161925

+SCN4Achr17

62038791

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000589222ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000589222ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000407086ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000407086ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000390652ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000390652ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000408905ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000408905ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000588462ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000588462ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000585744ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000585744ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000588874ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
In-frameENST00000588874ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-
intron-3CDSENST00000585812ENST00000435607BCAS3chr17

59161925

+SCN4Achr17

62038791

-
intron-3CDSENST00000585812ENST00000578147BCAS3chr17

59161925

+SCN4Achr17

62038791

-

Top

FusionProtFeatures for BCAS3_SCN4A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCAS3

Q9H6U6

SCN4A

P35499

This protein mediates the voltage-dependent sodium ionpermeability of excitable membranes. Assuming opened or closedconformations in response to the voltage difference across themembrane, the protein forms a sodium-selective channel throughwhich Na(+) ions may pass in accordance with their electrochemicalgradient. This sodium channel may be present in both denervatedand innervated skeletal muscle. {ECO:0000269|PubMed:15318338,ECO:0000269|PubMed:16890191}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241727_17565351837DomainIQ
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241231_12525351837IntramembranePore-forming
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241522_15445351837IntramembranePore-forming
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924747_7675351837IntramembranePore-forming
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241013_13265351837RepeatIII
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241335_16335351837RepeatIV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924560_8325351837RepeatII
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241051_10635351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241083_10965351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241116_11235351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241143_11595351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241180_12305351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241253_12695351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241292_13545351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241373_13835351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241403_14145351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241433_14455351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241463_14815351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241500_15215351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241545_15745351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241598_18365351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924598_6085351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924629_6425351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924663_6645351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924683_6985351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924718_7465351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924768_7805351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924802_10325351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241033_10505351837TransmembraneHelical%3B Name%3DS1 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241064_10825351837TransmembraneHelical%3B Name%3DS2 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241097_11155351837TransmembraneHelical%3B Name%3DS3 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241124_11425351837TransmembraneHelical%3B Name%3DS4 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241160_11795351837TransmembraneHelical%3B Name%3DS5 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241270_12915351837TransmembraneHelical%3B Name%3DS6 of repeat III
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241355_13725351837TransmembraneHelical%3B Name%3DS1 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241384_14025351837TransmembraneHelical%3B Name%3DS2 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241415_14325351837TransmembraneHelical%3B Name%3DS3 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241446_14625351837TransmembraneHelical%3B Name%3DS4 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241482_14995351837TransmembraneHelical%3B Name%3DS5 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241575_15975351837TransmembraneHelical%3B Name%3DS6 of repeat IV
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924579_5975351837TransmembraneHelical%3B Name%3DS1 of repeat II
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924609_6285351837TransmembraneHelical%3B Name%3DS2 of repeat II
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924643_6625351837TransmembraneHelical%3B Name%3DS3 of repeat II
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924665_6825351837TransmembraneHelical%3B Name%3DS4 of repeat II
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924699_7175351837TransmembraneHelical%3B Name%3DS5 of repeat II
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924781_8015351837TransmembraneHelical%3B Name%3DS6 of repeat II

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924392_4165351837IntramembranePore-forming
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924113_4545351837RepeatI
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924151_1575351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924179_1925351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-9241_1315351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924211_2165351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924234_2525351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924273_3915351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924417_4235351837Topological domainExtracellular
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924445_5785351837Topological domainCytoplasmic
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924132_1505351837TransmembraneHelical%3B Name%3DS1 of repeat I
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924158_1785351837TransmembraneHelical%3B Name%3DS2 of repeat I
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924193_2105351837TransmembraneHelical%3B Name%3DS3 of repeat I
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924217_2335351837TransmembraneHelical%3B Name%3DS4 of repeat I
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924253_2725351837TransmembraneHelical%3B Name%3DS5 of repeat I
TgeneSCN4Achr17:59161925chr17:62038791ENST00000435607-924424_4445351837TransmembraneHelical%3B Name%3DS6 of repeat I


Top

FusionGeneSequence for BCAS3_SCN4A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_2125aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTV
GNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGN
LTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLV
VLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEP
PEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKP
PEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIR
TILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNA
LLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVAT
FKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQ
KPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFV
VVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESG
IDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFN
VATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSG
EMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGH

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_2125aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTV
GNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGN
LTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLV
VLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEP
PEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKP
PEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIR
TILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNA
LLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVAT
FKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQ
KPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFV
VVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESG
IDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFN
VATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSG
EMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGH

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_2110aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLE
MMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPH
RRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASEL
EEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVL
KLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV
GMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSA
DSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHM
GLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEG
EQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFI
MEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVC
LIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSR
EKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVT
DLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLI
QKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSII
CLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDF
EMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMA
ANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGE

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_2125aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTV
GNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGN
LTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLV
VLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEP
PEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKP
PEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIR
TILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNA
LLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVAT
FKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQ
KPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFV
VVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESG
IDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFN
VATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSG
EMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGH

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_2125aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLTSLRTGEMVKS
IQFKTPITDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCTPCPGPNMNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVI
SAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPR
VVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPR
PLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVS
DRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTV
GNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGN
LTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLV
VLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEP
PEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKP
PEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIR
TILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNA
LLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVAT
FKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQ
KPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFV
VVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESG
IDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFN
VATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSG
EMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGH

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_1896aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNII
HLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLAN
VQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSF
LIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLL
GLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEES
DLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLR
RACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIIS
LVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDIS
EVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFI
GVIIDNFNQQKKKLGGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLK
VDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTL
LFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPG
TSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPL
RIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRH
LLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGEAGDAGPTMGLMPISPSDTAWPPAPPPGQTVRPGV

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_1896aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSR
SWFANNAGLKREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAA
DAVQTTQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHG
PSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNII
HLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLAN
VQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSF
LIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLL
GLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEES
DLEMPTEEETDTFSEPEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLR
RACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIIS
LVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDIS
EVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFI
GVIIDNFNQQKKKMRGKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLK
VDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTL
LFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPG
TSVKGDCGNPSIGICFFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPL
RIAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRH
LLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMTGHENGNSSSPSPEEKGEAGDAGPTMGLMPISPSDTAWPPAPPPGQTVRPGV

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_1881aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITI
CIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRV
FKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETM
WDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIML
SLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSE
PEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETF
IVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIK
SLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTG
QVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLG
GKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIF
TGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIG
LLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGIC
FFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDL
PMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRH

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_1881aa
MNPIALGSRWLATAENKLIRCHQSRGGACGDNIQSTTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGII
TVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLTTLHRGETEAKVQ
DICFSHDCRWVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLN
SQDSTNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQ
SKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVP
PGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDD
LDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASELEEAHQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITI
CIVLNTLFMAMEHYPMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYETFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRV
FKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETM
WDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIML
SLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSE
PEDSKKPPQPLTDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFKIVEHNWFETF
IVFMILLSSGALAFEDIYIEQRRVIRTILETADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIK
SLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISEVNNKSECESLMHTG
QVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMTAAVDSREKEEQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMR
GKDIFMTEEQKKYTNAMKKLGSKKPQKPIPRPQNKIQGMVTDLVTKQAFDITIMILICLNMVTMMVETDNQSQLKVDILYNINMIFIIIF
TGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIG
LLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENPGTSVKGDCGNPSIGIC
FFCSTIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDL
PMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_6375nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_6375nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_6330nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_6375nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_6375nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_5688nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCAC
CAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATC
CACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCC
ATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCC
ATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAAC
GTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAG
ATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTG
TTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTC
CTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTC
TTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCA
GCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTG
GGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGG
GAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGAC
GGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCC
GACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAAC
TCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAG
GAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGC
AGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAG
GACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTG
CTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGC
TTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCC
CGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGG
CTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCC
GAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGT
CTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAG
CAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATT
GGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAAC
GCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACG
AAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAG
GTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTAC
TTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTC
GTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTG
CTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATG
TCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAG
ATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGC
ACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAAC
ATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTAC
GAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTG
AGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTT
GCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCC
AAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCAC
CTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTG
CTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCC
GGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_5688nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCC
CCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGG
TCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTAT
GGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCG
CCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCA
GATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGT
TTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGG
ATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGT
CCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCC
GTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCAC
CAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATC
CACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCC
ATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCC
ATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAAC
GTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAG
ATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTG
TTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTC
CTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTC
TTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCA
GCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTG
GGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGG
GAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGAC
GGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCC
GACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAAC
TCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAG
GAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGC
AGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAG
GACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTG
CTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGC
TTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCC
CGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGG
CTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCC
GAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGT
CTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAG
CAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATT
GGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAAC
GCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACG
AAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAG
GTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTAC
TTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTC
GTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTG
CTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATG
TCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAG
ATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGC
ACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAAC
ATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTAC
GAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTG
AGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTT
GCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCC
AAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCAC
CTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTG
CTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCC
GGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_5643nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTC
ATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATC
TGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTC
TTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGAC
AGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTC
TTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTG
CTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGAC
TGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATG
TGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTG
TTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATC
GGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTC
AGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGAC
CTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAAC
AACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAG
CCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGAC
CCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTAC
GTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTC
ATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAA
TATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCC
TGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAA
TCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCC
ATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTC
TACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGC
CAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGG
ATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTC
ATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGG
GGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCC
CGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAAC
ATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTC
ACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTG
TCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGG
CGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGC
CTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATG
TTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTC
AACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGC
TTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAG
GAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCC
TACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTG
CCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCC
CTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCAC
GAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCAC
AGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAAC
AGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_5643nt
ATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGA
GACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAG
CTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATC
ACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCC
CATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTC
CAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAG
GACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGC
CAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAA
GAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAAC
AGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTT
GCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCG
ATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAG
TCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACT
GCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAA
TTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCC
CCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCC
CAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAA
ACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGAT
CTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGA
GTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTC
ATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATC
TGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTC
TTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGAC
AGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTC
TTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTG
CTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGAC
TGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATG
TGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTG
TTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATC
GGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTC
AGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGAC
CTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAAC
AACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAG
CCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGAC
CCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTAC
GTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTC
ATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAA
TATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCC
TGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAA
TCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCC
ATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTC
TACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGC
CAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGG
ATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTC
ATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGG
GGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCC
CGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAAC
ATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTC
ACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTG
TCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGG
CGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGC
CTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATG
TTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTC
AACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGC
TTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAG
GAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCC
TACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTG
CCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCC
CTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCAC
GAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCAC
AGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAAC
AGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8615nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCC
CACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCG
TCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGC
ACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCT
ACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGAC
TGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCA
ATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGA
GCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCT
TCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGG
TCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATG
AGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGC
ATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCC
CCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCAT
CCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGA
TGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCT
GCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCA
CTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCT
TCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACA
TTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGG
TGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCA
ACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGG
GCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCA
GCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACA
ACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACC
TCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGT
ACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCA
TTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGA
AGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCT
TCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCC
TGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTG
GCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCA
CGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCC
TCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTG
CCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGT
CGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCA
AGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCG
CCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGG
AGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCA
AGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCA
AAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCT
ACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGC
GCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACA
CCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTA
TGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTC
TTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGG
AGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCG
TTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTC
TGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGC
CTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCA
GCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCT
TCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGC
CACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCC
TAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCA
GCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCT
CTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGT
CTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGC
AGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGG
CAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCT
GTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGT
GTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGT
ACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGT
GTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGAT
TAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATG
CCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCC
CTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGC
CTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCT
GGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGT
AGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCC

>In-frame_BCAS3_ENST00000589222_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8615nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTT
ATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCT
TTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGA
TTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAA
GTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTA
ATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATT
CTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCA
CAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATA
CTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTA
CTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTT
TCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCA
GCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCT
CTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAG
TTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTG
CAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAG
TGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCA
GCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTAC
AGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTG
ACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCAC
AGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACA
CGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGC
CAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCC
CACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCG
TCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGC
ACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCT
ACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGAC
TGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCA
ATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGA
GCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCT
TCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGG
TCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATG
AGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGC
ATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCC
CCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCAT
CCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGA
TGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCT
GCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCA
CTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCT
TCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACA
TTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGG
TGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCA
ACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGG
GCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCA
GCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACA
ACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACC
TCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGT
ACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCA
TTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGA
AGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCT
TCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCC
TGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTG
GCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCA
CGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCC
TCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTG
CCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGT
CGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCA
AGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCG
CCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGG
AGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCA
AGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCA
AAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCT
ACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGC
GCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACA
CCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTA
TGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTC
TTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGG
AGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCG
TTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTC
TGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGC
CTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCA
GCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCT
TCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGC
CACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCC
TAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCA
GCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCT
CTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGT
CTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGC
AGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGG
CAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCT
GTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGT
GTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGT
ACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGT
GTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGAT
TAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATG
CCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCC
CTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGC
CTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCT
GGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGT
AGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCC

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8595nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGC
GCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGAC
CTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACT
GTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGT
TGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTC
CGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGT
AACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGC
AAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAG
TGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTT
GTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAAC
CTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCC
AAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAG
CCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCAC
CTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACC
GACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAG
CCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGC
TGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAAC
TGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATT
CGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTG
TACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAG
CTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAAC
GCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTG
TTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGC
CTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCC
ACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATG
TACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAG
AAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCT
CAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATC
CTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATC
TTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTC
GTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGC
CTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCC
CTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCG
GGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTC
CTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCC
TCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTC
AATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCC
ACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTC
ATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCT
GGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACC
CTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCC
TACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGC
CACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGC
CCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCG
GGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACT
GTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATG
GGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGT
CGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTT
GCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTA
ACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCA
GGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTG
GGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAA
GGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGC
CTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCG
TGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCAC
CTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGG
TTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGG
CTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTT
TTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATG
CACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTG
TGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGT
GTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAA
AACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGT
TGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTT
CTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTT
CCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGC
CCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCT
CTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGG

>In-frame_BCAS3_ENST00000407086_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8595nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTAC
TGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAA
CGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCA
TGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGT
GGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGG
AAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTG
GTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTG
GCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCAT
GACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACT
GAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATC
AACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTG
GAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTG
CATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATG
GTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATT
TCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAA
AGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCG
CGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACC
CCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTT
GCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGAT
GAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATC
CATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGAT
TTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTC
TCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGC
GCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGAC
CTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACT
GTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGT
TGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTC
CGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGT
AACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGC
AAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAG
TGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTT
GTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAAC
CTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCC
AAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAG
CCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCAC
CTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACC
GACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAG
CCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGC
TGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAAC
TGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATT
CGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTG
TACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAG
CTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAAC
GCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTG
TTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGC
CTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCC
ACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATG
TACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAG
AAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCT
CAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATC
CTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATC
TTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTC
GTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGC
CTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCC
CTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCG
GGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTC
CTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCC
TCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTC
AATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCC
ACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTC
ATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCT
GGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACC
CTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCC
TACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGC
CACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGC
CCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCG
GGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACT
GTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATG
GGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGT
CGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTT
GCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTA
ACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCA
GGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTG
GGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAA
GGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGC
CTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCG
TGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCAC
CTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGG
TTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGG
CTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTT
TTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATG
CACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTG
TGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGT
GTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAA
AACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGT
TGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTT
CTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTT
CCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGC
CCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCT
CTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGG

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8623nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCA
AAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCA
CCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCAT
GACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCAT
GGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGT
ACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGAT
CATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTT
TGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCT
CATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTT
CCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGC
CTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGG
GCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGA
GACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGG
CCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGA
CCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTC
GTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGA
GTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAG
GGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGA
CATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCT
CAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTT
GGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCG
ATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCT
GATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGA
GGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCT
GGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCA
GCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGG
CGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGC
CATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAA
GCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGT
GGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTT
CACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGT
GTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCT
GTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTC
CAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGAT
CACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCAC
CAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACAT
GTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGA
GACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAG
GATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGC
CCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAA
GGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCT
GCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCT
TGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGG
ACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAA
GGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGT
GAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAG
CGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCA
AGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAG
GAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCT
CAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGG
GTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACC
TGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGG
CTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGG
TCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCC
TTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCC
ACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTG
GGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCT
GGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTAC
CTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGA
ACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTC
CATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGT
GGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAA
AGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACA
TCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTC
TCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGG
AAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTT
GCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGA
GGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAA

>In-frame_BCAS3_ENST00000390652_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8623nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTA
TTCACTTCGTACTGGGGAGATGGTCAAGTCCATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGT
CTTGCAGGAGAAAATTGCTGCCTTTGATAGCTGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACAT
GAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGA
CAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCT
GACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCAC
AGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCA
TGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCA
AATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGA
CATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCA
GCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGA
ACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAG
CCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGC
ACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCC
ATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTC
ATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGG
CACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCC
TCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGA
TGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTT
AGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGAT
GGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCC
GAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGT
CAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCA
AAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCA
CCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCAT
GACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCAT
GGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGT
ACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGAT
CATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTT
TGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCT
CATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTT
CCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGC
CTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGG
GCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGA
GACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGG
CCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGA
CCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTC
GTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGA
GTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAG
GGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGA
CATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCT
CAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTT
GGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCG
ATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCT
GATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGA
GGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCT
GGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCA
GCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGG
CGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGC
CATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAA
GCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGT
GGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTT
CACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGT
GTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCT
GTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTC
CAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGAT
CACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCAC
CAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACAT
GTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGA
GACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAG
GATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGC
CCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAA
GGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCT
GCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCT
TGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGG
ACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAA
GGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGT
GAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAG
CGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCA
AGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAG
GAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCT
CAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGG
GTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACC
TGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGG
CTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGG
TCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCC
TTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCC
ACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTG
GGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCT
GGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTAC
CTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGA
ACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTC
CATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGT
GGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAA
AGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACA
TCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTC
TCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGG
AAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTT
GCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGA
GGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAA

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8547nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG
CGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTG
CCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGA
CACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCA
AGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCC
CCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAG
TGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCC
CCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTC
AAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTC
CGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAG
TGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAG
AAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCC
CTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAG
ATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGC
TGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTC
ACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGT
ATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGG
ACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTG
TGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCT
TGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTG
TGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTG
AACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTA
TGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACAT
TGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGT
GTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCT

>In-frame_BCAS3_ENST00000408905_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8547nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTC
GGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATT
ATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAA
ATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTG
CTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGG
TCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCAT
AGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTG
CAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTC
CGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTG
GAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTC
AAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATG
GAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTG
AAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTA
GGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAAC
ATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTG
GGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTC
TTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATG
TGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCC
GACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAG
GCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCT
GGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATG
GGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCC
TCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTC
TATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGG
GAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGG
TGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCT
CTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATC
ATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTC
TCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTG
AGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGC
CTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGG
TTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTAC
GACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGG
GAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTC
AACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAG
AAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTAT
GACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAG
AGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTG
CGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATC
CAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGC
ATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCC
ATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATC
TGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTG
GAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTC
ATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTT
GAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTG
CAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTG
GACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCA
GCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCC
TACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAG
AAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAG
GCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTG
CGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTG
CCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGA
CACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCA
AGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCC
CCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAG
TGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCC
CCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTC
AAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTC
CGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAG
TGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAG
AAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCC
CTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAG
ATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGC
TGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTC
ACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGT
ATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGG
ACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTG
TGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCT
TGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTG
TGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTG
AACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTA
TGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACAT
TGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGT
GTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCT

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8592nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC
TCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGG
TGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTG
CCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGA
ATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGC
CCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCC
CCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACC
TCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGA
ATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGC
TGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGA
TGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTG
AGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGA
GCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTC
TCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTC
AGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTC
AGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTA
TAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCAC
GTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGC
AGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTG
TACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAAC
CTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGT
CTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTC
GTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCT
TCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCC
TGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTC
CCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGGCTC

>In-frame_BCAS3_ENST00000588462_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8592nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGCACAAGCCCACCGTACTGTTGTGTGGATCTGTATTCACTTCGTACTGGGGAGATGGTCAAGTCC
ATTCAATTTAAGACACCTATTTATGATCTCCATTGCAATAAACGGATCCTTGTCGTAGTCTTGCAGGAGAAAATTGCTGCCTTTGATAGC
TGTACTTTCACGAAGAAATTCTTTGTTACAAGCTGCTATCCATGTCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTT
GCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATT
AGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAA
GATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGC
CAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAAT
ACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAA
TGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTT
GTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGA
GTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGC
CCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAAC
AACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACC
ATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCA
CCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGA
GAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGA
CCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCT
CAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCT
GGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAA
GAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCAT
CCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTT
GATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCT
GATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCC
CACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTG
GGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTG
GGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGG
AATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGT
CTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAAC
CTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAG
ATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGG
ATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTG
GTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTG
CAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAG
GACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCG
CCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTT
AACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGAC
ACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCC
CCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGG
CCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGG
TTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGC
ACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTAC
TTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTG
GGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCC
CTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTT
GCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTC
ATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACC
TTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTAC
CTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAG
AAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAG
AAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTC
ATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTC
ATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTG
GTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTG
GCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTC
TTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGC
ATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTC
AACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCC
ATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAAT
GTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACC
CAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATC
ACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGG
GAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTC
AAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTAC
ATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCAC
GAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCC
TCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGG
TGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTG
CCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGA
ATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGC
CCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCC
CCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACC
TCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGA
ATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGC
TGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGA
TGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTG
AGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGA
GCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTC
TCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTC
AGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTC
AGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTA
TAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCAC
GTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGC
AGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTG
TACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAAC
CTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGT
CTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTC
GTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCT
TCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCC
TGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTC
CCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGGCTC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8008nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACT
GGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTT
CAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCAT
GGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCT
GAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCT
AGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAA
CATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGT
GGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTT
CTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCAT
GTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGC
CGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAA
GGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGC
TGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACAT
GGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGC
CTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCT
CTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGG
GGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTG
GTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGC
TCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCAT
CATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGT
CTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCT
GAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTG
CCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAG
GTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTA
CGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCG
GGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCT
CAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAA
GAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTA
TGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCA
GAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCT
GCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGAT
CCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGG
CATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTC
CATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCAT
CTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCT
GGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCT
CATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTT
TGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCT
GCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCT
GGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGC
AGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGC
CTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGA
GAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGA
GGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGT
GCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGT
GCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTG
ACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCC
AAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGC
CCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAA
GTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACC
CCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCT
CAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGT
CCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGA
GTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAA
GAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTC
CCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTA
GATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTG
CTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATT
CACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTG
TATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTG
GACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCT
GTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTC
TTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGT
GTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCT
GAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCT
ATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACA
TTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTG
TGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCC

>In-frame_BCAS3_ENST00000585744_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8008nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGCTGCTATCCATG
TCCAGGGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGG
TGGAGCCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAA
AGTGGTGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGT
CCCAGGCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGC
CCACTTCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGA
CTTTCATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGA
AGCCAAAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAA
CCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGA
AGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCA
TGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGT
AGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTT
TTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTT
CGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACAT
TATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGA
AATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCT
GCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGG
GTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCA
TAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTT
GCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGT
CCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACT
GGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACAAAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTT
CAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCATCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCAT
GGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCAACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCT
GAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATATCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCT
AGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGCTGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAA
CATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGACGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGT
GGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTGCCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTT
CTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCGAGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCAT
GTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCCTGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGC
CGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGATTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAA
GGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACATCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGC
TGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCGAGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACAT
GGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACTTCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGC
CTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTTTCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCT
CTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCGAGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGG
GGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCTGCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTG
GTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCGAGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGC
TCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCATCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCAT
CATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCACCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGT
CTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGACCCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCT
GAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCCTAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTG
CCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCGGCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAG
GTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGCACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTA
CGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCAAGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCG
GGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCTACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCT
CAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGAAGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAA
GAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGCCAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTA
TGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCTGCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCA
GAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCATCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCT
GCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCGTCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGAT
CCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGCGGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGG
CATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCAACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTC
CATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCGATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCAT
CTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACCCCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCT
GGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCGGCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCT
CATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGGCCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTT
TGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGTTCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCT
GCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACACTGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCT
GGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAATGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGC
AGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGAGGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGC
CTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGTACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGA
GAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGAATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGA
GGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAGACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGT
GCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGCCCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGT
GCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTGGCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTG
ACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTGCGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCC
AAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCTCCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGC
CCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCCATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAA
GTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAGGGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACC
CCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTCCCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCT
CAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGGATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGT
CCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCCACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGA
GTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCATCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAA
GAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCACCACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTC
CCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTCCCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTA
GATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGCTCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTG
CTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGAGGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATT
CACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGGCCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTG
TATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGTCTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTG
GACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGCCTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCT
GTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACTCAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTC
TTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTCAAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGT
GTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTTATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCT
GAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTGTCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCT
ATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAGAAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACA
TTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGAGCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTG
TGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTGCCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCC

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000435607_chr17_62038791_-_8048nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACA
AAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCA
TCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCA
ACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATA
TCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGC
TGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGA
CGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTG
CCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCG
AGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCC
TGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGA
TTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACA
TCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCG
AGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACT
TCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTT
TCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCG
AGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCT
GCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCG
AGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCA
TCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCA
CCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGAC
CCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCC
TAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCG
GCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGC
ACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCA
AGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCT
ACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGA
AGTTAGGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGC
CAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCT
GCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCA
TCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCG
TCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGC
GGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCA
ACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCG
ATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACC
CCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCG
GCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGG
CCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGT
TCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACAC
TGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAA
TGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGA
GGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGT
ACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGA
ATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAG
ACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGC
CCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTG
GCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTG
CGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCT
CCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCC
ATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAG
GGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTC
CCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGG
ATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCC
ACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCA
TCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCAC
CACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTC
CCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGC
TCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGA
GGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGG
CCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGT
CTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGC
CTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACT
CAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTC
AAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTT
ATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTG
TCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAG
AAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGA
GCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTG
CCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGGCTCCTTT

>In-frame_BCAS3_ENST00000588874_chr17_59161925_+_SCN4A_ENST00000578147_chr17_62038791_-_8048nt
GCCGCCTTGCAGTTTGATCTCAGACTGCTGTGCTGGCAATCAGCGAGACTCCGTGGGCGTAGGACCCTCCGAGCCAGGTGTGGGATATAG
TCTCGTGGTGCGCCGTTTTTTAAGCCGGTCTGAAAAGCGCAATATTCGGGTGGGAGTGACCCGATTTTCCAGGCTGCTATCCATGTCCAG
GGCCAAACATGAATCCTATTGCTCTTGGGAGCCGCTGGCTTGCTTATGCAGAAAACAAGTTGATTCGATGTCATCAGTCCCGTGGTGGAG
CCTGTGGAGACAACATTCAGTCTTATACTGCCACAGTCATTAGTGCTGCTAAAACATTGAAAAGTGGCCTGACAATGGTAGGGAAAGTGG
TGACTCAGCTGACAGGCACACTGCCTTCAGGTGTGACAGAAGATGATGTTGCCATCCACAGTAATTCACGGCGGAGTCCTTTGGTCCCAG
GCATCATCACAGTTATTGACACCGAAACCGTTGGAGAGGGCCAGGTGCTTGTGAGTGAGGATTCTGACAGTGATGGCATTGTGGCCCACT
TCCCTGCCCATGAGAAGCCAGTGTGCTGCATGGCTTTTAATACAAGTGGAATGCTTCTAGTCACAACAGACACCCTTGGCCATGACTTTC
ATGTCTTCCAAATTCTGACTCATCCTTGGTCCTCATCACAATGTGCTGTCCACCATCTGTATACTCTTCACAGGGGAGAAACTGAAGCCA
AAGTACAGGACATCTGCTTCAGCCATGACTGTCGCTGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTT
ATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGA
TTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGA
AACTGAACAGCCAAGACTCCTATAACAATTTTACCAACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGA
TGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCA
GCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAA
AAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCC
TCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAAT
GGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCC
TGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAAT
GGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCT
CAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATA
CAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATC
GAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGAACTGGAAGAGGCCCACCAAAAGTGCCCACCATGGTGGTACAAGTGCGCCCACA
AAGTGCTCATATGGAACTGCTGCGCCCCGTGGCTGAAGTTCAAGAACATCATCCACCTGATCGTCATGGACCCGTTCGTGGACCTGGGCA
TCACCATCTGCATCGTGCTCAACACCCTCTTCATGGCCATGGAACATTACCCCATGACGGAGCACTTTGACAACGTGCTCACTGTGGGCA
ACCTGGTCTTCACAGGCATCTTCACAGCAGAGATGGTTCTGAAGCTGATTGCCATGGACCCCTACGAGTATTTCCAGCAGGGTTGGAATA
TCTTCGACAGCATCATCGTCACCCTCAGCCTGGTAGAGCTAGGCCTGGCCAACGTACAGGGACTGTCTGTGCTACGCTCCTTCCGTCTGC
TGCGGGTCTTCAAGCTGGCCAAGTCGTGGCCAACGCTGAACATGCTCATCAAGATCATTGGCAATTCAGTGGGGGCGCTGGGTAACCTGA
CGCTGGTGCTGGCTATCATCGTGTTCATCTTCGCCGTGGTGGGCATGCAGCTGTTTGGCAAGAGCTACAAGGAGTGCGTGTGCAAGATTG
CCTTGGACTGCAACCTGCCGCGCTGGCACATGCATGATTTCTTCCACTCCTTCCTCATCGTCTTCCGCATCCTGTGCGGGGAGTGGATCG
AGACCATGTGGGACTGCATGGAGGTGGCCGGCCAAGCCATGTGCCTCACCGTCTTCCTCATGGTCATGGTCATCGGCAATCTTGTGGTCC
TGAACCTGTTCCTGGCTCTGCTGCTGAGCTCCTTCAGCGCCGACAGTCTGGCAGCCTCGGATGAGGATGGCGAGATGAACAACCTGCAGA
TTGCCATCGGGCGCATCAAGTTGGGCATCGGCTTTGCCAAGGCCTTCCTCCTGGGGCTGCTGCATGGCAAGATCCTGAGCCCCAAGGACA
TCATGCTCAGCCTCGGGGAGGCTGACGGGGCCGGGGAGGCTGGAGAGGCGGGGGAGACTGCCCCCGAGGATGAGAAGAAGGAGCCGCCCG
AGGAGGACCTGAAGAAGGACAATCACATCCTGAACCACATGGGCCTGGCTGACGGCCCCCCATCCAGCCTCGAGCTGGACCACCTTAACT
TCATCAACAACCCCTACCTGACCATACAGGTGCCCATCGCCTCCGAGGAGTCCGACCTGGAGATGCCCACCGAGGAGGAAACCGACACTT
TCTCAGAGCCTGAGGATAGCAAGAAGCCGCCGCAGCCTCTCTATGATGGGAACTCGTCCGTCTGCAGCACAGCTGACTACAAGCCCCCCG
AGGAGGACCCTGAGGAGCAGGCAGAGGAGAACCCCGAGGGGGAGCAGCCTGAGGAGTGCTTCACTGAGGCCTGCGTGCAGCGCTGGCCCT
GCCTCTACGTGGACATCTCCCAGGGCCGTGGGAAGAAGTGGTGGACTCTGCGCAGGGCCTGCTTCAAGATTGTCGAGCACAACTGGTTCG
AGACCTTCATTGTCTTCATGATCCTGCTCAGCAGTGGGGCTCTGGCCTTCGAGGACATCTACATTGAGCAGCGGCGAGTCATTCGCACCA
TCCTAGAATATGCCGACAAGGTCTTCACCTACATCTTCATCATGGAGATGCTGCTCAAATGGGTGGCCTACGGCTTTAAGGTGTACTTCA
CCAACGCCTGGTGCTGGCTCGACTTCCTCATCGTGGATGTCTCCATCATCAGCTTGGTGGCCAACTGGCTGGGCTACTCGGAGCTGGGAC
CCATCAAATCCCTGCGGACACTGCGGGCCCTGCGTCCCCTGAGGGCACTGTCCCGATTCGAGGGCATGAGGGTGGTGGTGAACGCCCTCC
TAGGCGCCATCCCCTCCATCATGAATGTGCTGCTTGTCTGCCTCATCTTCTGGCTGATCTTCAGCATCATGGGTGTCAACCTGTTTGCCG
GCAAGTTCTACTACTGCATCAACACCACCACCTCTGAGAGGTTCGACATCTCCGAGGTCAACAACAAGTCTGAGTGCGAGAGCCTCATGC
ACACAGGCCAGGTCCGCTGGCTCAATGTCAAGGTCAACTACGACAACGTGGGTCTGGGCTACCTCTCCCTCCTGCAGGTGGCCACCTTCA
AGGGTTGGATGGACATCATGTATGCAGCCGTGGACTCCCGGGAGAAGGAGGAGCAGCCGCAGTACGAGGTGAACCTCTACATGTACCTCT
ACTTTGTCATCTTCATCATCTTTGGCTCCTTCTTCACCCTCAACCTCTTCATTGGCGTCATCATTGACAACTTCAACCAGCAGAAGAAGA
AGATGAGGGGGAAAGACATCTTTATGACGGAGGAACAGAAGAAATACTATAACGCCATGAAGAAGCTTGGCTCCAAGAAGCCTCAGAAGC
CAATTCCCCGGCCCCAGAACAAGATCCAGGGCATGGTGTATGACCTCGTGACGAAGCAGGCCTTCGACATCACCATCATGATCCTCATCT
GCCTCAACATGGTCACCATGATGGTGGAGACAGACAACCAGAGCCAGCTCAAGGTGGACATCCTGTACAACATCAACATGATCTTCATCA
TCATCTTCACAGGGGAGTGCGTGCTCAAGATGCTCGCCCTGCGCCAGTACTACTTCACCGTTGGCTGGAACATCTTTGACTTCGTGGTCG
TCATCCTGTCCATTGTGGGCCTTGCCCTCTCTGACCTGATCCAGAAGTACTTCGTGTCACCCACGCTGTTCCGTGTGATCCGCCTGGCGC
GGATTGGGCGTGTCCTGCGGCTGATCCGCGGGGCCAAGGGCATCCGGACGCTGCTGTTCGCCCTCATGATGTCGCTGCCTGCCCTCTTCA
ACATCGGCCTCCTCCTCTTCCTGGTCATGTTCATCTACTCCATCTTCGGCATGTCCAACTTTGCCTACGTCAAGAAGGAGTCGGGCATCG
ATGATATGTTCAACTTCGAGACCTTCGGCAACAGCATCATCTGCCTGTTCGAGATCACCACGTCGGCCGGCTGGGACGGGCTCCTCAACC
CCATCCTCAACAGCGGGCCCCCAGACTGTGACCCCAACCTGGAGAACCCGGGCACCAGTGTCAAGGGTGACTGCGGCAACCCCTCCATCG
GCATCTGCTTCTTCTGCAGCTATATCATCATCTCCTTCCTCATCGTGGTCAACATGTACATCGCCATCATCCTGGAGAACTTCAATGTGG
CCACAGAGGAGAGCAGCGAGCCCCTTGGTGAAGATGACTTTGAGATGTTCTACGAGACATGGGAGAAGTTCGACCCCGACGCCACCCAGT
TCATCGCCTACAGCCGCCTCTCAGACTTCGTGGACACCCTGCAGGAACCGCTGAGGATTGCCAAGCCCAACAAGATCAAGCTCATCACAC
TGGACTTGCCCATGGTGCCAGGGGACAAGATCCACTGCCTGGACATCCTCTTTGCCCTGACCAAAGAGGTCCTGGGTGACTCTGGGGAAA
TGGACGCCCTCAAGCAGACCATGGAGGAGAAGTTCATGGCAGCCAACCCCTCCAAGGTGTCCTACGAGCCCATCACCACCACCCTCAAGA
GGAAGCACGAGGAGGTGTGCGCCATCAAGATCCAGAGGGCCTACCGCCGGCACCTGCTACAGCGCTCCATGAAGCAGGCATCCTACATGT
ACCGCCACAGCCACGACGGCAGCGGGGATGACGCCCCTGAGAAGGAGGGGCTGCTTGCCAACACCATGAGCAAGATGTATGGCCACGAGA
ATGGGAACAGCAGCTCGCCAAGCCCGGAGGAGAAGGGCGAGGCAGGGGACGCCGGACCCACTATGGGGCTGATGCCCATCAGCCCCTCAG
ACACTGCCTGGCCTCCCGCCCCTCCCCCAGGGCAGACTGTGCGCCCAGGTGTCAAGGAGTCTCTTGTCTAGCAGGCAGCATCGGGGTGGC
CCACTGAGTCTCGGCATAGTCCCCAGAGCTCCCCCGTGGTGCCTGCACACAGAGTGAGGGAGGAGGGCTTTGAATCTGGGACTGTGCCTG
GCTCCCTGATGGGGGACAGGATTTGGCCACACTGGGGCTGACACCCAGGCCCGAGCGCCTGCGTTCCCAGACCATGGGAAATGGGAATTG
CGCTCAGGGGCTCCATGCTGGGTCTGAGGCCCCTGCCTCCAAGATTTAACCTGCAAGTTGCTCTGACCTCCTCTGGGCCCTGTCGCCCCT
CCTTTTGGCCTGGGGGAGGTCAGAACATTCGAATCTCTGCCCCTCACTTGAGGAGGAGCTGGCCTGCGGTGGAGGGATCAGTTGCCCCCC
ATCACCAGAGTCTTAAGGGTCACTGGCCTCTCCCCAGGAAGTGGCTCAGACCCCTCAGCCCCAGCCCAGACAAAGATGTCTTAACCTCAG
GGAGTGCAGACACCTAACCCCAGGGCACTGCCAGCCCACCCCCTTTGACTCTGGGGTGCAGCTTCACCCACCAGGCCAGCTCAGGAATTC
CCTGGAAAAGGGAAATGTGACTGGTTCAGAAATAGCTCCTCAAAGCCTCAAAACCTGATTGGCCACTGGATCCTGCTGCTTTGGGCTGGG
ATGGTGACTCCTGAAACCTCTTCCTAGGCCACGTCCAGGTCCGTAGCTCCCCTGGCTGGCTCCTAGGGGAAGAGCAGAAGGAAGGATGCC
ACTTGGGAATGAATTGTCCTTTTCTAGGAAGCACGGGGGAGTGAGACAGGCTGGGTCCTGCCAGCTGGATCGCTGCACATGGCCTGAGCA
TCCAGACCTGAGCGGGAGTCAGGGACCTGCTGCTCAGTAAGAAGATTCTCGCCCCTTCCCTCTCTCCCTGCCTCACTCCTCCGTGAGCAC
CACCAGGGCTCCAGGAGCCTCATCCAGCCTCAGAGATCTCCCTTCTCATCTCCCCACGCCCGTCTCTTTCTCACCTTTCCCACCTCTCTC
CCCAAAGTGATCCTAAGAATGTACAGTTGAGCTCAGGTTAGATATTTCGACCCTGGGGCGTGCAGCAGGGAAGGCCCAACTGGTTCAGGC
TCAACCTTCCAACTTCCTGTGGCCTGAAGAAGCACTTCTGCTGCATCGCTGTTCTGGGCATGGCAGGGCCAGGCCTCTGCTGGCTCAGGA
GGAGGGGTGAGAGACCTGCTCAGGCGTCGCTGGATTTATTCACTTGTGTGTGTACCTGTGGCTGTGTGTCTGCTTGTATGCTTTTATAGG
CCTGTGTGTATAGCTGTGTGTGTGTTCAAGTGCGTGACTGTATGTGTGTGTGTGAACCACTGTGTACTGGAGCCTGCATTATGCACGTGT
CTGGGTATCTTTGTATATATGTGTATATATGTGTGCCCTGGACTGTTTCAAGGTCCATGGAGTACGGCTGGTGTGTCATACTGTGCAGGC
CTGTCCCTGGGAGTGTTCCCGTGCCTGGGAGAGTGGACCTGTGCTGTGAGTGTGTGGATGCGTGTGAACGCATGTGGTAAGGTGTGTACT
CAGGGCATTCTGTTGGCCTAAGTGCCTCTTCTTTTTCTTCTTGTTTCTCATGAAAAGTTTGATTAAAATTCAGGAAGCAGCAAAACCTTC
AAAACAAGACATGTATGTGTGCTTGAGTGTGTGAACACGTGTGTGTGTGTGCACATCTACATGCCATGCCTATGGGCCAGAGTTGTCTTT
ATTGTCCACCATGCTCTCTCACCTGCTCCCAGTCCTGCCTGAACAGCCCTCTCTCTCACTCCCCTCTCCTCCCCTTCCTGTTTCTCGTTG
TCACACCCATGGCCTCAGCCCTGCTCCCTGCCTCCTGCCTATGTCTCCTCTATGGAAGGAGGCCTCCACTCCTTCCATCTCTTCCTTCAG
AAGTTTCGTCTAATGGGGGCAGTCTCCCCTTCCTGGCACATTGCCCCTCTGCCTTGCCCTCCTGGGCCCTGGGCTGGCACAGCCCCTGGA
GCCTCAGAAATCTGTTTGATTGGATATTCTCCTCGGACTGTGTGCAGGTTGCAGAGGAAGAGTAGATGAGCCGGGTCCGGCCTCTCCCTG
CCTGTGGCCCCTCCCCTGCAGACGGATGCCCATTCCTGCCTGGTCCAGTGGGGAACAGGTCCCACGCCAGGCCAGCAGGCGGGCTCCTTT


Top

FusionGenePPI for BCAS3_SCN4A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2BSCN4ASLC9A3R1, CALM1, ERBB2IP, SNTA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCAS3_SCN4A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneSCN4AP35499DB00909ZonisamideSodium channel protein type 4 subunit alphasmall moleculeapproved|investigational
TgeneSCN4AP35499DB00818PropofolSodium channel protein type 4 subunit alphasmall moleculeapproved|investigational|vet_approved
TgeneSCN4AP35499DB00281LidocaineSodium channel protein type 4 subunit alphasmall moleculeapproved|vet_approved
TgeneSCN4AP35499DB00586DiclofenacSodium channel protein type 4 subunit alphasmall moleculeapproved|vet_approved
TgeneSCN4AP35499DB01195FlecainideSodium channel protein type 4 subunit alphasmall moleculeapproved|withdrawn

Top

RelatedDiseases for BCAS3_SCN4A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSCN4AC2931826Potassium aggravated myotonia16CTD_human;ORPHANET;UNIPROT
TgeneSCN4AC0221055Paramyotonia Congenita (disorder)15ORPHANET;UNIPROT
TgeneSCN4AC2750061Hypokalemic Periodic Paralysis, Type 212CTD_human;UNIPROT
TgeneSCN4AC0238357Hyperkalemic periodic paralysis7CTD_human;HPO;ORPHANET;UNIPROT
TgeneSCN4AC3280112MYASTHENIC SYNDROME, CONGENITAL, 163UNIPROT
TgeneSCN4AC0027125Myotonia1CTD_human;HPO
TgeneSCN4AC0027127Myotonia Congenita1CTD_human
TgeneSCN4AC0238358Hypokalemic periodic paralysis1CTD_human;ORPHANET
TgeneSCN4AC0751882Myasthenic Syndromes, Congenital1CTD_human