FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3960

FusionGeneSummary for BCAS3_PRKAA2

check button Fusion gene summary
Fusion gene informationFusion gene name: BCAS3_PRKAA2
Fusion gene ID: 3960
HgeneTgene
Gene symbol

BCAS3

PRKAA2

Gene ID

54828

5563

Gene nameBCAS3, microtubule associated cell migration factorprotein kinase AMP-activated catalytic subunit alpha 2
SynonymsGAOB1|MAABAMPK|AMPK2|AMPKa2|PRKAA
Cytomap

17q23.2

1p32.2

Type of geneprotein-codingprotein-coding
Descriptionbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab15'-AMP-activated protein kinase catalytic subunit alpha-25'-AMP-activated protein kinase, catalytic alpha-2 chainACACA kinaseAMP-activated protein kinase alpha-2 subunit variant 2AMP-activated protein kinase alpha-2 subunit variant 3AMPK alpha 2AMPK
Modification date2018052320180523
UniProtAcc

Q9H6U6

P54646

Ensembl transtripts involved in fusion geneENST00000589222, ENST00000407086, 
ENST00000390652, ENST00000408905, 
ENST00000588462, ENST00000585744, 
ENST00000588874, ENST00000585812, 
ENST00000371244, 
Fusion gene scores* DoF score40 X 23 X 15=138002 X 3 X 2=12
# samples 472
** MAII scorelog2(47/13800*10)=-4.87586369998789
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/12*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BCAS3 [Title/Abstract] AND PRKAA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

HgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

HgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A8-A09G-01ABCAS3chr17

58885437

+PRKAA2chr1

57140054

+
TCGALDBRCATCGA-A8-A09G-01ABCAS3chr17

58885437

+PRKAA2chr1

57157067

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000589222ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
Frame-shitENST00000407086ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
Frame-shitENST00000390652ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
Frame-shitENST00000408905ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
Frame-shitENST00000588462ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
intron-3CDSENST00000585744ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
intron-3CDSENST00000588874ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
intron-3CDSENST00000585812ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57140054

+
In-frameENST00000589222ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
In-frameENST00000407086ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
In-frameENST00000390652ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
In-frameENST00000408905ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
In-frameENST00000588462ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
intron-3CDSENST00000585744ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
intron-3CDSENST00000588874ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+
intron-3CDSENST00000585812ENST00000371244BCAS3chr17

58885437

+PRKAA2chr1

57157067

+

Top

FusionProtFeatures for BCAS3_PRKAA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BCAS3

Q9H6U6

PRKAA2

P54646

Catalytic subunit of AMP-activated protein kinase(AMPK), an energy sensor protein kinase that plays a key role inregulating cellular energy metabolism. In response to reduction ofintracellular ATP levels, AMPK activates energy-producing pathwaysand inhibits energy-consuming processes: inhibits protein,carbohydrate and lipid biosynthesis, as well as cell growth andproliferation. AMPK acts via direct phosphorylation of metabolicenzymes, and by longer-term effects via phosphorylation oftranscription regulators. Also acts as a regulator of cellularpolarity by remodeling the actin cytoskeleton; probably byindirectly activating myosin. Regulates lipid synthesis byphosphorylating and inactivating lipid metabolic enzymes such asACACA, ACACB, GYS1, HMGCR and LIPE; regulates fatty acid andcholesterol synthesis by phosphorylating acetyl-CoA carboxylase(ACACA and ACACB) and hormone-sensitive lipase (LIPE) enzymes,respectively. Regulates insulin-signaling and glycolysis byphosphorylating IRS1, PFKFB2 and PFKFB3. Involved in insulinreceptor/INSR internalization (PubMed:25687571). AMPK stimulatesglucose uptake in muscle by increasing the translocation of theglucose transporter SLC2A4/GLUT4 to the plasma membrane, possiblyby mediating phosphorylation of TBC1D4/AS160. Regulatestranscription and chromatin structure by phosphorylatingtranscription regulators involved in energy metabolism such asCRTC2/TORC2, FOXO3, histone H2B, HDAC5, MEF2C, MLXIPL/ChREBP,EP300, HNF4A, p53/TP53, SREBF1, SREBF2 and PPARGC1A. Acts as a keyregulator of glucose homeostasis in liver by phosphorylatingCRTC2/TORC2, leading to CRTC2/TORC2 sequestration in thecytoplasm. In response to stress, phosphorylates 'Ser-36' ofhistone H2B (H2BS36ph), leading to promote transcription. Acts asa key regulator of cell growth and proliferation byphosphorylating TSC2, RPTOR and ATG1/ULK1: in response to nutrientlimitation, negatively regulates the mTORC1 complex byphosphorylating RPTOR component of the mTORC1 complex and byphosphorylating and activating TSC2. In response to nutrientlimitation, promotes autophagy by phosphorylating and activatingATG1/ULK1. AMPK also acts as a regulator of circadian rhythm bymediating phosphorylation of CRY1, leading to destabilize it. Mayregulate the Wnt signaling pathway by phosphorylating CTNNB1,leading to stabilize it. Also phosphorylates CFTR, EEF2K, KLC1,NOS3 and SLC12A1. Plays an important role in the differentialregulation of pro-autophagy (composed of PIK3C3, BECN1, PIK3R4 andUVRAG or ATG14) and non-autophagy (composed of PIK3C3, BECN1 andPIK3R4) complexes, in response to glucose starvation. Can inhibitthe non-autophagy complex by phosphorylating PIK3C3 and canactivate the pro-autophagy complex by phosphorylating BECN1 (Bysimilarity). {ECO:0000250|UniProtKB:Q8BRK8,ECO:0000269|PubMed:11518699, ECO:0000269|PubMed:11554766,ECO:0000269|PubMed:12519745, ECO:0000269|PubMed:14651849,ECO:0000269|PubMed:15866171, ECO:0000269|PubMed:17486097,ECO:0000269|PubMed:17711846, ECO:0000269|PubMed:18184930,ECO:0000269|PubMed:20074060, ECO:0000269|PubMed:20160076,ECO:0000269|PubMed:21205641, ECO:0000269|PubMed:25687571,ECO:0000269|PubMed:7959015}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePRKAA2chr17:58885437chr1:57157067ENST00000371244+19291_37678553RegionAIS

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePRKAA2chr17:58885437chr1:57157067ENST00000371244+1916_26878553DomainProtein kinase
TgenePRKAA2chr17:58885437chr1:57157067ENST00000371244+1922_3078553Nucleotide bindingATP


Top

FusionGeneSequence for BCAS3_PRKAA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BCAS3_ENST00000589222_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_633aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGYQVISTPTDFFMVMETVSGGE
LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNTAAPEVISGRLT
AGPEVDIWSCGVILTALLCGTLPFDDEHVPTLFKKIRGGVFTIPETLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED
PSTDANVIDDEAVKEVCEKFECTESEVMNSLTSGDPQDQLAVATHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERM
PPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPTDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV
DNRSTLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL

>In-frame_BCAS3_ENST00000407086_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_633aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGYQVISTPTDFFMVMETVSGGE
LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNTAAPEVISGRLT
AGPEVDIWSCGVILTALLCGTLPFDDEHVPTLFKKIRGGVFTIPETLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED
PSTDANVIDDEAVKEVCEKFECTESEVMNSLTSGDPQDQLAVATHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERM
PPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPTDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV
DNRSTLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL

>In-frame_BCAS3_ENST00000390652_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_633aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGYQVISTPTDFFMVMETVSGGE
LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNTAAPEVISGRLT
AGPEVDIWSCGVILTALLCGTLPFDDEHVPTLFKKIRGGVFTIPETLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED
PSTDANVIDDEAVKEVCEKFECTESEVMNSLTSGDPQDQLAVATHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERM
PPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPTDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV
DNRSTLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL

>In-frame_BCAS3_ENST00000408905_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_633aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGYQVISTPTDFFMVMETVSGGE
LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNTAAPEVISGRLT
AGPEVDIWSCGVILTALLCGTLPFDDEHVPTLFKKIRGGVFTIPETLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED
PSTDANVIDDEAVKEVCEKFECTESEVMNSLTSGDPQDQLAVATHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERM
PPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPTDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV
DNRSTLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL

>In-frame_BCAS3_ENST00000588462_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_633aa
MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPP
LLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGYQVISTPTDFFMVMETVSGGE
LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNTAAPEVISGRLT
AGPEVDIWSCGVILTALLCGTLPFDDEHVPTLFKKIRGGVFTIPETLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED
PSTDANVIDDEAVKEVCEKFECTESEVMNSLTSGDPQDQLAVATHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERM
PPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPTDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLV
DNRSTLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BCAS3_ENST00000589222_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_1899nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA

>In-frame_BCAS3_ENST00000407086_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_1899nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA

>In-frame_BCAS3_ENST00000390652_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_1899nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA

>In-frame_BCAS3_ENST00000408905_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_1899nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA

>In-frame_BCAS3_ENST00000588462_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_1899nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BCAS3_ENST00000589222_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_9589nt
CTCGGGGAGACTCCAAACAGTGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAG
ATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGA
CTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATG
CAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACA
GTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAA
TCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTT
CTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAATTATTTGACTACATCTGTAAGC
ATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGTCATAGGCATATGGTTGTTCATC
GAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTATCTAATATGATGTCAGATGGTG
AATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTATGCAGGTCCTGAAGTTGATATCT
GGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCTACGTTATTTAAGAAGATCCGAG
GGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAGGTTGACCCACTGAAACGAGCAA
CTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGACCCTTCCTATGATGCTAACGTCA
TTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGTTTATATAGTGGTGACCCTCAAG
ACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTCTACCTCGCCTCTAGTCCTCCAT
CTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATGCCACCTCTTATAGCAGACAGCC
CCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCCAAGTGGCATCTTGGAATCCGAA
GTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGGAAGGTAGTGAATGCATACCATC
TTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTTGATAACAGGAGCTATCTTTTGG
ACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGTTCTGCTGCTGGCTTACACAGAC
CAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTGACCGGAAGCACATTGTCTTCAG
TTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTAGCCCGTTGATCTGTCTCTAGTT
TCTTTCTGTTATTGCACTATGAAAATCAGTTATATTCTTTAAATTTTTATCTTACTTTTGGATAATATCCACTGCAATACTAATTGAGAA
ACATGAATTATTTCCAGGGGCACACAATGCTATTGAAATTACTGAAAACAAAATATCTGACATCTTATTTACTTGTAGAAATCTGTAATT
CTATTGTGCCTATGATAAATTCACATAGGCAATATCTTTAATAGGTTAATATCAATGAAGATTTTTAATTACAATAATGAGTTCACTACA
GACGATTAACACACCACACTGGCGAACCATCTCAATGTAAGGGTGGTTTGGCAACACCTCCTTGCTTTGCTGTTTGGTGTAGGTAAATCT
AGTTTACTTCCTAAATTTCAGTAGGCTTTATGCTGTGTTTATGCCCCCAATTTATTTTAACAAAAGAAGATTAAAAAGTAAAAGAACCAC
GAGTAAGATATTATTTAAATGTTGAAATCTTAAAAACCTGCCTCCAAGATTTCAGAAGCCAAGTTTTTCTAACAGTATTTGTACAAATAC
TGCCTAGTGTATTCAACAGAAGGACTGTGGTCATGTAACAGGTAACCACAATTTTCAGGTTTCTTAAAAACAGCTGTAACTAACTCAGGA
TTTTTATCTTGAGATTTCCCTGAATAATATATTTATCTTAAGAGCCTTCAAGTTTCAAATTAATATTGGAACATCTGGAATTGCAACAAC
TTTTGTCTTTTACATAAACTTACGTCATTTAAAAAATGTCTTCAAAATCTACCTTTCTCAAATTCTTTTTGCCTCTATTTATTTTTGCAT
TTCACCAACAGTGATAAAATAGTTAAATGAAACAAAGCAAAGTATCAACAGTCCCTTAAATGAGAATCCTTATCTTTGATCTTTATTTTC
TGTGTTAGGTGTTAGGGTCCTGGTGCAGCTCATAATGCTAATTCTTCATTGGAAGCCACTCCCTTCACCTCACCTCACCTAGTCACTATT
GTCTTTGTTCATTGTTTGATCCTGAGTGGTTGATTGATATAGCTTTGAATCTTTTCTAGTCCAAGTTTGAAAACACTGTTCTGGCCCTAA
GGGCTGGCTATGACCTTTACTGTTGAACCTGATAGGGCAGGGAAGCTTTGAACATCAAGAAAAAATTTTTATCTTAAATAAATAAATATA
TATATTCACACACCAGTGCTTTTAAGCAAAAACCAGTTTTTTTGTTTGTTTGTTTTGCTTTGTGCAGGTTTTCTTTAAGATTAAAAAAAC
ACAAACTATAGCAGGGTAGATAATAGTTTATTGATTATATTTTGTTTTAGTAAAAGTATTTAATTTTAAATTCTGTGTAATTTATCTAAT
TTGTATTTATTCATTTGTTATTTTTATGTTGTAATTAACACTTATTTACCTGGATTACCCTAAAAAAATTAAGCTCTTGAAAACAAAAAA
ATGACATTACCTTGACAGGCTTCTCTTTGCCAAAAGTAATGTATGTTCTGCCAAGAAGCAAATGAGAATGTTAGACTAAGTTTCTCCTGT
GTTAGTGGAAAACAAGTGTGTCTATCTTTAAATATTCTTTGAATCAGGAGTTTGCGTTGTGTCACATCATATGGCTTTGCAGATCTTTTA
AAAACTGATGTTAAATAACTTATAAGTCCAACTTCTTAATATCAAGATAAATGAATAGTTCACCAATTTGGGAAGGAGGGCGGGTTGCAA
TTTGAGATAGTTTAAGGTTTAATTATTGAAAGACTGCCATCTTGTGGCACCAAAAGGTAATTTTTACATGATTATTTGTATAGTGATAAG
CAGTCCTGCTGTGTTAGCCTGGTCCATTATAGATATGGCATAGTTTTGGGTTCTCTAAATGGGTCCATACCTCTTTTGGGAAAAAACAGG
GCCACCTCATAATATTTGCCTGATTATGAATGGAATTACCTTAGAAATAAGGAACTAATCAGATTACTTAACCCCAATGACAAAATCCAC
AAAAATTTTGAAGGCAGAGAAACAGAAGGAATCCAGTGATGTTTTAGCTCCATTAGTCTAATAGGTCAGATATTAAAAAATTGTTCATAT
CAAAATTACCTTATATGGATTATTGCCATGTTTTTTGAGAGTTAATTATTTACTGTTTTCTAATTCTTGCCAGTATTTATGAACAGCTGT
AGCTTGATATTTACCTACTGAATTTTAGGAGAACTAATGGTCACAGTTTGGGTTCTTTTATGTGTATGTTTTTAAAACAGCTATTTTGTG
AATCTAGGTGGTTGGTTTTTAGAAGATTTCAGGAGATGCAGTCCAGCACAATTAGAGCTGGAACATTGTTACAGCAGGCTTTTTGTTGCT
CATGGGCAGATAGAGGGAAAGAATCAGTTGTTAGCCCCAAATTTCCACATTTCAGTGTTGTAAACTCTGAATGTGATAGGTAGATGTGGG
CTAAGAATAATTTCCTCCAGTGAAGACACGGGAGAAGAGCTTCTATTATGAGGTTATAGATAAGGCCTTAGTTATATCATGGAAATGGAC
TCCATGTAGTTCTAGAACTGCATTTCCCAAAGTATATCCTGTGAGATGCTCCACAGAAAAAATGATTGCATGGACTAAGTTTGAAAAATG
TTGCATGCTACTCTTCCCCTCGAAGATGACAGTGGATGTCAGCATTAAAGACTTTGACAGGTCTTTCTGTGAAAAAAAGAAAGCCACATA
ACTTTGTTGAACTTTGCCCAAATTAATTTTTCATTTTAAAAAACTTAATAGCCCATGAAAAGCAAATTTGGGAAATACATTTTTTAGGAA
AATACTGTCCCAGAATGCCATAATTAGGGTAGTTAATAATTAACACTTCCATTTCTCTTACTGGTTGTTGGGAGAATCTGATTGAAAATT
AGAATTACTTTGTTTTAACTTGCAGACATGTTCATCGTGAGTGAATGCTGGATTAAATAGAATTTTCTGTGTCTGCAACTTGTTTCATGA
CACCTTGGTTTTCTTAATCATCTTGTATTATTATTTGAGTGCAACATTATTCTTATGCATGGGTGACTGAAAAACCTGAAACAAGATTAC
TTGTTAAAAAAAAGTCTAAGAGACTAATGACTCATGCTTATGGCTCAGTGGGTAATGAATCAGTGTCACTGATTCTTACTTTTAAAATGT
GTAGTCAGTGAACATTTTCTAAATACTTTTCTTTGGGATACCATATGAAGATCTAATTCCTTATGTTTCAGTGTAGGAACAGCTACCTTC
TCAAATAGAATATGCAGGGAGGGAAGTAGGCAAACCATTTACAAGTTGGGTTTTTGTTTTGATTAACCTGTTAAGAGACACTTTTGTAAT
CTCTAGTGTTTACATTCCTTTATACTAGCTATCTATAAAGAGAATCCAGAAGGCTAAATTAATCAGAAATAATTATATTTCTATGTCAGG
GTATTGGCTATATGTAGCATGAACAATTCTCCATTTTCTGCAAATGGGTTTTTCAGGACAGTTTTATAATTCTGAGTTTGCTTTTTCTTA
TTCCCTAGACAGTTTGTACTCAGGGAATACAAATTGATTTTTACTGTTAAATGAGACATAGTTTAGAAAAAATCATAAGCAACTATTGTA
GATTTTTGATCTGTTTGGATTTATCTGTAGCATTGAATAATGTGCAGTGTACTGAGTTAATGTAGGCACCTCACTTTGGATTTATAAAAT
GTAAAAACCTGGAACATGCCTGCCACAGACACCACTTTGTCTATTCACCGGGTACTAATTTACATCCTATTAATGGTTGTAAAAGCTGAG
TGTCTAAATGCTAGACATGTTCACAATTTTGTCTGTTTTTGTTTATTTGTTTTTAAGACCCAAACCTTTTCAATCTTGCATTTATTTACT
TGGTTCTCCTGTGTCACCCTGTGGCTTTTTAAATAGGGAATGTAATTTATTTTAATAGTAGTTCTCAAAGACTCTATTAAAAACTCTGGA
CGAGGGATATGTGCAATCTGTTGGTAAGTCACATCCTATGTTTGGCCTCATTTTTATAACTCCTAAAATGAGAAAGGTAGATTTTAACAC
TTCTAAGGTACCTTTGAGCTTTAAAGTTCTTTTCTGCTTTTCCATATGATTTGTGTTAGTGTTCACTTTTTATATATTTAGAGTTTTTAT
ATGAGTGTGAATGTTTCTGTTTTGATTTGGTGAGGCATGTCAGAGGTATATACTTGAATATTTTTCTAAATACAGCTGCTGGAGGAATGC
AAATGGCAAAAATCATCCAGAAAACCAAACACGGTGAAACATCACATCCATTTGGCATGAAGCAAAGCATTACAAATTTGGAGTGATGAA
AGTGTTCCATATATTTTTTATAGTGATTTTTCGATCTAGAGACCCTTCATATTGTTTACTTACTATTACGATAACTTTGAGAGGTAACCA
GAGAAAGCATTTTTGCCATTTCCAGATGAGGAAGCAGGACCAGAAAGCTCTTCATAAAGCTTTAACACCATACAAGTATCCAGCAGTGAT
CAATTGCTCTTTATAGGAAACCACCTTTCCTCTGGGGAAGAACAGTCTGAATTAATAAAACATCAGAGTGGTTGAGTAGTAAAAATAAAC
ACAGATGTATTGCTTTCAAGTCTTAGAGTGACATAAAGTAGTCTTAAATAAATAGTTCTTAGTTTATTTTAAGCAGTTGATTGTACTAAC
GAGATGTAATTATCTGAAGTATTTATGATTAGCATATTGGTTTTTATAAGTATTTCTGAGTTATTGAGGGTGCTTAAAAATGCTGAAGAA
ACTTTAAAACATGATTCTTCTTATAATTTTATGTGATTCTTATAGCACAATCATTTTTGAAAAAGGAAAACTAGGCTGGGTGTAGTGGCT
CATGCCTATAATCCCAGCACTTTGGGAGGCCAAAGTGGGTGGATCACCCGAGTTCAGGAGTTCGAGACCAGTCTGGCCAACATGGTGAAA
CCTCGTCTCTACTAAAAATACCAAAATTATCCGGTGTGGTGACAGGCTGCTTGTAATCCCAGCTACTCGGGAGGCTGAGGCACGGGAATC
TCTTGAACCTGGGAGGCAGAGATTGCAATAAGCCAAGATCATGCCACTGCATGCCAGCCTGGGTGACAGCACAAGACTGTCTCAAAAAAA
AACAAAAAAAGGAAAAAGAAAACTAGCCCCAGTCCCTGTCTAAATTGTTATAGTTTTTGACTATTATCTGAATTAGTCTTATCCAAATTT
CATATGCAGATTGATTTTTCATTTTGTATGTATATTACATGATATAACTATTTTCATAGAATATATTTCTAATTTACAAACACTGAATTA
TTAGCTTGATAGAGTTTCTCCCAAACCTTATAAAACTTTGAAATGTACTTATGTTTGAGCTTTAAAAATTATAAAAACTTCATTTAAACA
AGTTGCTGGCATCATTACTAGCCTTTCCACCTATAATTATGATGCATTTGATGCCACTGAACAGTAATAGCACAAAGAACAGGTCACACA
GTCTAGACTGGATTGAGTTTTAATTAAACTTCTTCATCCATAGCCTGATAAGAATCAGGCTGGGTCTAGAAGAGTTATCAGACTGTAGGC
CTGTATTAATTTTGCAAGCTAATGTTAATGTTTACTGCCAGCCTTGCATAGCAATGCCAGTTTGCAGTTGTGACTATGATGTGACTTTTG
GTAAAAATGGTTTATATCTAAAGTAGTTTAGATTTTATGGAAGTGGCTCTTGATTGTTTGGACAAGCAGGGTAGGTAAATTTCAATTACG
TTTGAAGTGTAATTAAATCCTAGAATAGAGCACTCTCCAGAAAAAAAAATGAAAAAAGAATTTGGAGAATATCCTGGCATGAAAACTTTT
TTGAATAATACGTAGAATTTTGACAAGGTTCATACAGTGCATACAGTGTGACCTTTTCTGAGGTGGGCAGGGAGGGTTGCTACGTTGTGT
TGATTTAAAATTTCAAGGAGGAACAAAAACATTCTAGCCAAGGAGAATTGCATTGTTATTTTTTTTTCTACTAATTTAAACGTGCATTTT
TCACAGTTACACATTTAAGTTTTGCTACCAAAAATGGCCATTTTTCTAGACAGATAACATTTTCCTAAAGTGGAAGAGAGATCCACTGTT
CTAAAAAAAAAAAAAAAAAAAAACACTAAATTGTGCCTTCTCCCTTAAATTATAAGAAGAGTAATAGTAAAAACTTGTTTAAACTATATT
TTCTTTTTTTCTAATCCCTCTCAGTTCTCCTTAGATCTGCCTCCTACAAATGATCATGTTGTTTGCATCTGCCTGATTGAGTTCCCTTGG
TCAAACCTCTCCCTATCACTATCAGAAGTTGTTCACTAAATGTATTTTCCTATTTCTTTCATGTTGATTGACTTTATAAGTCACCTTGGT
AAACATAACATTTGGCTACCTTCTCATGCTTTATAAATGAATTTGATGAATGGCAGTTTTTATATTTTAACCCTTTAAAAAGTTTGTCAA
GGAAACAACTCAGAGCTAAGAACAAAATCTAACTTGGAATCAGTTTCTTCCTTTGGCTGCTGAAGCAGCAGCAAGTCACGTAACCTCATT
TAGTTTTTTGATTTACAAAATGTGGATAATAACCTACCTCACAGATGTGTGTGAGCAACTGTTTGAAAGCCCTTGTTTAAATACAGGGTT
TATATCCCCACATTCAATGTAAATTCCTTTTTTTAAAAAAAATAAGTATCTTTGATACTGATAGGATGAGTATCTTGATTTTTAGGTAAG
ATCACAGTTTCACAAATTGTGGTGTTGTTAGGTGACATTTAATATTTCTTGAGACCTCAAGTATTCAAATATCAAACTTGTCCTGTGTTG
TAACAAATATTCAGAATCTCTTAAAATGTTGGCTGAAGCTGCCTTAATGTACCAAAATACAGCTCTCAAGACTGTTCACAAATATCTGTG
GTTGTACAATGTTTTGAACATTTAATGTAAAGTTGTTGTAGAACTGTGAACTCTAAGGATAGTATCTTTATTGTTTTAGGAAGAATGGTT
GTGTTCTTTGTCATGTATGCTTAAATATACAGTGGATTTTGAATGCAACAAATAAAACTGAAAACAGCCATTTGGTTGTGTCATGACAAT
CATAATATAGGATATAATATTTACTTTTTTTCAAAAACATCCTGCATTCATTCATTCTTAGCATACCTTTGAAAAAGAAAAAAAAATCCA
TAGGTTGATACATTGACCCATTGAAGTACTTCATTACGTATTTATTGAAAATTTTTTTTAATTGTTGAAATTGGGACCACTTTTTATAAT
TGGTTTCAAGAAAAAAAAATGAACAGACTTCCAGTGCTTTTCTGTTCAAATAAACTCCGATTCAAATTTCAGTTTTGTTTGTTATATACT
TTTTGTGAGTGTTAAATGATATGGGAAGGATTTGTCTTTCATTAACCATATGGAAAAGATGTCTTCCTGAATTACATAGCATTTCATAGT
TACAGATTCTTCCTAATTAATGTTTGCACCATATGAAACTCATAGGTAACAAACACAAAGGAGAAAAGCAGCCTGTCTGATTGCTTATAA

>In-frame_BCAS3_ENST00000407086_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_9569nt
TGAGCCTAGAGCTGGAGACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGT
CGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTG
CCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCA
AGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGG
AGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTT
GGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGC
ACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAATTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATG
GAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGTCATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAAT
GTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTATCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGC
GGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTATGCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTG
TATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCTACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCA
GAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAGGTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAG
CATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGACCCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAA
GAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGTTTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTAT
CATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTCTACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGAT
AGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATGCCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTG
GATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCCAAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGAC
ATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGGAAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAAT
CCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTTGATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGAT
GAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGTTCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCC
ACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTGACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGT
CACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTAGCCCGTTGATCTGTCTCTAGTTTCTTTCTGTTATTGCACTAT
GAAAATCAGTTATATTCTTTAAATTTTTATCTTACTTTTGGATAATATCCACTGCAATACTAATTGAGAAACATGAATTATTTCCAGGGG
CACACAATGCTATTGAAATTACTGAAAACAAAATATCTGACATCTTATTTACTTGTAGAAATCTGTAATTCTATTGTGCCTATGATAAAT
TCACATAGGCAATATCTTTAATAGGTTAATATCAATGAAGATTTTTAATTACAATAATGAGTTCACTACAGACGATTAACACACCACACT
GGCGAACCATCTCAATGTAAGGGTGGTTTGGCAACACCTCCTTGCTTTGCTGTTTGGTGTAGGTAAATCTAGTTTACTTCCTAAATTTCA
GTAGGCTTTATGCTGTGTTTATGCCCCCAATTTATTTTAACAAAAGAAGATTAAAAAGTAAAAGAACCACGAGTAAGATATTATTTAAAT
GTTGAAATCTTAAAAACCTGCCTCCAAGATTTCAGAAGCCAAGTTTTTCTAACAGTATTTGTACAAATACTGCCTAGTGTATTCAACAGA
AGGACTGTGGTCATGTAACAGGTAACCACAATTTTCAGGTTTCTTAAAAACAGCTGTAACTAACTCAGGATTTTTATCTTGAGATTTCCC
TGAATAATATATTTATCTTAAGAGCCTTCAAGTTTCAAATTAATATTGGAACATCTGGAATTGCAACAACTTTTGTCTTTTACATAAACT
TACGTCATTTAAAAAATGTCTTCAAAATCTACCTTTCTCAAATTCTTTTTGCCTCTATTTATTTTTGCATTTCACCAACAGTGATAAAAT
AGTTAAATGAAACAAAGCAAAGTATCAACAGTCCCTTAAATGAGAATCCTTATCTTTGATCTTTATTTTCTGTGTTAGGTGTTAGGGTCC
TGGTGCAGCTCATAATGCTAATTCTTCATTGGAAGCCACTCCCTTCACCTCACCTCACCTAGTCACTATTGTCTTTGTTCATTGTTTGAT
CCTGAGTGGTTGATTGATATAGCTTTGAATCTTTTCTAGTCCAAGTTTGAAAACACTGTTCTGGCCCTAAGGGCTGGCTATGACCTTTAC
TGTTGAACCTGATAGGGCAGGGAAGCTTTGAACATCAAGAAAAAATTTTTATCTTAAATAAATAAATATATATATTCACACACCAGTGCT
TTTAAGCAAAAACCAGTTTTTTTGTTTGTTTGTTTTGCTTTGTGCAGGTTTTCTTTAAGATTAAAAAAACACAAACTATAGCAGGGTAGA
TAATAGTTTATTGATTATATTTTGTTTTAGTAAAAGTATTTAATTTTAAATTCTGTGTAATTTATCTAATTTGTATTTATTCATTTGTTA
TTTTTATGTTGTAATTAACACTTATTTACCTGGATTACCCTAAAAAAATTAAGCTCTTGAAAACAAAAAAATGACATTACCTTGACAGGC
TTCTCTTTGCCAAAAGTAATGTATGTTCTGCCAAGAAGCAAATGAGAATGTTAGACTAAGTTTCTCCTGTGTTAGTGGAAAACAAGTGTG
TCTATCTTTAAATATTCTTTGAATCAGGAGTTTGCGTTGTGTCACATCATATGGCTTTGCAGATCTTTTAAAAACTGATGTTAAATAACT
TATAAGTCCAACTTCTTAATATCAAGATAAATGAATAGTTCACCAATTTGGGAAGGAGGGCGGGTTGCAATTTGAGATAGTTTAAGGTTT
AATTATTGAAAGACTGCCATCTTGTGGCACCAAAAGGTAATTTTTACATGATTATTTGTATAGTGATAAGCAGTCCTGCTGTGTTAGCCT
GGTCCATTATAGATATGGCATAGTTTTGGGTTCTCTAAATGGGTCCATACCTCTTTTGGGAAAAAACAGGGCCACCTCATAATATTTGCC
TGATTATGAATGGAATTACCTTAGAAATAAGGAACTAATCAGATTACTTAACCCCAATGACAAAATCCACAAAAATTTTGAAGGCAGAGA
AACAGAAGGAATCCAGTGATGTTTTAGCTCCATTAGTCTAATAGGTCAGATATTAAAAAATTGTTCATATCAAAATTACCTTATATGGAT
TATTGCCATGTTTTTTGAGAGTTAATTATTTACTGTTTTCTAATTCTTGCCAGTATTTATGAACAGCTGTAGCTTGATATTTACCTACTG
AATTTTAGGAGAACTAATGGTCACAGTTTGGGTTCTTTTATGTGTATGTTTTTAAAACAGCTATTTTGTGAATCTAGGTGGTTGGTTTTT
AGAAGATTTCAGGAGATGCAGTCCAGCACAATTAGAGCTGGAACATTGTTACAGCAGGCTTTTTGTTGCTCATGGGCAGATAGAGGGAAA
GAATCAGTTGTTAGCCCCAAATTTCCACATTTCAGTGTTGTAAACTCTGAATGTGATAGGTAGATGTGGGCTAAGAATAATTTCCTCCAG
TGAAGACACGGGAGAAGAGCTTCTATTATGAGGTTATAGATAAGGCCTTAGTTATATCATGGAAATGGACTCCATGTAGTTCTAGAACTG
CATTTCCCAAAGTATATCCTGTGAGATGCTCCACAGAAAAAATGATTGCATGGACTAAGTTTGAAAAATGTTGCATGCTACTCTTCCCCT
CGAAGATGACAGTGGATGTCAGCATTAAAGACTTTGACAGGTCTTTCTGTGAAAAAAAGAAAGCCACATAACTTTGTTGAACTTTGCCCA
AATTAATTTTTCATTTTAAAAAACTTAATAGCCCATGAAAAGCAAATTTGGGAAATACATTTTTTAGGAAAATACTGTCCCAGAATGCCA
TAATTAGGGTAGTTAATAATTAACACTTCCATTTCTCTTACTGGTTGTTGGGAGAATCTGATTGAAAATTAGAATTACTTTGTTTTAACT
TGCAGACATGTTCATCGTGAGTGAATGCTGGATTAAATAGAATTTTCTGTGTCTGCAACTTGTTTCATGACACCTTGGTTTTCTTAATCA
TCTTGTATTATTATTTGAGTGCAACATTATTCTTATGCATGGGTGACTGAAAAACCTGAAACAAGATTACTTGTTAAAAAAAAGTCTAAG
AGACTAATGACTCATGCTTATGGCTCAGTGGGTAATGAATCAGTGTCACTGATTCTTACTTTTAAAATGTGTAGTCAGTGAACATTTTCT
AAATACTTTTCTTTGGGATACCATATGAAGATCTAATTCCTTATGTTTCAGTGTAGGAACAGCTACCTTCTCAAATAGAATATGCAGGGA
GGGAAGTAGGCAAACCATTTACAAGTTGGGTTTTTGTTTTGATTAACCTGTTAAGAGACACTTTTGTAATCTCTAGTGTTTACATTCCTT
TATACTAGCTATCTATAAAGAGAATCCAGAAGGCTAAATTAATCAGAAATAATTATATTTCTATGTCAGGGTATTGGCTATATGTAGCAT
GAACAATTCTCCATTTTCTGCAAATGGGTTTTTCAGGACAGTTTTATAATTCTGAGTTTGCTTTTTCTTATTCCCTAGACAGTTTGTACT
CAGGGAATACAAATTGATTTTTACTGTTAAATGAGACATAGTTTAGAAAAAATCATAAGCAACTATTGTAGATTTTTGATCTGTTTGGAT
TTATCTGTAGCATTGAATAATGTGCAGTGTACTGAGTTAATGTAGGCACCTCACTTTGGATTTATAAAATGTAAAAACCTGGAACATGCC
TGCCACAGACACCACTTTGTCTATTCACCGGGTACTAATTTACATCCTATTAATGGTTGTAAAAGCTGAGTGTCTAAATGCTAGACATGT
TCACAATTTTGTCTGTTTTTGTTTATTTGTTTTTAAGACCCAAACCTTTTCAATCTTGCATTTATTTACTTGGTTCTCCTGTGTCACCCT
GTGGCTTTTTAAATAGGGAATGTAATTTATTTTAATAGTAGTTCTCAAAGACTCTATTAAAAACTCTGGACGAGGGATATGTGCAATCTG
TTGGTAAGTCACATCCTATGTTTGGCCTCATTTTTATAACTCCTAAAATGAGAAAGGTAGATTTTAACACTTCTAAGGTACCTTTGAGCT
TTAAAGTTCTTTTCTGCTTTTCCATATGATTTGTGTTAGTGTTCACTTTTTATATATTTAGAGTTTTTATATGAGTGTGAATGTTTCTGT
TTTGATTTGGTGAGGCATGTCAGAGGTATATACTTGAATATTTTTCTAAATACAGCTGCTGGAGGAATGCAAATGGCAAAAATCATCCAG
AAAACCAAACACGGTGAAACATCACATCCATTTGGCATGAAGCAAAGCATTACAAATTTGGAGTGATGAAAGTGTTCCATATATTTTTTA
TAGTGATTTTTCGATCTAGAGACCCTTCATATTGTTTACTTACTATTACGATAACTTTGAGAGGTAACCAGAGAAAGCATTTTTGCCATT
TCCAGATGAGGAAGCAGGACCAGAAAGCTCTTCATAAAGCTTTAACACCATACAAGTATCCAGCAGTGATCAATTGCTCTTTATAGGAAA
CCACCTTTCCTCTGGGGAAGAACAGTCTGAATTAATAAAACATCAGAGTGGTTGAGTAGTAAAAATAAACACAGATGTATTGCTTTCAAG
TCTTAGAGTGACATAAAGTAGTCTTAAATAAATAGTTCTTAGTTTATTTTAAGCAGTTGATTGTACTAACGAGATGTAATTATCTGAAGT
ATTTATGATTAGCATATTGGTTTTTATAAGTATTTCTGAGTTATTGAGGGTGCTTAAAAATGCTGAAGAAACTTTAAAACATGATTCTTC
TTATAATTTTATGTGATTCTTATAGCACAATCATTTTTGAAAAAGGAAAACTAGGCTGGGTGTAGTGGCTCATGCCTATAATCCCAGCAC
TTTGGGAGGCCAAAGTGGGTGGATCACCCGAGTTCAGGAGTTCGAGACCAGTCTGGCCAACATGGTGAAACCTCGTCTCTACTAAAAATA
CCAAAATTATCCGGTGTGGTGACAGGCTGCTTGTAATCCCAGCTACTCGGGAGGCTGAGGCACGGGAATCTCTTGAACCTGGGAGGCAGA
GATTGCAATAAGCCAAGATCATGCCACTGCATGCCAGCCTGGGTGACAGCACAAGACTGTCTCAAAAAAAAACAAAAAAAGGAAAAAGAA
AACTAGCCCCAGTCCCTGTCTAAATTGTTATAGTTTTTGACTATTATCTGAATTAGTCTTATCCAAATTTCATATGCAGATTGATTTTTC
ATTTTGTATGTATATTACATGATATAACTATTTTCATAGAATATATTTCTAATTTACAAACACTGAATTATTAGCTTGATAGAGTTTCTC
CCAAACCTTATAAAACTTTGAAATGTACTTATGTTTGAGCTTTAAAAATTATAAAAACTTCATTTAAACAAGTTGCTGGCATCATTACTA
GCCTTTCCACCTATAATTATGATGCATTTGATGCCACTGAACAGTAATAGCACAAAGAACAGGTCACACAGTCTAGACTGGATTGAGTTT
TAATTAAACTTCTTCATCCATAGCCTGATAAGAATCAGGCTGGGTCTAGAAGAGTTATCAGACTGTAGGCCTGTATTAATTTTGCAAGCT
AATGTTAATGTTTACTGCCAGCCTTGCATAGCAATGCCAGTTTGCAGTTGTGACTATGATGTGACTTTTGGTAAAAATGGTTTATATCTA
AAGTAGTTTAGATTTTATGGAAGTGGCTCTTGATTGTTTGGACAAGCAGGGTAGGTAAATTTCAATTACGTTTGAAGTGTAATTAAATCC
TAGAATAGAGCACTCTCCAGAAAAAAAAATGAAAAAAGAATTTGGAGAATATCCTGGCATGAAAACTTTTTTGAATAATACGTAGAATTT
TGACAAGGTTCATACAGTGCATACAGTGTGACCTTTTCTGAGGTGGGCAGGGAGGGTTGCTACGTTGTGTTGATTTAAAATTTCAAGGAG
GAACAAAAACATTCTAGCCAAGGAGAATTGCATTGTTATTTTTTTTTCTACTAATTTAAACGTGCATTTTTCACAGTTACACATTTAAGT
TTTGCTACCAAAAATGGCCATTTTTCTAGACAGATAACATTTTCCTAAAGTGGAAGAGAGATCCACTGTTCTAAAAAAAAAAAAAAAAAA
AAACACTAAATTGTGCCTTCTCCCTTAAATTATAAGAAGAGTAATAGTAAAAACTTGTTTAAACTATATTTTCTTTTTTTCTAATCCCTC
TCAGTTCTCCTTAGATCTGCCTCCTACAAATGATCATGTTGTTTGCATCTGCCTGATTGAGTTCCCTTGGTCAAACCTCTCCCTATCACT
ATCAGAAGTTGTTCACTAAATGTATTTTCCTATTTCTTTCATGTTGATTGACTTTATAAGTCACCTTGGTAAACATAACATTTGGCTACC
TTCTCATGCTTTATAAATGAATTTGATGAATGGCAGTTTTTATATTTTAACCCTTTAAAAAGTTTGTCAAGGAAACAACTCAGAGCTAAG
AACAAAATCTAACTTGGAATCAGTTTCTTCCTTTGGCTGCTGAAGCAGCAGCAAGTCACGTAACCTCATTTAGTTTTTTGATTTACAAAA
TGTGGATAATAACCTACCTCACAGATGTGTGTGAGCAACTGTTTGAAAGCCCTTGTTTAAATACAGGGTTTATATCCCCACATTCAATGT
AAATTCCTTTTTTTAAAAAAAATAAGTATCTTTGATACTGATAGGATGAGTATCTTGATTTTTAGGTAAGATCACAGTTTCACAAATTGT
GGTGTTGTTAGGTGACATTTAATATTTCTTGAGACCTCAAGTATTCAAATATCAAACTTGTCCTGTGTTGTAACAAATATTCAGAATCTC
TTAAAATGTTGGCTGAAGCTGCCTTAATGTACCAAAATACAGCTCTCAAGACTGTTCACAAATATCTGTGGTTGTACAATGTTTTGAACA
TTTAATGTAAAGTTGTTGTAGAACTGTGAACTCTAAGGATAGTATCTTTATTGTTTTAGGAAGAATGGTTGTGTTCTTTGTCATGTATGC
TTAAATATACAGTGGATTTTGAATGCAACAAATAAAACTGAAAACAGCCATTTGGTTGTGTCATGACAATCATAATATAGGATATAATAT
TTACTTTTTTTCAAAAACATCCTGCATTCATTCATTCTTAGCATACCTTTGAAAAAGAAAAAAAAATCCATAGGTTGATACATTGACCCA
TTGAAGTACTTCATTACGTATTTATTGAAAATTTTTTTTAATTGTTGAAATTGGGACCACTTTTTATAATTGGTTTCAAGAAAAAAAAAT
GAACAGACTTCCAGTGCTTTTCTGTTCAAATAAACTCCGATTCAAATTTCAGTTTTGTTTGTTATATACTTTTTGTGAGTGTTAAATGAT
ATGGGAAGGATTTGTCTTTCATTAACCATATGGAAAAGATGTCTTCCTGAATTACATAGCATTTCATAGTTACAGATTCTTCCTAATTAA
TGTTTGCACCATATGAAACTCATAGGTAACAAACACAAAGGAGAAAAGCAGCCTGTCTGATTGCTTATAAGCTTTTTTCACAAAATCAAA

>In-frame_BCAS3_ENST00000390652_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_9552nt
ACTAGCGTTAACCGGCGGGGCGGCCGGTTTTATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGT
TGTGGTTCGCCCCCAGGCTGTCACAGAGCAGTCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGG
AACACCTCTAACAGAAGAAAAGGAGAAAATAGTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCA
TGAAATACATAGTACTGGGAATGAACCGCCTTTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGG
TGAAGCACAAGAGCTCTTCTCTGTTCGACATGGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGA
TAACTTTGCTGAAAAAAGACCCCTCCTTGGTGTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTT
TATGGTAATGGAATATGTGTCTGGAGGTGAATTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTT
TCAGCAGATTCTGTCTGCTGTGGATTACTGTCATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACA
CATGAATGCCAAGATAGCCGATTTCGGATTATCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGC
AGCACCTGAAGTCATCTCAGGCAGATTGTATGCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGG
CACCCTCCCATTTGATGATGAGCATGTACCTACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTC
TGTCGCCACTCTCCTGATGCATATGCTGCAGGTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACA
AGATTTGCCCAGTTACTTATTTCCTGAAGACCCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATT
TGAATGTACAGAATCAGAAGTAATGAACAGTTTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAA
TCGGAGAATAATGAACCAAGCCAGTGAGTTCTACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCC
CCCAGGCCTGAAACCTCATCCAGAAAGGATGCCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGAC
TAAGCCCAAATCTTTAGCTGTGAAAAAAGCCAAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTA
CCGAGCTATGAAGCAGCTGGATTTTGAATGGAAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTA
CGTGAAAATGAGCTTACAACTTTACCTGGTTGATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAG
ATCTGGTTCCTCAACACCTCAGCGTTCCTGTTCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCA
TTCACTTTCTGGCTCTCTCACTGGCTCTTTGACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTT
TGAAATGTGTGCCAGTCTGATTACTACTTTAGCCCGTTGATCTGTCTCTAGTTTCTTTCTGTTATTGCACTATGAAAATCAGTTATATTC
TTTAAATTTTTATCTTACTTTTGGATAATATCCACTGCAATACTAATTGAGAAACATGAATTATTTCCAGGGGCACACAATGCTATTGAA
ATTACTGAAAACAAAATATCTGACATCTTATTTACTTGTAGAAATCTGTAATTCTATTGTGCCTATGATAAATTCACATAGGCAATATCT
TTAATAGGTTAATATCAATGAAGATTTTTAATTACAATAATGAGTTCACTACAGACGATTAACACACCACACTGGCGAACCATCTCAATG
TAAGGGTGGTTTGGCAACACCTCCTTGCTTTGCTGTTTGGTGTAGGTAAATCTAGTTTACTTCCTAAATTTCAGTAGGCTTTATGCTGTG
TTTATGCCCCCAATTTATTTTAACAAAAGAAGATTAAAAAGTAAAAGAACCACGAGTAAGATATTATTTAAATGTTGAAATCTTAAAAAC
CTGCCTCCAAGATTTCAGAAGCCAAGTTTTTCTAACAGTATTTGTACAAATACTGCCTAGTGTATTCAACAGAAGGACTGTGGTCATGTA
ACAGGTAACCACAATTTTCAGGTTTCTTAAAAACAGCTGTAACTAACTCAGGATTTTTATCTTGAGATTTCCCTGAATAATATATTTATC
TTAAGAGCCTTCAAGTTTCAAATTAATATTGGAACATCTGGAATTGCAACAACTTTTGTCTTTTACATAAACTTACGTCATTTAAAAAAT
GTCTTCAAAATCTACCTTTCTCAAATTCTTTTTGCCTCTATTTATTTTTGCATTTCACCAACAGTGATAAAATAGTTAAATGAAACAAAG
CAAAGTATCAACAGTCCCTTAAATGAGAATCCTTATCTTTGATCTTTATTTTCTGTGTTAGGTGTTAGGGTCCTGGTGCAGCTCATAATG
CTAATTCTTCATTGGAAGCCACTCCCTTCACCTCACCTCACCTAGTCACTATTGTCTTTGTTCATTGTTTGATCCTGAGTGGTTGATTGA
TATAGCTTTGAATCTTTTCTAGTCCAAGTTTGAAAACACTGTTCTGGCCCTAAGGGCTGGCTATGACCTTTACTGTTGAACCTGATAGGG
CAGGGAAGCTTTGAACATCAAGAAAAAATTTTTATCTTAAATAAATAAATATATATATTCACACACCAGTGCTTTTAAGCAAAAACCAGT
TTTTTTGTTTGTTTGTTTTGCTTTGTGCAGGTTTTCTTTAAGATTAAAAAAACACAAACTATAGCAGGGTAGATAATAGTTTATTGATTA
TATTTTGTTTTAGTAAAAGTATTTAATTTTAAATTCTGTGTAATTTATCTAATTTGTATTTATTCATTTGTTATTTTTATGTTGTAATTA
ACACTTATTTACCTGGATTACCCTAAAAAAATTAAGCTCTTGAAAACAAAAAAATGACATTACCTTGACAGGCTTCTCTTTGCCAAAAGT
AATGTATGTTCTGCCAAGAAGCAAATGAGAATGTTAGACTAAGTTTCTCCTGTGTTAGTGGAAAACAAGTGTGTCTATCTTTAAATATTC
TTTGAATCAGGAGTTTGCGTTGTGTCACATCATATGGCTTTGCAGATCTTTTAAAAACTGATGTTAAATAACTTATAAGTCCAACTTCTT
AATATCAAGATAAATGAATAGTTCACCAATTTGGGAAGGAGGGCGGGTTGCAATTTGAGATAGTTTAAGGTTTAATTATTGAAAGACTGC
CATCTTGTGGCACCAAAAGGTAATTTTTACATGATTATTTGTATAGTGATAAGCAGTCCTGCTGTGTTAGCCTGGTCCATTATAGATATG
GCATAGTTTTGGGTTCTCTAAATGGGTCCATACCTCTTTTGGGAAAAAACAGGGCCACCTCATAATATTTGCCTGATTATGAATGGAATT
ACCTTAGAAATAAGGAACTAATCAGATTACTTAACCCCAATGACAAAATCCACAAAAATTTTGAAGGCAGAGAAACAGAAGGAATCCAGT
GATGTTTTAGCTCCATTAGTCTAATAGGTCAGATATTAAAAAATTGTTCATATCAAAATTACCTTATATGGATTATTGCCATGTTTTTTG
AGAGTTAATTATTTACTGTTTTCTAATTCTTGCCAGTATTTATGAACAGCTGTAGCTTGATATTTACCTACTGAATTTTAGGAGAACTAA
TGGTCACAGTTTGGGTTCTTTTATGTGTATGTTTTTAAAACAGCTATTTTGTGAATCTAGGTGGTTGGTTTTTAGAAGATTTCAGGAGAT
GCAGTCCAGCACAATTAGAGCTGGAACATTGTTACAGCAGGCTTTTTGTTGCTCATGGGCAGATAGAGGGAAAGAATCAGTTGTTAGCCC
CAAATTTCCACATTTCAGTGTTGTAAACTCTGAATGTGATAGGTAGATGTGGGCTAAGAATAATTTCCTCCAGTGAAGACACGGGAGAAG
AGCTTCTATTATGAGGTTATAGATAAGGCCTTAGTTATATCATGGAAATGGACTCCATGTAGTTCTAGAACTGCATTTCCCAAAGTATAT
CCTGTGAGATGCTCCACAGAAAAAATGATTGCATGGACTAAGTTTGAAAAATGTTGCATGCTACTCTTCCCCTCGAAGATGACAGTGGAT
GTCAGCATTAAAGACTTTGACAGGTCTTTCTGTGAAAAAAAGAAAGCCACATAACTTTGTTGAACTTTGCCCAAATTAATTTTTCATTTT
AAAAAACTTAATAGCCCATGAAAAGCAAATTTGGGAAATACATTTTTTAGGAAAATACTGTCCCAGAATGCCATAATTAGGGTAGTTAAT
AATTAACACTTCCATTTCTCTTACTGGTTGTTGGGAGAATCTGATTGAAAATTAGAATTACTTTGTTTTAACTTGCAGACATGTTCATCG
TGAGTGAATGCTGGATTAAATAGAATTTTCTGTGTCTGCAACTTGTTTCATGACACCTTGGTTTTCTTAATCATCTTGTATTATTATTTG
AGTGCAACATTATTCTTATGCATGGGTGACTGAAAAACCTGAAACAAGATTACTTGTTAAAAAAAAGTCTAAGAGACTAATGACTCATGC
TTATGGCTCAGTGGGTAATGAATCAGTGTCACTGATTCTTACTTTTAAAATGTGTAGTCAGTGAACATTTTCTAAATACTTTTCTTTGGG
ATACCATATGAAGATCTAATTCCTTATGTTTCAGTGTAGGAACAGCTACCTTCTCAAATAGAATATGCAGGGAGGGAAGTAGGCAAACCA
TTTACAAGTTGGGTTTTTGTTTTGATTAACCTGTTAAGAGACACTTTTGTAATCTCTAGTGTTTACATTCCTTTATACTAGCTATCTATA
AAGAGAATCCAGAAGGCTAAATTAATCAGAAATAATTATATTTCTATGTCAGGGTATTGGCTATATGTAGCATGAACAATTCTCCATTTT
CTGCAAATGGGTTTTTCAGGACAGTTTTATAATTCTGAGTTTGCTTTTTCTTATTCCCTAGACAGTTTGTACTCAGGGAATACAAATTGA
TTTTTACTGTTAAATGAGACATAGTTTAGAAAAAATCATAAGCAACTATTGTAGATTTTTGATCTGTTTGGATTTATCTGTAGCATTGAA
TAATGTGCAGTGTACTGAGTTAATGTAGGCACCTCACTTTGGATTTATAAAATGTAAAAACCTGGAACATGCCTGCCACAGACACCACTT
TGTCTATTCACCGGGTACTAATTTACATCCTATTAATGGTTGTAAAAGCTGAGTGTCTAAATGCTAGACATGTTCACAATTTTGTCTGTT
TTTGTTTATTTGTTTTTAAGACCCAAACCTTTTCAATCTTGCATTTATTTACTTGGTTCTCCTGTGTCACCCTGTGGCTTTTTAAATAGG
GAATGTAATTTATTTTAATAGTAGTTCTCAAAGACTCTATTAAAAACTCTGGACGAGGGATATGTGCAATCTGTTGGTAAGTCACATCCT
ATGTTTGGCCTCATTTTTATAACTCCTAAAATGAGAAAGGTAGATTTTAACACTTCTAAGGTACCTTTGAGCTTTAAAGTTCTTTTCTGC
TTTTCCATATGATTTGTGTTAGTGTTCACTTTTTATATATTTAGAGTTTTTATATGAGTGTGAATGTTTCTGTTTTGATTTGGTGAGGCA
TGTCAGAGGTATATACTTGAATATTTTTCTAAATACAGCTGCTGGAGGAATGCAAATGGCAAAAATCATCCAGAAAACCAAACACGGTGA
AACATCACATCCATTTGGCATGAAGCAAAGCATTACAAATTTGGAGTGATGAAAGTGTTCCATATATTTTTTATAGTGATTTTTCGATCT
AGAGACCCTTCATATTGTTTACTTACTATTACGATAACTTTGAGAGGTAACCAGAGAAAGCATTTTTGCCATTTCCAGATGAGGAAGCAG
GACCAGAAAGCTCTTCATAAAGCTTTAACACCATACAAGTATCCAGCAGTGATCAATTGCTCTTTATAGGAAACCACCTTTCCTCTGGGG
AAGAACAGTCTGAATTAATAAAACATCAGAGTGGTTGAGTAGTAAAAATAAACACAGATGTATTGCTTTCAAGTCTTAGAGTGACATAAA
GTAGTCTTAAATAAATAGTTCTTAGTTTATTTTAAGCAGTTGATTGTACTAACGAGATGTAATTATCTGAAGTATTTATGATTAGCATAT
TGGTTTTTATAAGTATTTCTGAGTTATTGAGGGTGCTTAAAAATGCTGAAGAAACTTTAAAACATGATTCTTCTTATAATTTTATGTGAT
TCTTATAGCACAATCATTTTTGAAAAAGGAAAACTAGGCTGGGTGTAGTGGCTCATGCCTATAATCCCAGCACTTTGGGAGGCCAAAGTG
GGTGGATCACCCGAGTTCAGGAGTTCGAGACCAGTCTGGCCAACATGGTGAAACCTCGTCTCTACTAAAAATACCAAAATTATCCGGTGT
GGTGACAGGCTGCTTGTAATCCCAGCTACTCGGGAGGCTGAGGCACGGGAATCTCTTGAACCTGGGAGGCAGAGATTGCAATAAGCCAAG
ATCATGCCACTGCATGCCAGCCTGGGTGACAGCACAAGACTGTCTCAAAAAAAAACAAAAAAAGGAAAAAGAAAACTAGCCCCAGTCCCT
GTCTAAATTGTTATAGTTTTTGACTATTATCTGAATTAGTCTTATCCAAATTTCATATGCAGATTGATTTTTCATTTTGTATGTATATTA
CATGATATAACTATTTTCATAGAATATATTTCTAATTTACAAACACTGAATTATTAGCTTGATAGAGTTTCTCCCAAACCTTATAAAACT
TTGAAATGTACTTATGTTTGAGCTTTAAAAATTATAAAAACTTCATTTAAACAAGTTGCTGGCATCATTACTAGCCTTTCCACCTATAAT
TATGATGCATTTGATGCCACTGAACAGTAATAGCACAAAGAACAGGTCACACAGTCTAGACTGGATTGAGTTTTAATTAAACTTCTTCAT
CCATAGCCTGATAAGAATCAGGCTGGGTCTAGAAGAGTTATCAGACTGTAGGCCTGTATTAATTTTGCAAGCTAATGTTAATGTTTACTG
CCAGCCTTGCATAGCAATGCCAGTTTGCAGTTGTGACTATGATGTGACTTTTGGTAAAAATGGTTTATATCTAAAGTAGTTTAGATTTTA
TGGAAGTGGCTCTTGATTGTTTGGACAAGCAGGGTAGGTAAATTTCAATTACGTTTGAAGTGTAATTAAATCCTAGAATAGAGCACTCTC
CAGAAAAAAAAATGAAAAAAGAATTTGGAGAATATCCTGGCATGAAAACTTTTTTGAATAATACGTAGAATTTTGACAAGGTTCATACAG
TGCATACAGTGTGACCTTTTCTGAGGTGGGCAGGGAGGGTTGCTACGTTGTGTTGATTTAAAATTTCAAGGAGGAACAAAAACATTCTAG
CCAAGGAGAATTGCATTGTTATTTTTTTTTCTACTAATTTAAACGTGCATTTTTCACAGTTACACATTTAAGTTTTGCTACCAAAAATGG
CCATTTTTCTAGACAGATAACATTTTCCTAAAGTGGAAGAGAGATCCACTGTTCTAAAAAAAAAAAAAAAAAAAAACACTAAATTGTGCC
TTCTCCCTTAAATTATAAGAAGAGTAATAGTAAAAACTTGTTTAAACTATATTTTCTTTTTTTCTAATCCCTCTCAGTTCTCCTTAGATC
TGCCTCCTACAAATGATCATGTTGTTTGCATCTGCCTGATTGAGTTCCCTTGGTCAAACCTCTCCCTATCACTATCAGAAGTTGTTCACT
AAATGTATTTTCCTATTTCTTTCATGTTGATTGACTTTATAAGTCACCTTGGTAAACATAACATTTGGCTACCTTCTCATGCTTTATAAA
TGAATTTGATGAATGGCAGTTTTTATATTTTAACCCTTTAAAAAGTTTGTCAAGGAAACAACTCAGAGCTAAGAACAAAATCTAACTTGG
AATCAGTTTCTTCCTTTGGCTGCTGAAGCAGCAGCAAGTCACGTAACCTCATTTAGTTTTTTGATTTACAAAATGTGGATAATAACCTAC
CTCACAGATGTGTGTGAGCAACTGTTTGAAAGCCCTTGTTTAAATACAGGGTTTATATCCCCACATTCAATGTAAATTCCTTTTTTTAAA
AAAAATAAGTATCTTTGATACTGATAGGATGAGTATCTTGATTTTTAGGTAAGATCACAGTTTCACAAATTGTGGTGTTGTTAGGTGACA
TTTAATATTTCTTGAGACCTCAAGTATTCAAATATCAAACTTGTCCTGTGTTGTAACAAATATTCAGAATCTCTTAAAATGTTGGCTGAA
GCTGCCTTAATGTACCAAAATACAGCTCTCAAGACTGTTCACAAATATCTGTGGTTGTACAATGTTTTGAACATTTAATGTAAAGTTGTT
GTAGAACTGTGAACTCTAAGGATAGTATCTTTATTGTTTTAGGAAGAATGGTTGTGTTCTTTGTCATGTATGCTTAAATATACAGTGGAT
TTTGAATGCAACAAATAAAACTGAAAACAGCCATTTGGTTGTGTCATGACAATCATAATATAGGATATAATATTTACTTTTTTTCAAAAA
CATCCTGCATTCATTCATTCTTAGCATACCTTTGAAAAAGAAAAAAAAATCCATAGGTTGATACATTGACCCATTGAAGTACTTCATTAC
GTATTTATTGAAAATTTTTTTTAATTGTTGAAATTGGGACCACTTTTTATAATTGGTTTCAAGAAAAAAAAATGAACAGACTTCCAGTGC
TTTTCTGTTCAAATAAACTCCGATTCAAATTTCAGTTTTGTTTGTTATATACTTTTTGTGAGTGTTAAATGATATGGGAAGGATTTGTCT
TTCATTAACCATATGGAAAAGATGTCTTCCTGAATTACATAGCATTTCATAGTTACAGATTCTTCCTAATTAATGTTTGCACCATATGAA
ACTCATAGGTAACAAACACAAAGGAGAAAAGCAGCCTGTCTGATTGCTTATAAGCTTTTTTCACAAAATCAAATTAAAAGTCTCTGATTC

>In-frame_BCAS3_ENST00000408905_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_9521nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA
GCCCGTTGATCTGTCTCTAGTTTCTTTCTGTTATTGCACTATGAAAATCAGTTATATTCTTTAAATTTTTATCTTACTTTTGGATAATAT
CCACTGCAATACTAATTGAGAAACATGAATTATTTCCAGGGGCACACAATGCTATTGAAATTACTGAAAACAAAATATCTGACATCTTAT
TTACTTGTAGAAATCTGTAATTCTATTGTGCCTATGATAAATTCACATAGGCAATATCTTTAATAGGTTAATATCAATGAAGATTTTTAA
TTACAATAATGAGTTCACTACAGACGATTAACACACCACACTGGCGAACCATCTCAATGTAAGGGTGGTTTGGCAACACCTCCTTGCTTT
GCTGTTTGGTGTAGGTAAATCTAGTTTACTTCCTAAATTTCAGTAGGCTTTATGCTGTGTTTATGCCCCCAATTTATTTTAACAAAAGAA
GATTAAAAAGTAAAAGAACCACGAGTAAGATATTATTTAAATGTTGAAATCTTAAAAACCTGCCTCCAAGATTTCAGAAGCCAAGTTTTT
CTAACAGTATTTGTACAAATACTGCCTAGTGTATTCAACAGAAGGACTGTGGTCATGTAACAGGTAACCACAATTTTCAGGTTTCTTAAA
AACAGCTGTAACTAACTCAGGATTTTTATCTTGAGATTTCCCTGAATAATATATTTATCTTAAGAGCCTTCAAGTTTCAAATTAATATTG
GAACATCTGGAATTGCAACAACTTTTGTCTTTTACATAAACTTACGTCATTTAAAAAATGTCTTCAAAATCTACCTTTCTCAAATTCTTT
TTGCCTCTATTTATTTTTGCATTTCACCAACAGTGATAAAATAGTTAAATGAAACAAAGCAAAGTATCAACAGTCCCTTAAATGAGAATC
CTTATCTTTGATCTTTATTTTCTGTGTTAGGTGTTAGGGTCCTGGTGCAGCTCATAATGCTAATTCTTCATTGGAAGCCACTCCCTTCAC
CTCACCTCACCTAGTCACTATTGTCTTTGTTCATTGTTTGATCCTGAGTGGTTGATTGATATAGCTTTGAATCTTTTCTAGTCCAAGTTT
GAAAACACTGTTCTGGCCCTAAGGGCTGGCTATGACCTTTACTGTTGAACCTGATAGGGCAGGGAAGCTTTGAACATCAAGAAAAAATTT
TTATCTTAAATAAATAAATATATATATTCACACACCAGTGCTTTTAAGCAAAAACCAGTTTTTTTGTTTGTTTGTTTTGCTTTGTGCAGG
TTTTCTTTAAGATTAAAAAAACACAAACTATAGCAGGGTAGATAATAGTTTATTGATTATATTTTGTTTTAGTAAAAGTATTTAATTTTA
AATTCTGTGTAATTTATCTAATTTGTATTTATTCATTTGTTATTTTTATGTTGTAATTAACACTTATTTACCTGGATTACCCTAAAAAAA
TTAAGCTCTTGAAAACAAAAAAATGACATTACCTTGACAGGCTTCTCTTTGCCAAAAGTAATGTATGTTCTGCCAAGAAGCAAATGAGAA
TGTTAGACTAAGTTTCTCCTGTGTTAGTGGAAAACAAGTGTGTCTATCTTTAAATATTCTTTGAATCAGGAGTTTGCGTTGTGTCACATC
ATATGGCTTTGCAGATCTTTTAAAAACTGATGTTAAATAACTTATAAGTCCAACTTCTTAATATCAAGATAAATGAATAGTTCACCAATT
TGGGAAGGAGGGCGGGTTGCAATTTGAGATAGTTTAAGGTTTAATTATTGAAAGACTGCCATCTTGTGGCACCAAAAGGTAATTTTTACA
TGATTATTTGTATAGTGATAAGCAGTCCTGCTGTGTTAGCCTGGTCCATTATAGATATGGCATAGTTTTGGGTTCTCTAAATGGGTCCAT
ACCTCTTTTGGGAAAAAACAGGGCCACCTCATAATATTTGCCTGATTATGAATGGAATTACCTTAGAAATAAGGAACTAATCAGATTACT
TAACCCCAATGACAAAATCCACAAAAATTTTGAAGGCAGAGAAACAGAAGGAATCCAGTGATGTTTTAGCTCCATTAGTCTAATAGGTCA
GATATTAAAAAATTGTTCATATCAAAATTACCTTATATGGATTATTGCCATGTTTTTTGAGAGTTAATTATTTACTGTTTTCTAATTCTT
GCCAGTATTTATGAACAGCTGTAGCTTGATATTTACCTACTGAATTTTAGGAGAACTAATGGTCACAGTTTGGGTTCTTTTATGTGTATG
TTTTTAAAACAGCTATTTTGTGAATCTAGGTGGTTGGTTTTTAGAAGATTTCAGGAGATGCAGTCCAGCACAATTAGAGCTGGAACATTG
TTACAGCAGGCTTTTTGTTGCTCATGGGCAGATAGAGGGAAAGAATCAGTTGTTAGCCCCAAATTTCCACATTTCAGTGTTGTAAACTCT
GAATGTGATAGGTAGATGTGGGCTAAGAATAATTTCCTCCAGTGAAGACACGGGAGAAGAGCTTCTATTATGAGGTTATAGATAAGGCCT
TAGTTATATCATGGAAATGGACTCCATGTAGTTCTAGAACTGCATTTCCCAAAGTATATCCTGTGAGATGCTCCACAGAAAAAATGATTG
CATGGACTAAGTTTGAAAAATGTTGCATGCTACTCTTCCCCTCGAAGATGACAGTGGATGTCAGCATTAAAGACTTTGACAGGTCTTTCT
GTGAAAAAAAGAAAGCCACATAACTTTGTTGAACTTTGCCCAAATTAATTTTTCATTTTAAAAAACTTAATAGCCCATGAAAAGCAAATT
TGGGAAATACATTTTTTAGGAAAATACTGTCCCAGAATGCCATAATTAGGGTAGTTAATAATTAACACTTCCATTTCTCTTACTGGTTGT
TGGGAGAATCTGATTGAAAATTAGAATTACTTTGTTTTAACTTGCAGACATGTTCATCGTGAGTGAATGCTGGATTAAATAGAATTTTCT
GTGTCTGCAACTTGTTTCATGACACCTTGGTTTTCTTAATCATCTTGTATTATTATTTGAGTGCAACATTATTCTTATGCATGGGTGACT
GAAAAACCTGAAACAAGATTACTTGTTAAAAAAAAGTCTAAGAGACTAATGACTCATGCTTATGGCTCAGTGGGTAATGAATCAGTGTCA
CTGATTCTTACTTTTAAAATGTGTAGTCAGTGAACATTTTCTAAATACTTTTCTTTGGGATACCATATGAAGATCTAATTCCTTATGTTT
CAGTGTAGGAACAGCTACCTTCTCAAATAGAATATGCAGGGAGGGAAGTAGGCAAACCATTTACAAGTTGGGTTTTTGTTTTGATTAACC
TGTTAAGAGACACTTTTGTAATCTCTAGTGTTTACATTCCTTTATACTAGCTATCTATAAAGAGAATCCAGAAGGCTAAATTAATCAGAA
ATAATTATATTTCTATGTCAGGGTATTGGCTATATGTAGCATGAACAATTCTCCATTTTCTGCAAATGGGTTTTTCAGGACAGTTTTATA
ATTCTGAGTTTGCTTTTTCTTATTCCCTAGACAGTTTGTACTCAGGGAATACAAATTGATTTTTACTGTTAAATGAGACATAGTTTAGAA
AAAATCATAAGCAACTATTGTAGATTTTTGATCTGTTTGGATTTATCTGTAGCATTGAATAATGTGCAGTGTACTGAGTTAATGTAGGCA
CCTCACTTTGGATTTATAAAATGTAAAAACCTGGAACATGCCTGCCACAGACACCACTTTGTCTATTCACCGGGTACTAATTTACATCCT
ATTAATGGTTGTAAAAGCTGAGTGTCTAAATGCTAGACATGTTCACAATTTTGTCTGTTTTTGTTTATTTGTTTTTAAGACCCAAACCTT
TTCAATCTTGCATTTATTTACTTGGTTCTCCTGTGTCACCCTGTGGCTTTTTAAATAGGGAATGTAATTTATTTTAATAGTAGTTCTCAA
AGACTCTATTAAAAACTCTGGACGAGGGATATGTGCAATCTGTTGGTAAGTCACATCCTATGTTTGGCCTCATTTTTATAACTCCTAAAA
TGAGAAAGGTAGATTTTAACACTTCTAAGGTACCTTTGAGCTTTAAAGTTCTTTTCTGCTTTTCCATATGATTTGTGTTAGTGTTCACTT
TTTATATATTTAGAGTTTTTATATGAGTGTGAATGTTTCTGTTTTGATTTGGTGAGGCATGTCAGAGGTATATACTTGAATATTTTTCTA
AATACAGCTGCTGGAGGAATGCAAATGGCAAAAATCATCCAGAAAACCAAACACGGTGAAACATCACATCCATTTGGCATGAAGCAAAGC
ATTACAAATTTGGAGTGATGAAAGTGTTCCATATATTTTTTATAGTGATTTTTCGATCTAGAGACCCTTCATATTGTTTACTTACTATTA
CGATAACTTTGAGAGGTAACCAGAGAAAGCATTTTTGCCATTTCCAGATGAGGAAGCAGGACCAGAAAGCTCTTCATAAAGCTTTAACAC
CATACAAGTATCCAGCAGTGATCAATTGCTCTTTATAGGAAACCACCTTTCCTCTGGGGAAGAACAGTCTGAATTAATAAAACATCAGAG
TGGTTGAGTAGTAAAAATAAACACAGATGTATTGCTTTCAAGTCTTAGAGTGACATAAAGTAGTCTTAAATAAATAGTTCTTAGTTTATT
TTAAGCAGTTGATTGTACTAACGAGATGTAATTATCTGAAGTATTTATGATTAGCATATTGGTTTTTATAAGTATTTCTGAGTTATTGAG
GGTGCTTAAAAATGCTGAAGAAACTTTAAAACATGATTCTTCTTATAATTTTATGTGATTCTTATAGCACAATCATTTTTGAAAAAGGAA
AACTAGGCTGGGTGTAGTGGCTCATGCCTATAATCCCAGCACTTTGGGAGGCCAAAGTGGGTGGATCACCCGAGTTCAGGAGTTCGAGAC
CAGTCTGGCCAACATGGTGAAACCTCGTCTCTACTAAAAATACCAAAATTATCCGGTGTGGTGACAGGCTGCTTGTAATCCCAGCTACTC
GGGAGGCTGAGGCACGGGAATCTCTTGAACCTGGGAGGCAGAGATTGCAATAAGCCAAGATCATGCCACTGCATGCCAGCCTGGGTGACA
GCACAAGACTGTCTCAAAAAAAAACAAAAAAAGGAAAAAGAAAACTAGCCCCAGTCCCTGTCTAAATTGTTATAGTTTTTGACTATTATC
TGAATTAGTCTTATCCAAATTTCATATGCAGATTGATTTTTCATTTTGTATGTATATTACATGATATAACTATTTTCATAGAATATATTT
CTAATTTACAAACACTGAATTATTAGCTTGATAGAGTTTCTCCCAAACCTTATAAAACTTTGAAATGTACTTATGTTTGAGCTTTAAAAA
TTATAAAAACTTCATTTAAACAAGTTGCTGGCATCATTACTAGCCTTTCCACCTATAATTATGATGCATTTGATGCCACTGAACAGTAAT
AGCACAAAGAACAGGTCACACAGTCTAGACTGGATTGAGTTTTAATTAAACTTCTTCATCCATAGCCTGATAAGAATCAGGCTGGGTCTA
GAAGAGTTATCAGACTGTAGGCCTGTATTAATTTTGCAAGCTAATGTTAATGTTTACTGCCAGCCTTGCATAGCAATGCCAGTTTGCAGT
TGTGACTATGATGTGACTTTTGGTAAAAATGGTTTATATCTAAAGTAGTTTAGATTTTATGGAAGTGGCTCTTGATTGTTTGGACAAGCA
GGGTAGGTAAATTTCAATTACGTTTGAAGTGTAATTAAATCCTAGAATAGAGCACTCTCCAGAAAAAAAAATGAAAAAAGAATTTGGAGA
ATATCCTGGCATGAAAACTTTTTTGAATAATACGTAGAATTTTGACAAGGTTCATACAGTGCATACAGTGTGACCTTTTCTGAGGTGGGC
AGGGAGGGTTGCTACGTTGTGTTGATTTAAAATTTCAAGGAGGAACAAAAACATTCTAGCCAAGGAGAATTGCATTGTTATTTTTTTTTC
TACTAATTTAAACGTGCATTTTTCACAGTTACACATTTAAGTTTTGCTACCAAAAATGGCCATTTTTCTAGACAGATAACATTTTCCTAA
AGTGGAAGAGAGATCCACTGTTCTAAAAAAAAAAAAAAAAAAAAACACTAAATTGTGCCTTCTCCCTTAAATTATAAGAAGAGTAATAGT
AAAAACTTGTTTAAACTATATTTTCTTTTTTTCTAATCCCTCTCAGTTCTCCTTAGATCTGCCTCCTACAAATGATCATGTTGTTTGCAT
CTGCCTGATTGAGTTCCCTTGGTCAAACCTCTCCCTATCACTATCAGAAGTTGTTCACTAAATGTATTTTCCTATTTCTTTCATGTTGAT
TGACTTTATAAGTCACCTTGGTAAACATAACATTTGGCTACCTTCTCATGCTTTATAAATGAATTTGATGAATGGCAGTTTTTATATTTT
AACCCTTTAAAAAGTTTGTCAAGGAAACAACTCAGAGCTAAGAACAAAATCTAACTTGGAATCAGTTTCTTCCTTTGGCTGCTGAAGCAG
CAGCAAGTCACGTAACCTCATTTAGTTTTTTGATTTACAAAATGTGGATAATAACCTACCTCACAGATGTGTGTGAGCAACTGTTTGAAA
GCCCTTGTTTAAATACAGGGTTTATATCCCCACATTCAATGTAAATTCCTTTTTTTAAAAAAAATAAGTATCTTTGATACTGATAGGATG
AGTATCTTGATTTTTAGGTAAGATCACAGTTTCACAAATTGTGGTGTTGTTAGGTGACATTTAATATTTCTTGAGACCTCAAGTATTCAA
ATATCAAACTTGTCCTGTGTTGTAACAAATATTCAGAATCTCTTAAAATGTTGGCTGAAGCTGCCTTAATGTACCAAAATACAGCTCTCA
AGACTGTTCACAAATATCTGTGGTTGTACAATGTTTTGAACATTTAATGTAAAGTTGTTGTAGAACTGTGAACTCTAAGGATAGTATCTT
TATTGTTTTAGGAAGAATGGTTGTGTTCTTTGTCATGTATGCTTAAATATACAGTGGATTTTGAATGCAACAAATAAAACTGAAAACAGC
CATTTGGTTGTGTCATGACAATCATAATATAGGATATAATATTTACTTTTTTTCAAAAACATCCTGCATTCATTCATTCTTAGCATACCT
TTGAAAAAGAAAAAAAAATCCATAGGTTGATACATTGACCCATTGAAGTACTTCATTACGTATTTATTGAAAATTTTTTTTAATTGTTGA
AATTGGGACCACTTTTTATAATTGGTTTCAAGAAAAAAAAATGAACAGACTTCCAGTGCTTTTCTGTTCAAATAAACTCCGATTCAAATT
TCAGTTTTGTTTGTTATATACTTTTTGTGAGTGTTAAATGATATGGGAAGGATTTGTCTTTCATTAACCATATGGAAAAGATGTCTTCCT
GAATTACATAGCATTTCATAGTTACAGATTCTTCCTAATTAATGTTTGCACCATATGAAACTCATAGGTAACAAACACAAAGGAGAAAAG

>In-frame_BCAS3_ENST00000588462_chr17_58885437_+_PRKAA2_ENST00000371244_chr1_57157067_+_9521nt
ATGAATGAAGCTATGGCTACAGATTCCCCAAGAAGACCCAGTCGTTGTACTGGTGGAGTTGTGGTTCGCCCCCAGGCTGTCACAGAGCAG
TCCTACATGGAAAGTGTTGTGACTTTTCTGCAGGATGTTGTGCCACAGGCTTACAGTGGAACACCTCTAACAGAAGAAAAGGAGAAAATA
GTCTGGGTCAGATTTGAAAATGCAGATTTAAATGATACATCAAGAAATCTGGAATTTCATGAAATACATAGTACTGGGAATGAACCGCCT
TTGTTGATTATGATTGGCTACAGTGATGGAATGCAGGTCTGGAGCATCCCTATCAGTGGTGAAGCACAAGAGCTCTTCTCTGTTCGACAT
GGCCCAATTCGAGCGGCTAGAATCTTGCCTGCTCCACAGTTTGGTGCTCAAAAATGTGATAACTTTGCTGAAAAAAGACCCCTCCTTGGT
GTTTGTAAGAGCATTGGATCTTCTGGATACCAGGTGATCAGCACTCCAACAGATTTTTTTATGGTAATGGAATATGTGTCTGGAGGTGAA
TTATTTGACTACATCTGTAAGCATGGACGGGTTGAAGAGATGGAAGCCAGGCGGCTCTTTCAGCAGATTCTGTCTGCTGTGGATTACTGT
CATAGGCATATGGTTGTTCATCGAGACCTGAAACCAGAGAATGTCCTGTTGGATGCACACATGAATGCCAAGATAGCCGATTTCGGATTA
TCTAATATGATGTCAGATGGTGAATTTCTGAGAACTAGTTGCGGATCTCCAAATTATGCAGCACCTGAAGTCATCTCAGGCAGATTGTAT
GCAGGTCCTGAAGTTGATATCTGGAGCTGTGGTGTTATCTTGTATGCTCTTCTTTGTGGCACCCTCCCATTTGATGATGAGCATGTACCT
ACGTTATTTAAGAAGATCCGAGGGGGTGTCTTTTATATCCCAGAATATCTCAATCGTTCTGTCGCCACTCTCCTGATGCATATGCTGCAG
GTTGACCCACTGAAACGAGCAACTATCAAAGACATAAGAGAGCATGAATGGTTTAAACAAGATTTGCCCAGTTACTTATTTCCTGAAGAC
CCTTCCTATGATGCTAACGTCATTGATGATGAGGCTGTGAAAGAAGTGTGTGAAAAATTTGAATGTACAGAATCAGAAGTAATGAACAGT
TTATATAGTGGTGACCCTCAAGACCAGCTTGCAGTGGCTTATCATCTTATCATTGACAATCGGAGAATAATGAACCAAGCCAGTGAGTTC
TACCTCGCCTCTAGTCCTCCATCTGGTTCTTTTATGGATGATAGTGCCATGCATATTCCCCCAGGCCTGAAACCTCATCCAGAAAGGATG
CCACCTCTTATAGCAGACAGCCCCAAAGCAAGATGTCCATTGGATGCACTGAATACGACTAAGCCCAAATCTTTAGCTGTGAAAAAAGCC
AAGTGGCATCTTGGAATCCGAAGTCAGAGCAAACCGTATGACATTATGGCTGAAGTTTACCGAGCTATGAAGCAGCTGGATTTTGAATGG
AAGGTAGTGAATGCATACCATCTTCGTGTAAGAAGAAAAAATCCAGTGACTGGCAATTACGTGAAAATGAGCTTACAACTTTACCTGGTT
GATAACAGGAGCTATCTTTTGGACTTTAAAAGCATTGATGATGAAGTAGTGGAGCAGAGATCTGGTTCCTCAACACCTCAGCGTTCCTGT
TCTGCTGCTGGCTTACACAGACCAAGATCAAGTTTTGATTCCACAACTGCAGAGAGCCATTCACTTTCTGGCTCTCTCACTGGCTCTTTG
ACCGGAAGCACATTGTCTTCAGTTTCACCTCGCCTGGGCAGTCACACCATGGATTTTTTTGAAATGTGTGCCAGTCTGATTACTACTTTA
GCCCGTTGATCTGTCTCTAGTTTCTTTCTGTTATTGCACTATGAAAATCAGTTATATTCTTTAAATTTTTATCTTACTTTTGGATAATAT
CCACTGCAATACTAATTGAGAAACATGAATTATTTCCAGGGGCACACAATGCTATTGAAATTACTGAAAACAAAATATCTGACATCTTAT
TTACTTGTAGAAATCTGTAATTCTATTGTGCCTATGATAAATTCACATAGGCAATATCTTTAATAGGTTAATATCAATGAAGATTTTTAA
TTACAATAATGAGTTCACTACAGACGATTAACACACCACACTGGCGAACCATCTCAATGTAAGGGTGGTTTGGCAACACCTCCTTGCTTT
GCTGTTTGGTGTAGGTAAATCTAGTTTACTTCCTAAATTTCAGTAGGCTTTATGCTGTGTTTATGCCCCCAATTTATTTTAACAAAAGAA
GATTAAAAAGTAAAAGAACCACGAGTAAGATATTATTTAAATGTTGAAATCTTAAAAACCTGCCTCCAAGATTTCAGAAGCCAAGTTTTT
CTAACAGTATTTGTACAAATACTGCCTAGTGTATTCAACAGAAGGACTGTGGTCATGTAACAGGTAACCACAATTTTCAGGTTTCTTAAA
AACAGCTGTAACTAACTCAGGATTTTTATCTTGAGATTTCCCTGAATAATATATTTATCTTAAGAGCCTTCAAGTTTCAAATTAATATTG
GAACATCTGGAATTGCAACAACTTTTGTCTTTTACATAAACTTACGTCATTTAAAAAATGTCTTCAAAATCTACCTTTCTCAAATTCTTT
TTGCCTCTATTTATTTTTGCATTTCACCAACAGTGATAAAATAGTTAAATGAAACAAAGCAAAGTATCAACAGTCCCTTAAATGAGAATC
CTTATCTTTGATCTTTATTTTCTGTGTTAGGTGTTAGGGTCCTGGTGCAGCTCATAATGCTAATTCTTCATTGGAAGCCACTCCCTTCAC
CTCACCTCACCTAGTCACTATTGTCTTTGTTCATTGTTTGATCCTGAGTGGTTGATTGATATAGCTTTGAATCTTTTCTAGTCCAAGTTT
GAAAACACTGTTCTGGCCCTAAGGGCTGGCTATGACCTTTACTGTTGAACCTGATAGGGCAGGGAAGCTTTGAACATCAAGAAAAAATTT
TTATCTTAAATAAATAAATATATATATTCACACACCAGTGCTTTTAAGCAAAAACCAGTTTTTTTGTTTGTTTGTTTTGCTTTGTGCAGG
TTTTCTTTAAGATTAAAAAAACACAAACTATAGCAGGGTAGATAATAGTTTATTGATTATATTTTGTTTTAGTAAAAGTATTTAATTTTA
AATTCTGTGTAATTTATCTAATTTGTATTTATTCATTTGTTATTTTTATGTTGTAATTAACACTTATTTACCTGGATTACCCTAAAAAAA
TTAAGCTCTTGAAAACAAAAAAATGACATTACCTTGACAGGCTTCTCTTTGCCAAAAGTAATGTATGTTCTGCCAAGAAGCAAATGAGAA
TGTTAGACTAAGTTTCTCCTGTGTTAGTGGAAAACAAGTGTGTCTATCTTTAAATATTCTTTGAATCAGGAGTTTGCGTTGTGTCACATC
ATATGGCTTTGCAGATCTTTTAAAAACTGATGTTAAATAACTTATAAGTCCAACTTCTTAATATCAAGATAAATGAATAGTTCACCAATT
TGGGAAGGAGGGCGGGTTGCAATTTGAGATAGTTTAAGGTTTAATTATTGAAAGACTGCCATCTTGTGGCACCAAAAGGTAATTTTTACA
TGATTATTTGTATAGTGATAAGCAGTCCTGCTGTGTTAGCCTGGTCCATTATAGATATGGCATAGTTTTGGGTTCTCTAAATGGGTCCAT
ACCTCTTTTGGGAAAAAACAGGGCCACCTCATAATATTTGCCTGATTATGAATGGAATTACCTTAGAAATAAGGAACTAATCAGATTACT
TAACCCCAATGACAAAATCCACAAAAATTTTGAAGGCAGAGAAACAGAAGGAATCCAGTGATGTTTTAGCTCCATTAGTCTAATAGGTCA
GATATTAAAAAATTGTTCATATCAAAATTACCTTATATGGATTATTGCCATGTTTTTTGAGAGTTAATTATTTACTGTTTTCTAATTCTT
GCCAGTATTTATGAACAGCTGTAGCTTGATATTTACCTACTGAATTTTAGGAGAACTAATGGTCACAGTTTGGGTTCTTTTATGTGTATG
TTTTTAAAACAGCTATTTTGTGAATCTAGGTGGTTGGTTTTTAGAAGATTTCAGGAGATGCAGTCCAGCACAATTAGAGCTGGAACATTG
TTACAGCAGGCTTTTTGTTGCTCATGGGCAGATAGAGGGAAAGAATCAGTTGTTAGCCCCAAATTTCCACATTTCAGTGTTGTAAACTCT
GAATGTGATAGGTAGATGTGGGCTAAGAATAATTTCCTCCAGTGAAGACACGGGAGAAGAGCTTCTATTATGAGGTTATAGATAAGGCCT
TAGTTATATCATGGAAATGGACTCCATGTAGTTCTAGAACTGCATTTCCCAAAGTATATCCTGTGAGATGCTCCACAGAAAAAATGATTG
CATGGACTAAGTTTGAAAAATGTTGCATGCTACTCTTCCCCTCGAAGATGACAGTGGATGTCAGCATTAAAGACTTTGACAGGTCTTTCT
GTGAAAAAAAGAAAGCCACATAACTTTGTTGAACTTTGCCCAAATTAATTTTTCATTTTAAAAAACTTAATAGCCCATGAAAAGCAAATT
TGGGAAATACATTTTTTAGGAAAATACTGTCCCAGAATGCCATAATTAGGGTAGTTAATAATTAACACTTCCATTTCTCTTACTGGTTGT
TGGGAGAATCTGATTGAAAATTAGAATTACTTTGTTTTAACTTGCAGACATGTTCATCGTGAGTGAATGCTGGATTAAATAGAATTTTCT
GTGTCTGCAACTTGTTTCATGACACCTTGGTTTTCTTAATCATCTTGTATTATTATTTGAGTGCAACATTATTCTTATGCATGGGTGACT
GAAAAACCTGAAACAAGATTACTTGTTAAAAAAAAGTCTAAGAGACTAATGACTCATGCTTATGGCTCAGTGGGTAATGAATCAGTGTCA
CTGATTCTTACTTTTAAAATGTGTAGTCAGTGAACATTTTCTAAATACTTTTCTTTGGGATACCATATGAAGATCTAATTCCTTATGTTT
CAGTGTAGGAACAGCTACCTTCTCAAATAGAATATGCAGGGAGGGAAGTAGGCAAACCATTTACAAGTTGGGTTTTTGTTTTGATTAACC
TGTTAAGAGACACTTTTGTAATCTCTAGTGTTTACATTCCTTTATACTAGCTATCTATAAAGAGAATCCAGAAGGCTAAATTAATCAGAA
ATAATTATATTTCTATGTCAGGGTATTGGCTATATGTAGCATGAACAATTCTCCATTTTCTGCAAATGGGTTTTTCAGGACAGTTTTATA
ATTCTGAGTTTGCTTTTTCTTATTCCCTAGACAGTTTGTACTCAGGGAATACAAATTGATTTTTACTGTTAAATGAGACATAGTTTAGAA
AAAATCATAAGCAACTATTGTAGATTTTTGATCTGTTTGGATTTATCTGTAGCATTGAATAATGTGCAGTGTACTGAGTTAATGTAGGCA
CCTCACTTTGGATTTATAAAATGTAAAAACCTGGAACATGCCTGCCACAGACACCACTTTGTCTATTCACCGGGTACTAATTTACATCCT
ATTAATGGTTGTAAAAGCTGAGTGTCTAAATGCTAGACATGTTCACAATTTTGTCTGTTTTTGTTTATTTGTTTTTAAGACCCAAACCTT
TTCAATCTTGCATTTATTTACTTGGTTCTCCTGTGTCACCCTGTGGCTTTTTAAATAGGGAATGTAATTTATTTTAATAGTAGTTCTCAA
AGACTCTATTAAAAACTCTGGACGAGGGATATGTGCAATCTGTTGGTAAGTCACATCCTATGTTTGGCCTCATTTTTATAACTCCTAAAA
TGAGAAAGGTAGATTTTAACACTTCTAAGGTACCTTTGAGCTTTAAAGTTCTTTTCTGCTTTTCCATATGATTTGTGTTAGTGTTCACTT
TTTATATATTTAGAGTTTTTATATGAGTGTGAATGTTTCTGTTTTGATTTGGTGAGGCATGTCAGAGGTATATACTTGAATATTTTTCTA
AATACAGCTGCTGGAGGAATGCAAATGGCAAAAATCATCCAGAAAACCAAACACGGTGAAACATCACATCCATTTGGCATGAAGCAAAGC
ATTACAAATTTGGAGTGATGAAAGTGTTCCATATATTTTTTATAGTGATTTTTCGATCTAGAGACCCTTCATATTGTTTACTTACTATTA
CGATAACTTTGAGAGGTAACCAGAGAAAGCATTTTTGCCATTTCCAGATGAGGAAGCAGGACCAGAAAGCTCTTCATAAAGCTTTAACAC
CATACAAGTATCCAGCAGTGATCAATTGCTCTTTATAGGAAACCACCTTTCCTCTGGGGAAGAACAGTCTGAATTAATAAAACATCAGAG
TGGTTGAGTAGTAAAAATAAACACAGATGTATTGCTTTCAAGTCTTAGAGTGACATAAAGTAGTCTTAAATAAATAGTTCTTAGTTTATT
TTAAGCAGTTGATTGTACTAACGAGATGTAATTATCTGAAGTATTTATGATTAGCATATTGGTTTTTATAAGTATTTCTGAGTTATTGAG
GGTGCTTAAAAATGCTGAAGAAACTTTAAAACATGATTCTTCTTATAATTTTATGTGATTCTTATAGCACAATCATTTTTGAAAAAGGAA
AACTAGGCTGGGTGTAGTGGCTCATGCCTATAATCCCAGCACTTTGGGAGGCCAAAGTGGGTGGATCACCCGAGTTCAGGAGTTCGAGAC
CAGTCTGGCCAACATGGTGAAACCTCGTCTCTACTAAAAATACCAAAATTATCCGGTGTGGTGACAGGCTGCTTGTAATCCCAGCTACTC
GGGAGGCTGAGGCACGGGAATCTCTTGAACCTGGGAGGCAGAGATTGCAATAAGCCAAGATCATGCCACTGCATGCCAGCCTGGGTGACA
GCACAAGACTGTCTCAAAAAAAAACAAAAAAAGGAAAAAGAAAACTAGCCCCAGTCCCTGTCTAAATTGTTATAGTTTTTGACTATTATC
TGAATTAGTCTTATCCAAATTTCATATGCAGATTGATTTTTCATTTTGTATGTATATTACATGATATAACTATTTTCATAGAATATATTT
CTAATTTACAAACACTGAATTATTAGCTTGATAGAGTTTCTCCCAAACCTTATAAAACTTTGAAATGTACTTATGTTTGAGCTTTAAAAA
TTATAAAAACTTCATTTAAACAAGTTGCTGGCATCATTACTAGCCTTTCCACCTATAATTATGATGCATTTGATGCCACTGAACAGTAAT
AGCACAAAGAACAGGTCACACAGTCTAGACTGGATTGAGTTTTAATTAAACTTCTTCATCCATAGCCTGATAAGAATCAGGCTGGGTCTA
GAAGAGTTATCAGACTGTAGGCCTGTATTAATTTTGCAAGCTAATGTTAATGTTTACTGCCAGCCTTGCATAGCAATGCCAGTTTGCAGT
TGTGACTATGATGTGACTTTTGGTAAAAATGGTTTATATCTAAAGTAGTTTAGATTTTATGGAAGTGGCTCTTGATTGTTTGGACAAGCA
GGGTAGGTAAATTTCAATTACGTTTGAAGTGTAATTAAATCCTAGAATAGAGCACTCTCCAGAAAAAAAAATGAAAAAAGAATTTGGAGA
ATATCCTGGCATGAAAACTTTTTTGAATAATACGTAGAATTTTGACAAGGTTCATACAGTGCATACAGTGTGACCTTTTCTGAGGTGGGC
AGGGAGGGTTGCTACGTTGTGTTGATTTAAAATTTCAAGGAGGAACAAAAACATTCTAGCCAAGGAGAATTGCATTGTTATTTTTTTTTC
TACTAATTTAAACGTGCATTTTTCACAGTTACACATTTAAGTTTTGCTACCAAAAATGGCCATTTTTCTAGACAGATAACATTTTCCTAA
AGTGGAAGAGAGATCCACTGTTCTAAAAAAAAAAAAAAAAAAAAACACTAAATTGTGCCTTCTCCCTTAAATTATAAGAAGAGTAATAGT
AAAAACTTGTTTAAACTATATTTTCTTTTTTTCTAATCCCTCTCAGTTCTCCTTAGATCTGCCTCCTACAAATGATCATGTTGTTTGCAT
CTGCCTGATTGAGTTCCCTTGGTCAAACCTCTCCCTATCACTATCAGAAGTTGTTCACTAAATGTATTTTCCTATTTCTTTCATGTTGAT
TGACTTTATAAGTCACCTTGGTAAACATAACATTTGGCTACCTTCTCATGCTTTATAAATGAATTTGATGAATGGCAGTTTTTATATTTT
AACCCTTTAAAAAGTTTGTCAAGGAAACAACTCAGAGCTAAGAACAAAATCTAACTTGGAATCAGTTTCTTCCTTTGGCTGCTGAAGCAG
CAGCAAGTCACGTAACCTCATTTAGTTTTTTGATTTACAAAATGTGGATAATAACCTACCTCACAGATGTGTGTGAGCAACTGTTTGAAA
GCCCTTGTTTAAATACAGGGTTTATATCCCCACATTCAATGTAAATTCCTTTTTTTAAAAAAAATAAGTATCTTTGATACTGATAGGATG
AGTATCTTGATTTTTAGGTAAGATCACAGTTTCACAAATTGTGGTGTTGTTAGGTGACATTTAATATTTCTTGAGACCTCAAGTATTCAA
ATATCAAACTTGTCCTGTGTTGTAACAAATATTCAGAATCTCTTAAAATGTTGGCTGAAGCTGCCTTAATGTACCAAAATACAGCTCTCA
AGACTGTTCACAAATATCTGTGGTTGTACAATGTTTTGAACATTTAATGTAAAGTTGTTGTAGAACTGTGAACTCTAAGGATAGTATCTT
TATTGTTTTAGGAAGAATGGTTGTGTTCTTTGTCATGTATGCTTAAATATACAGTGGATTTTGAATGCAACAAATAAAACTGAAAACAGC
CATTTGGTTGTGTCATGACAATCATAATATAGGATATAATATTTACTTTTTTTCAAAAACATCCTGCATTCATTCATTCTTAGCATACCT
TTGAAAAAGAAAAAAAAATCCATAGGTTGATACATTGACCCATTGAAGTACTTCATTACGTATTTATTGAAAATTTTTTTTAATTGTTGA
AATTGGGACCACTTTTTATAATTGGTTTCAAGAAAAAAAAATGAACAGACTTCCAGTGCTTTTCTGTTCAAATAAACTCCGATTCAAATT
TCAGTTTTGTTTGTTATATACTTTTTGTGAGTGTTAAATGATATGGGAAGGATTTGTCTTTCATTAACCATATGGAAAAGATGTCTTCCT
GAATTACATAGCATTTCATAGTTACAGATTCTTCCTAATTAATGTTTGCACCATATGAAACTCATAGGTAACAAACACAAAGGAGAAAAG


Top

FusionGenePPI for BCAS3_PRKAA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2BPRKAA2PRKAG1, CAMKK2, PRKAB2, MLF2, PRKAA1, STIM2, SH3PXD2A, STIM1, GYS1, PRKAG2, CEP170B, MAST3, MAP3K5, MAP3K6, BAIAP2L1, GYG1, PIK3CG, FLCN, AMOT, RB1CC1, ULK1, GFPT1, AGL, PARS2, FNIP1, DFFA, SMC1A, ACACA, DNAJB1, PRKAB1, EPM2A, NRAP, TMOD1, UBE2I, PBXIP1, SNW1, TRIP6, MYOZ1, C19orf47, PSMD11, RPTOR, WWP1, HSP90AA1, PPARG, AES, FOS, GLI1, KIFC3, KRT31, NONO, VPS52, TCF4, AIMP2, ABI2, APPBP2, RBPMS, NECAB2, HOMEZ, CCNB1IP1, HMBOX1, TSC22D4, USHBP1, ZNF397, L3MBTL3, RFX6, NUTM1, KCTD1, KIF24, KRTAP10-3, NOTCH2NL, ZBTB8A, BRCA1, INSR, PPM1E, PPM1F, DCLRE1C, NIPSNAP1, STK11, TFAP2A, USP10, G3BP1, PRKAG3, CTNNA3, DNMT1, RBBP7, HAT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BCAS3_PRKAA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BCAS3_PRKAA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePRKAA2C0018800Cardiomegaly1CTD_human
TgenePRKAA2C0021655Insulin Resistance1CTD_human
TgenePRKAA2C0038454Cerebrovascular accident1CTD_human
TgenePRKAA2C0271650Impaired glucose tolerance1CTD_human
TgenePRKAA2C0878544Cardiomyopathies1CTD_human