FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39530

FusionGeneSummary for TRIM37_DNAH17

check button Fusion gene summary
Fusion gene informationFusion gene name: TRIM37_DNAH17
Fusion gene ID: 39530
HgeneTgene
Gene symbol

TRIM37

DNAH17

Gene ID

4591

8632

Gene nametripartite motif containing 37dynein axonemal heavy chain 17
SynonymsMUL|POB1|TEF3DNAHL1|DNEL2
Cytomap

17q22

17q25.3

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase TRIM37RING-B-box-coiled-coil proteinRING-type E3 ubiquitin transferase TRIM37mulibrey nanism proteindynein heavy chain 17, axonemalaxonemal beta dynein heavy chain 17axonemal dynein heavy chain-like protein 1ciliary dynein heavy chain 17ciliary dynein heavy chain-like protein 1dynein light chain 2, axonemaldynein, axonemal, heavy polypeptide 17
Modification date2018052220180523
UniProtAcc

O94972

Q9UFH2

Ensembl transtripts involved in fusion geneENST00000393066, ENST00000262294, 
ENST00000376149, ENST00000393065, 
ENST00000584889, 
ENST00000389840, 
ENST00000585328, ENST00000586052, 
Fusion gene scores* DoF score8 X 7 X 6=33612 X 12 X 11=1584
# samples 812
** MAII scorelog2(8/336*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/1584*10)=-3.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TRIM37 [Title/Abstract] AND DNAH17 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTRIM37

GO:0000122

negative regulation of transcription by RNA polymerase II

25470042

HgeneTRIM37

GO:0032088

negative regulation of NF-kappaB transcription factor activity

11279055

HgeneTRIM37

GO:0035518

histone H2A monoubiquitination

25470042

HgeneTRIM37

GO:0036353

histone H2A-K119 monoubiquitination

25470042

HgeneTRIM37

GO:0051091

positive regulation of DNA binding transcription factor activity

23077300

HgeneTRIM37

GO:0051092

positive regulation of NF-kappaB transcription factor activity

23077300

HgeneTRIM37

GO:0051865

protein autoubiquitination

15885686

HgeneTRIM37

GO:0070842

aggresome assembly

15885686


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-BR-8590-01ATRIM37chr17

57161363

-DNAH17chr17

76441762

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393066ENST00000389840TRIM37chr17

57161363

-DNAH17chr17

76441762

-
In-frameENST00000393066ENST00000585328TRIM37chr17

57161363

-DNAH17chr17

76441762

-
5CDS-5UTRENST00000393066ENST00000586052TRIM37chr17

57161363

-DNAH17chr17

76441762

-
In-frameENST00000262294ENST00000389840TRIM37chr17

57161363

-DNAH17chr17

76441762

-
In-frameENST00000262294ENST00000585328TRIM37chr17

57161363

-DNAH17chr17

76441762

-
5CDS-5UTRENST00000262294ENST00000586052TRIM37chr17

57161363

-DNAH17chr17

76441762

-
Frame-shitENST00000376149ENST00000389840TRIM37chr17

57161363

-DNAH17chr17

76441762

-
Frame-shitENST00000376149ENST00000585328TRIM37chr17

57161363

-DNAH17chr17

76441762

-
5CDS-5UTRENST00000376149ENST00000586052TRIM37chr17

57161363

-DNAH17chr17

76441762

-
In-frameENST00000393065ENST00000389840TRIM37chr17

57161363

-DNAH17chr17

76441762

-
In-frameENST00000393065ENST00000585328TRIM37chr17

57161363

-DNAH17chr17

76441762

-
5CDS-5UTRENST00000393065ENST00000586052TRIM37chr17

57161363

-DNAH17chr17

76441762

-
intron-3CDSENST00000584889ENST00000389840TRIM37chr17

57161363

-DNAH17chr17

76441762

-
intron-3CDSENST00000584889ENST00000585328TRIM37chr17

57161363

-DNAH17chr17

76441762

-
intron-5UTRENST00000584889ENST00000586052TRIM37chr17

57161363

-DNAH17chr17

76441762

-

Top

FusionProtFeatures for TRIM37_DNAH17


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRIM37

O94972

DNAH17

Q9UFH2

Force generating protein of respiratory cilia. Producesforce towards the minus ends of microtubules. Dynein has ATPaseactivity; the force-producing power stroke is thought to occur onrelease of ADP. Involved in sperm motility; implicated in spermflagellar assembly (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-52415_55123965Zinc fingerRING-type%3B degenerate
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-52515_55123965Zinc fingerRING-type%3B degenerate
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68813828_406237234486RegionAAA 6
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68814141_417637234486RepeatNote=TPR 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524132_234123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524419_450123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524673_700123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523132_2341804Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523419_4501804Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523673_7001804Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525132_234123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525419_450123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525673_700123965Coiled coilOntology_term=ECO:0000255
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524534_540123965Compositional biasNote=Poly-Ser
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524578_581123965Compositional biasNote=Poly-Ala
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523534_5401804Compositional biasNote=Poly-Ser
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523578_5811804Compositional biasNote=Poly-Ala
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525534_540123965Compositional biasNote=Poly-Ser
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525578_581123965Compositional biasNote=Poly-Ala
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-524276_403123965DomainMATH
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-523276_4031804DomainMATH
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-525276_403123965DomainMATH
HgeneTRIM37chr17:57161363chr17:76441762ENST00000262294-52490_132123965Zinc fingerB box-type
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-52315_551804Zinc fingerRING-type%3B degenerate
HgeneTRIM37chr17:57161363chr17:76441762ENST00000376149-52390_1321804Zinc fingerB box-type
HgeneTRIM37chr17:57161363chr17:76441762ENST00000393066-52590_132123965Zinc fingerB box-type
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68813013_307237234486Coiled coilOntology_term=ECO:0000255
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68813243_329537234486Coiled coilOntology_term=ECO:0000255
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68811833_184037234486Nucleotide bindingATP
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812114_212137234486Nucleotide bindingATP
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812441_244837234486Nucleotide bindingATP
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812787_279437234486Nucleotide bindingATP
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68811795_201637234486RegionAAA 1
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68811_179437234486RegionStem
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812076_229737234486RegionAAA 2
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812403_265137234486RegionAAA 3
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68812749_299837234486RegionAAA 4
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68813013_329937234486RegionStalk
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68813391_361837234486RegionAAA 5
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68811019_105237234486RepeatNote=TPR 1
TgeneDNAH17chr17:57161363chr17:76441762ENST00000389840-68811691_172537234486RepeatNote=TPR 2


Top

FusionGeneSequence for TRIM37_DNAH17


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_886aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEEN
EKDKCENHHEKLSVFCWTCKKCICHQCALWGGMVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIE
GSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVD
PLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQVRGGQHCRNIHLVARWLGTLDKKLEHYSTGSHEDYRVFI
SAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNN
GDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLP
PESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKAGSLKLLPSERKGEDLELRRGGCPGTGFQVKAVLDDILEK
IPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWY
ADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQ

>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_849aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEEN
EKDKCENHHEKLSVFCWTCKKCICHQCALWGGMVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIE
GSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVD
PLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSP
ETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISIN
VLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYG
LHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNE
MRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTA
IMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYEC

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_886aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEEN
EKDKCENHHEKLSVFCWTCKKCICHQCALWGGMVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIE
GSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVD
PLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQVRGGQHCRNIHLVARWLGTLDKKLEHYSTGSHEDYRVFI
SAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNN
GDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLP
PESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKAGSLKLLPSERKGEDLELRRGGCPGTGFQVKAVLDDILEK
IPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWY
ADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQ

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_849aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEEN
EKDKCENHHEKLSVFCWTCKKCICHQCALWGGMVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIE
GSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVD
PLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVAENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSP
ETHIIPQGILENAIKITNEPPTGMHANLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISIN
VLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYG
LHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNE
MRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTA
IMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYEC

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_852aa
MDEQSVERWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMV
LSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLC
MVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVA
ENALDVAAEKGHWVILQVRGGQHCRNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSPETHIIPQGILENAIKITNEPPTGMHA
NLHKALDLFTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRYLFGEIMY
GGHITDDWDRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQP
KETDSGAGTGVSREEKAGSLKLLPSERKGEDLELRRGGCPGTGFQVKAVLDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNIL
TNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTVPDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSF
LTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNI

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_815aa
MDEQSVERWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMV
LSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQGWGGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLC
MVRCLRPDRMTYAIKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTSIFFILSPGVDPLKDVEALGKKLGFTIDNGKLHNVSLGQGQEVVA
ENALDVAAEKGHWVILQNIHLVARWLGTLDKKLEHYSTGSHEDYRVFISAEPAPSPETHIIPQGILENAIKITNEPPTGMHANLHKALDL
FTQDTLEMCTKEMEFKCMLFALCYFHAVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDW
DRRLCRTYLAEYIRTEMLEGDVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFLTVTSEKLFRTVLEMQPKETDSGAG
TGVSREEKVKAVLDDILEKIPETFNMAEIMAKAAEKTPYVVVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDVEDLSTALFYDTV
PDTWVARAYPSMMGLAAWYADLLLRIRELEAWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTKKNREDMTAPP
REGSYVYGLFMEGARWDTQTGVIAEARLKELTPAMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKWILAAVAL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_2658nt
ATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCAT
TGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTA
CGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAAT
GAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGG
GGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCA
CCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAA
GGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTG
CAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTC
GTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGAC
CCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAA
GAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCACTGCAGGAAT
ATCCACCTGGTGGCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATC
AGCGCGGAGCCTGCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACG
GGCATGCACGCCAACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATG
CTCTTCGCCCTGTGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAAC
GGGGACCTCACCATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGT
GAAATCATGTATGGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTG
GAGGGAGACGTCCTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCC
CCTGAGAGTCCCTATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTG
GAAATGCAGCCAAAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCTCCCAAGCGAG
AGGAAGGGGGAGGATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAG
ATTCCGGAGACTTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGA
ATGAACATCCTGACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAA
GATCTGTCCACGGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTAC
GCAGACCTGCTGCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAAC
CCCCAGTCGTTCCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACC
AAGAAAAACCGAGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAG
ACTGGAGTCATCGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAG
ACCAAGAACATCTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAG

>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_2547nt
ATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCAT
TGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTA
CGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAAT
GAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGG
GGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCA
CCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAA
GGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTG
CAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTC
GTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGAC
CCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAA
GAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGCCCGGTGGCTG
GGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCC
GAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAACTTGCACAAG
GCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTGCTACTTCCAC
GCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCATCTCCATCAAC
GTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGGCGGCCACATC
ACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCC
GGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTATCTGTATGGC
CTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAAAGAGACGGAC
TCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACTTTCAACATG
GCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTGACCAACGAA
ATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACGGCTCTCTTC
TATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTGCTCCGCATC
AGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTCCTCACGGCC
ATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGAGAGGACATG
ACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATCGCTGAAGCG
CGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATCTATGAGTGT
CCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGGATCCTGGCA

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_2658nt
ATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCAT
TGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTA
CGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAAT
GAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGG
GGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCA
CCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAA
GGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTG
CAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTC
GTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGAC
CCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAA
GAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCACTGCAGGAAT
ATCCACCTGGTGGCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATC
AGCGCGGAGCCTGCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACG
GGCATGCACGCCAACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATG
CTCTTCGCCCTGTGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAAC
GGGGACCTCACCATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGT
GAAATCATGTATGGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTG
GAGGGAGACGTCCTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCC
CCTGAGAGTCCCTATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTG
GAAATGCAGCCAAAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCTCCCAAGCGAG
AGGAAGGGGGAGGATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAG
ATTCCGGAGACTTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGA
ATGAACATCCTGACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAA
GATCTGTCCACGGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTAC
GCAGACCTGCTGCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAAC
CCCCAGTCGTTCCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACC
AAGAAAAACCGAGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAG
ACTGGAGTCATCGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAG
ACCAAGAACATCTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAG

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_2547nt
ATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCAT
TGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTA
CGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAAT
GAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGG
GGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCA
CCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAA
GGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTG
CAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTC
GTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGAC
CCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAA
GAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGCCCGGTGGCTG
GGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCC
GAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAACTTGCACAAG
GCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTGCTACTTCCAC
GCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCATCTCCATCAAC
GTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGGCGGCCACATC
ACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCC
GGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTATCTGTATGGC
CTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAAAGAGACGGAC
TCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACTTTCAACATG
GCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTGACCAACGAA
ATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACGGCTCTCTTC
TATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTGCTCCGCATC
AGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTCCTCACGGCC
ATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGAGAGGACATG
ACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATCGCTGAAGCG
CGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATCTATGAGTGT
CCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGGATCCTGGCA

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_2556nt
ATGGATGAACAGAGCGTGGAGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAACTAGTA
AATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGGACAAA
TGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAATGGTC
CTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGGACTTC
CTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTGCCAAG
CGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGCTGTGC
ATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAGGCCGG
AGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGAAAGAC
GTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGGTGGCT
GAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCACTGCAGGAATATCCACCTGGTG
GCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCT
GCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCC
AACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTG
TGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACC
ATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTAT
GGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTC
CTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCC
TATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCA
AAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCTCCCAAGCGAGAGGAAGGGGGAG
GATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACT
TTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTG
ACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACG
GCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTG
CTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTC
CTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGA
GAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATC
GCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATC
TATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGG

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_2445nt
ATGGATGAACAGAGCGTGGAGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAACTAGTA
AATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGGACAAA
TGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAATGGTC
CTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGGACTTC
CTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTGCCAAG
CGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGCTGTGC
ATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAGGCCGG
AGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGAAAGAC
GTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGGTGGCT
GAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGCCCGGTGGCTGGGAACACTGGAC
AAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCCGAGACCCACATC
ATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAACTTGCACAAGGCCCTGGACCTG
TTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTGCTACTTCCACGCTGTGGTGGCA
GAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCATCTCCATCAACGTGCTCTACAAC
TACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGGCGGCCACATCACAGATGACTGG
GACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCCGGCTTTCAGATC
CCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTATCTGTATGGCCTGCACCCCAAC
GCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAAAGAGACGGACTCGGGGGCAGGC
ACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACTTTCAACATGGCTGAGATCATG
GCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTGACCAACGAAATGCGCCGTTCG
CTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACGGCTCTCTTCTATGACACCGTG
CCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTGCTCCGCATCAGGGAACTCGAG
GCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTCCTCACGGCCATCATGCAGTCC
ATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGAGAGGACATGACCGCTCCTCCG
CGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATCGCTGAAGCGCGGCTGAAAGAG
CTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATCTATGAGTGTCCCGTGTACAAA
ACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGGATCCTGGCAGCCGTGGCGCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_3327nt
CCTCCTTTCCCCTCCCACAGCGTCCTGCGCGCATGCGCTTCGCAGCTTCTCTCGCCGCCGCGCCCCCAGCTGCTCTGGTTACGGTTGGTG
TTTGCGAATTCTCTGCGGCACCTTCTTCGCTGAACTCCACCGTCAGTTCCATAGGCGCGCGCCCGCGTCACGTGGGCCGAGGTTCCGGCG
CGGCTGCTGGCCGGCGGCTGAGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAA
ATGGCGAAATGGGGGTAGGCGGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGG
CTTTTATCGGCGATTTGATCTGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGA
GCCGGAGGCAATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCT
GTGTCCTCATTGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCC
ACTCCAGCTACGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACA
TGAAGAAAATGAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTG
TGCACTTTGGGGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGG
AGTGGTCTCACCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAG
TGACATCGAAGGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAA
GACGGCCCTGCAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGG
CAGCAAGTTCGTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCC
GGGGGTTGACCCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGG
GCAGGGACAAGAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCA
CTGCAGGAATATCCACCTGGTGGCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCG
GGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGA
GCCCCCCACGGGCATGCACGCCAACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTT
CAAGTGCATGCTCTTCGCCCTGTGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCC
CTTCAACAACGGGGACCTCACCATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTA
CCTTTTTGGTGAAATCATGTATGGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGAC
GGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGA
GAACCTGCCCCCTGAGAGTCCCTATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCG
CACTGTCCTGGAAATGCAGCCAAAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCT
CCCAAGCGAGAGGAAGGGGGAGGATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACAT
CCTGGAGAAGATTCCGGAGACTTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGA
ATGTGAAAGAATGAACATCCTGACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGAC
CGACGTGGAAGATCTGTCCACGGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGC
GGCCTGGTACGCAGACCTGCTGCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGG
CTTCTTCAACCCCCAGTCGTTCCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGT
CGAGGTGACCAAGAAAAACCGAGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTG
GGACACCCAGACTGGAGTCATCGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGA
CCGCATGGAGACCAAGAACATCTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGAC
CAAAGAGAAGGCAGCGAAGTGGATCCTGGCAGCCGTGGCGCTGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGG
GGCTGGACCACAACTCAGCCCTTCACCTGTGCACCTGTGACTTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCA

>In-frame_TRIM37_ENST00000393066_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_3216nt
CCTCCTTTCCCCTCCCACAGCGTCCTGCGCGCATGCGCTTCGCAGCTTCTCTCGCCGCCGCGCCCCCAGCTGCTCTGGTTACGGTTGGTG
TTTGCGAATTCTCTGCGGCACCTTCTTCGCTGAACTCCACCGTCAGTTCCATAGGCGCGCGCCCGCGTCACGTGGGCCGAGGTTCCGGCG
CGGCTGCTGGCCGGCGGCTGAGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAA
ATGGCGAAATGGGGGTAGGCGGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGG
CTTTTATCGGCGATTTGATCTGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGA
GCCGGAGGCAATGGATGAACAGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCT
GTGTCCTCATTGCTCCAAACTGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCC
ACTCCAGCTACGAGAACTAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACA
TGAAGAAAATGAAAAGGACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTG
TGCACTTTGGGGAGGAATGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGG
AGTGGTCTCACCAGTGGACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAG
TGACATCGAAGGATCTGCCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAA
GACGGCCCTGCAGAAGCTGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGG
CAGCAAGTTCGTGGAAGGCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCC
GGGGGTTGACCCCTTGAAAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGG
GCAGGGACAAGAGGTGGTGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGC
CCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGC
CCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAA
CTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTG
CTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCAT
CTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGG
CGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCT
GCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTA
TCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAA
AGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGAC
TTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCT
GACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCAC
GGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCT
GCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTT
CCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCG
AGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCAT
CGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACAT
CTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTG
GATCCTGGCAGCCGTGGCGCTGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGGGGCTGGACCACAACTCAGCCC
TTCACCTGTGCACCTGTGACTTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCAGGTGCTTTGTAACCAAGCACA

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_3127nt
AGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAAATGGCGAAATGGGGGTAGGC
GGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGGCTTTTATCGGCGATTTGATC
TGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGAGCCGGAGGCAATGGATGAAC
AGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCATTGCTCCAAAC
TGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAACTAG
TAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGGACA
AATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAATGG
TCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGGACT
TCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTGCCA
AGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGCTGT
GCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAGGCC
GGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGAAAG
ACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGGTGG
CTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCACTGCAGGAATATCCACCTGG
TGGCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGC
CTGCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACG
CCAACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCC
TGTGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCA
CCATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGT
ATGGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACG
TCCTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTC
CCTATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGC
CAAAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCTCCCAAGCGAGAGGAAGGGGG
AGGATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGA
CTTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCC
TGACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCA
CGGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGC
TGCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGT
TCCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACC
GAGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCA
TCGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACA
TCTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGT
GGATCCTGGCAGCCGTGGCGCTGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGGGGCTGGACCACAACTCAGCC
CTTCACCTGTGCACCTGTGACTTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCAGGTGCTTTGTAACCAAGCAC

>In-frame_TRIM37_ENST00000262294_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_3016nt
AGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAAATGGCGAAATGGGGGTAGGC
GGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGGCTTTTATCGGCGATTTGATC
TGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGAGCCGGAGGCAATGGATGAAC
AGAGCGTGGAGAGCATTGCTGAGGTTTTCCGATGTTTCATTTGTATGGAGAAATTGCGGGATGCACGCCTGTGTCCTCATTGCTCCAAAC
TGTGTTGTTTCAGCTGTATTAGGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAACTAG
TAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGGACA
AATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAATGG
TCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGGACT
TCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTGCCA
AGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGCTGT
GCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAGGCC
GGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGAAAG
ACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGGTGG
CTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGCCCGGTGGCTGGGAACACTGG
ACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCCGAGACCCACA
TCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAACTTGCACAAGGCCCTGGACC
TGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTGCTACTTCCACGCTGTGGTGG
CAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCATCTCCATCAACGTGCTCTACA
ACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGGCGGCCACATCACAGATGACT
GGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCCGGCTTTCAGA
TCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTATCTGTATGGCCTGCACCCCA
ACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAAAGAGACGGACTCGGGGGCAG
GCACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACTTTCAACATGGCTGAGATCA
TGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTGACCAACGAAATGCGCCGTT
CGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACGGCTCTCTTCTATGACACCG
TGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTGCTCCGCATCAGGGAACTCG
AGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTCCTCACGGCCATCATGCAGT
CCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGAGAGGACATGACCGCTCCTC
CGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATCGCTGAAGCGCGGCTGAAAG
AGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATCTATGAGTGTCCCGTGTACA
AAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGGATCCTGGCAGCCGTGGCGC
TGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGGGGCTGGACCACAACTCAGCCCTTCACCTGTGCACCTGTGAC
TTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCAGGTGCTTTGTAACCAAGCACATCGGAACCAGAGGGTGGAGG

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000389840_chr17_76441762_-_3130nt
GAATTCTCTGCGGCACCTTCTTCGCTGAACTCCACCGTCAGTTCCATAGGCGCGCGCCCGCGTCACGTGGGCCGAGGTTCCGGCGCGGCT
GCTGGCCGGCGGCTGAGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAAATGGC
GAAATGGGGGTAGGCGGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGGCTTTT
ATCGGCGATTTGATCTGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGAGCCGG
AGGCAATGGATGAACAGAGCGTGGAGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAAC
TAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGG
ACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAA
TGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGG
ACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTG
CCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGC
TGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAG
GCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGA
AAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGG
TGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGGTACGAGGGGGCCAGCACTGCAGGAATATCCACC
TGGTGGCCCGGTGGCTGGGAACACTGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGG
AGCCTGCCCCCAGCCCCGAGACCCACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGC
ACGCCAACTTGCACAAGGCCCTGGACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCG
CCCTGTGCTACTTCCACGCTGTGGTGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACC
TCACCATCTCCATCAACGTGCTCTACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCA
TGTATGGCGGCCACATCACAGATGACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAG
ACGTCCTGCTGGCCCCCGGCTTTCAGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGA
GTCCCTATCTGTATGGCCTGCACCCCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGC
AGCCAAAAGAGACGGACTCGGGGGCAGGCACGGGAGTGTCCCGCGAGGAGAAGGCAGGATCTTTGAAACTGCTCCCAAGCGAGAGGAAGG
GGGAGGATCTAGAACTGAGGAGGGGGGGCTGTCCGGGGACTGGCTTCCAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGG
AGACTTTCAACATGGCTGAGATCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACA
TCCTGACCAACGAAATGCGCCGTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGT
CCACGGCTCTCTTCTATGACACCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACC
TGCTGCTCCGCATCAGGGAACTCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGT
CGTTCCTCACGGCCATCATGCAGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAA
ACCGAGAGGACATGACCGCTCCTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAG
TCATCGCTGAAGCGCGGCTGAAAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGA
ACATCTATGAGTGTCCCGTGTACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGA
AGTGGATCCTGGCAGCCGTGGCGCTGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGGGGCTGGACCACAACTCA
GCCCTTCACCTGTGCACCTGTGACTTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCAGGTGCTTTGTAACCAAG

>In-frame_TRIM37_ENST00000393065_chr17_57161363_-_DNAH17_ENST00000585328_chr17_76441762_-_3019nt
GAATTCTCTGCGGCACCTTCTTCGCTGAACTCCACCGTCAGTTCCATAGGCGCGCGCCCGCGTCACGTGGGCCGAGGTTCCGGCGCGGCT
GCTGGCCGGCGGCTGAGCCGGGAGAAAGGAGCTGCGGCCACCGTTCGCCCTACTTCTGCGCCTCGGGGCGGGCGCGCCGGTAAAAATGGC
GAAATGGGGGTAGGCGGCGCTGGACCTGAAGAGATGGGGCGCGCAGGTGGGGCGGTTGTCAGAGCCCCCTGACGTGGGCGCCGGGCTTTT
ATCGGCGATTTGATCTGGCGACCTCGGGCCGGCGCCTAAGAGGTCAGACTGCGGAGCCTGCGGGTCGCCAGCGGCCCCGCCGAGAGCCGG
AGGCAATGGATGAACAGAGCGTGGAGCGCTGGCTGACAGAGCAGAGAGCTCAATGTCCTCATTGCCGTGCTCCACTCCAGCTACGAGAAC
TAGTAAATTGTCGTTGGGCAGAAGAAGTAACACAACAGCTTGATACTCTTCAACTCTGCAGTCTCACCAAACATGAAGAAAATGAAAAGG
ACAAATGTGAAAATCACCATGAAAAACTTAGTGTATTTTGCTGGACTTGTAAGAAGTGTATCTGCCATCAGTGTGCACTTTGGGGAGGAA
TGGTCCTGTCCATGAAGAAGGAGCTGAACCCAGTGGAGCTGGATTTCCTCCTGCGGTTCCCTTTTAAGGCCGGAGTGGTCTCACCAGTGG
ACTTCCTCCAGCATCAAGGCTGGGGCGGGATCAAGGCCCTCTCGGAGATGGATGAGTTCAAAAATCTGGACAGTGACATCGAAGGATCTG
CCAAGCGCTGGAAAAAGCTGGTGGAGTCGGAAGCCCCCGAGAAGGAGATCTTCCCCAAGGAGTGGAAGAACAAGACGGCCCTGCAGAAGC
TGTGCATGGTGCGCTGCCTGCGGCCAGATCGCATGACCTACGCTATCAAGAACTTCGTGGAGGAAAAGATGGGCAGCAAGTTCGTGGAAG
GCCGGAGTGTTGAGTTTTCTAAGTCCTACGAGGAGAGCAGCCCCTCCACGTCAATCTTCTTCATCCTCTCCCCGGGGGTTGACCCCTTGA
AAGACGTGGAAGCCCTGGGAAAAAAACTAGGGTTTACCATAGACAATGGAAAACTCCATAATGTGTCCCTGGGGCAGGGACAAGAGGTGG
TGGCTGAGAACGCCCTGGACGTGGCTGCAGAGAAAGGACACTGGGTCATTCTGCAGAATATCCACCTGGTGGCCCGGTGGCTGGGAACAC
TGGACAAGAAGCTGGAGCACTACAGCACGGGCAGCCATGAGGACTACCGGGTGTTCATCAGCGCGGAGCCTGCCCCCAGCCCCGAGACCC
ACATCATCCCCCAGGGCATTCTGGAGAACGCCATCAAGATCACCAACGAGCCCCCCACGGGCATGCACGCCAACTTGCACAAGGCCCTGG
ACCTGTTCACCCAGGACACCCTGGAGATGTGCACCAAGGAGATGGAGTTCAAGTGCATGCTCTTCGCCCTGTGCTACTTCCACGCTGTGG
TGGCAGAGAGGCGCAAGTTCGGCGCCCAGGGCTGGAACCGGTCGTACCCCTTCAACAACGGGGACCTCACCATCTCCATCAACGTGCTCT
ACAACTACCTGGAGGCCAACCCCAAGGTGCCCTGGGACGATCTCCGCTACCTTTTTGGTGAAATCATGTATGGCGGCCACATCACAGATG
ACTGGGACCGTCGGCTGTGCAGGACCTACCTGGCTGAATACATCCGGACGGAGATGCTGGAGGGAGACGTCCTGCTGGCCCCCGGCTTTC
AGATCCCCCCCAACCTGGACTACAAGGGTTACCACGAATACATCGATGAGAACCTGCCCCCTGAGAGTCCCTATCTGTATGGCCTGCACC
CCAACGCAGAGATTGGCTTTCTGACGGTCACCTCAGAGAAGCTGTTCCGCACTGTCCTGGAAATGCAGCCAAAAGAGACGGACTCGGGGG
CAGGCACGGGAGTGTCCCGCGAGGAGAAGGTGAAGGCCGTGCTGGACGACATCCTGGAGAAGATTCCGGAGACTTTCAACATGGCTGAGA
TCATGGCAAAGGCAGCGGAAAAGACCCCCTACGTGGTAGTCGCCTTTCAAGAATGTGAAAGAATGAACATCCTGACCAACGAAATGCGCC
GTTCGCTCAAGGAGCTGAACCTGGGGCTGAAGGGAGAACTGACCATCACGACCGACGTGGAAGATCTGTCCACGGCTCTCTTCTATGACA
CCGTGCCTGATACGTGGGTGGCCCGGGCCTACCCCTCCATGATGGGCCTGGCGGCCTGGTACGCAGACCTGCTGCTCCGCATCAGGGAAC
TCGAGGCCTGGACGACAGACTTTGCCCTGCCCACCACCGTGTGGCTGGCCGGCTTCTTCAACCCCCAGTCGTTCCTCACGGCCATCATGC
AGTCCATGGCCAGGAAGAACGAGTGGCCCCTGGACAAGATGTGTCTGTCTGTCGAGGTGACCAAGAAAAACCGAGAGGACATGACCGCTC
CTCCGCGAGAGGGCTCCTACGTGTACGGACTCTTCATGGAAGGGGCTCGCTGGGACACCCAGACTGGAGTCATCGCTGAAGCGCGGCTGA
AAGAGCTGACCCCGGCCATGCCTGTCATCTTCATCAAGGCCATTCCTGTGGACCGCATGGAGACCAAGAACATCTATGAGTGTCCCGTGT
ACAAAACACGCATCCGCGGCCCCACCTATGTCTGGACCTTTAACTTGAAGACCAAAGAGAAGGCAGCGAAGTGGATCCTGGCAGCCGTGG
CGCTGCTCCTACAGGTTTAGCTCGCTCCTGCCTCACAGCCCACACTCCCTGGGGCTGGACCACAACTCAGCCCTTCACCTGTGCACCTGT
GACTTATTCTTTACAGGAACTGGTGGTGGTTTTTCGTTCTCTTAAATAATCAGGTGCTTTGTAACCAAGCACATCGGAACCAGAGGGTGG


Top

FusionGenePPI for TRIM37_DNAH17


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRIM37FAM124B, MAGEB18, TCEB3B, APEX2, FXR2, FAM107A, RIBC2, RHPN1, BYSL, ZNF655, DLGAP5, PNKP, PRC1, COPB1, KIAA0408, ZNF417, MCM10, EWSR1, MCRS1, NUDT18, PBK, TRAF1, TRAF2, TRAF3, TRAF4, TRAF5, TRAF6, TRIM37, TNFRSF1B, LTBR, NGFR, UBE2U, UBE2H, ELAVL1, UBE2D1, UBE2D2, UBE2D3, UBE2E1, UBE2E2, UBE2E3, APTX, HSP90AA1, CCDC33, CDK5RAP2, LATS2, ANKRD11, ARNT2, CEP250, DDX6, RPL9, KAT5, FAM50B, RASD1, UBASH3A, KIF9, SCNM1, ZNF329, FAM161A, SSX2IP, CWF19L2, ZMAT2, CDC20B, C17orf59, CEP192, KIAA0753, CCDC14, RPGRIP1L, CNTROB, SPICE1, CEP128, CEP63, CEP89, RPGRIP1, XPO1, HIST2H2AC, EZH2, SUZ12, BMI1, HIST3H3, ZNF816, ZNF610, ZNF550, NCAPH2, ZNF263, ZNF211, ZNF214, CDC16, TPTE2, ZNF416, BBS7, CTNNB1DNAH17IRS4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRIM37_DNAH17


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TRIM37_DNAH17


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTRIM37C0524582Mulibrey Nanism4CTD_human;ORPHANET;UNIPROT
HgeneTRIM37C0016063Osteitis Fibrosa Disseminata1CTD_human
HgeneTRIM37C0019209Hepatomegaly1CTD_human;HPO
HgeneTRIM37C0376634Craniofacial Abnormalities1CTD_human