FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39510

FusionGeneSummary for TRIM2_WDR37

check button Fusion gene summary
Fusion gene informationFusion gene name: TRIM2_WDR37
Fusion gene ID: 39510
HgeneTgene
Gene symbol

TRIM2

WDR37

Gene ID

23321

22884

Gene nametripartite motif containing 2WD repeat domain 37
SynonymsCMT2R|RNF86-
Cytomap

4q31.3

10p15.3

Type of geneprotein-codingprotein-coding
Descriptiontripartite motif-containing protein 2E3 ubiquitin-protein ligase TRIM2RING finger protein 86RING-type E3 ubiquitin transferase TRIM2tripartite motif protein TRIM2WD repeat-containing protein 37
Modification date2018052320180523
UniProtAcc

Q9C040

Q9Y2I8

Ensembl transtripts involved in fusion geneENST00000437508, ENST00000494872, 
ENST00000338700, 
ENST00000358220, 
ENST00000381329, ENST00000263150, 
ENST00000482165, 
Fusion gene scores* DoF score11 X 10 X 7=7704 X 4 X 3=48
# samples 144
** MAII scorelog2(14/770*10)=-2.4594316186373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TRIM2 [Title/Abstract] AND WDR37 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-E1-5304-01ATRIM2chr4

154125712

+WDR37chr10

1149542

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000437508ENST00000358220TRIM2chr4

154125712

+WDR37chr10

1149542

+
intron-intronENST00000437508ENST00000381329TRIM2chr4

154125712

+WDR37chr10

1149542

+
intron-intronENST00000437508ENST00000263150TRIM2chr4

154125712

+WDR37chr10

1149542

+
intron-intronENST00000437508ENST00000482165TRIM2chr4

154125712

+WDR37chr10

1149542

+
3UTR-3CDSENST00000494872ENST00000358220TRIM2chr4

154125712

+WDR37chr10

1149542

+
3UTR-intronENST00000494872ENST00000381329TRIM2chr4

154125712

+WDR37chr10

1149542

+
3UTR-intronENST00000494872ENST00000263150TRIM2chr4

154125712

+WDR37chr10

1149542

+
3UTR-intronENST00000494872ENST00000482165TRIM2chr4

154125712

+WDR37chr10

1149542

+
In-frameENST00000338700ENST00000358220TRIM2chr4

154125712

+WDR37chr10

1149542

+
5CDS-intronENST00000338700ENST00000381329TRIM2chr4

154125712

+WDR37chr10

1149542

+
5CDS-intronENST00000338700ENST00000263150TRIM2chr4

154125712

+WDR37chr10

1149542

+
5CDS-intronENST00000338700ENST00000482165TRIM2chr4

154125712

+WDR37chr10

1149542

+

Top

FusionProtFeatures for TRIM2_WDR37


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRIM2

Q9C040

WDR37

Q9Y2I8

UBE2D1-dependent E3 ubiquitin-protein ligase thatmediates the ubiquitination of NEFL and of phosphorylated BCL2L11.Plays a neuroprotective function. May play a role in neuronalrapid ischemic tolerance. {ECO:0000250|UniProtKB:Q9ESN6}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TRIM2_WDR37


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRIM2_ENST00000338700_chr4_154125712_+_WDR37_ENST00000358220_chr10_1149542_+_263aa
MHRSGRYGTQISGEDEVECSDKDEPDLDGDVSSDCPTIRVPLTSLKSHQGVVIASDWLVGGKQAVTASWDRTANLYDVETSELVHSLTGH
DQELTHCCTHPTQRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAIN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRIM2_ENST00000338700_chr4_154125712_+_WDR37_ENST00000358220_chr10_1149542_+_789nt
ATGCACAGGAGTGGCCGTTATGGAACGCAGATATCTGGGGAAGATGAAGTAGAGTGCTCTGACAAGGACGAGCCCGACCTCGATGGGGAT
GTGTCCAGCGACTGCCCCACCATCCGCGTCCCACTGACATCCCTCAAGAGCCACCAGGGCGTGGTCATCGCCTCCGACTGGCTGGTTGGG
GGGAAGCAGGCTGTGACTGCCTCCTGGGACCGGACGGCAAACCTGTACGACGTGGAGACGTCCGAGCTCGTTCACTCTCTGACAGGGCAC
GACCAGGAGTTGACGCACTGCTGCACACACCCCACCCAGCGGCTCGTGGTGACCTCCTCCCGTGACACGACTTTCCGCCTCTGGGATTTC
AGGGACCCCTCCATCCACTCGGTGAATGTTTTCCAGGGACACACGGACACTGTGACTTCTGCCGTGTTCACCGTGGGAGACAACGTGGTT
TCAGGCAGCGATGACCGCACGGTGAAAGTCTGGGACTTGAAAAATATGAGATCCCCCATTGCAACTATTCGCACGGACTCTGCCATTAAC
AGGATCAATGTATGTGTCGGCCAAAAAATCATAGCCCTCCCCCATGACAACCGACAAGTGAGACTGTTTGATATGTCAGGAGTGCGCCTG
GCGCGGCTTCCCCGGAGCAGCCGACAGGGCCACAGGAGAATGGTATGCTGCTCGGCATGGAGTGAAGACCACCCCGTGTGCAATCTGTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRIM2_ENST00000338700_chr4_154125712_+_WDR37_ENST00000358220_chr10_1149542_+_3807nt
CCCAGTTGTCTGCGGGCTGCGGGGAGCTAAGTCCCCAGATTGGAGGAGGCTGGCTCTGGTCTTCGATGCACAGGAGTGGCCGTTATGGAA
CGCAGATATCTGGGGAAGATGAAGTAGAGTGCTCTGACAAGGACGAGCCCGACCTCGATGGGGATGTGTCCAGCGACTGCCCCACCATCC
GCGTCCCACTGACATCCCTCAAGAGCCACCAGGGCGTGGTCATCGCCTCCGACTGGCTGGTTGGGGGGAAGCAGGCTGTGACTGCCTCCT
GGGACCGGACGGCAAACCTGTACGACGTGGAGACGTCCGAGCTCGTTCACTCTCTGACAGGGCACGACCAGGAGTTGACGCACTGCTGCA
CACACCCCACCCAGCGGCTCGTGGTGACCTCCTCCCGTGACACGACTTTCCGCCTCTGGGATTTCAGGGACCCCTCCATCCACTCGGTGA
ATGTTTTCCAGGGACACACGGACACTGTGACTTCTGCCGTGTTCACCGTGGGAGACAACGTGGTTTCAGGCAGCGATGACCGCACGGTGA
AAGTCTGGGACTTGAAAAATATGAGATCCCCCATTGCAACTATTCGCACGGACTCTGCCATTAACAGGATCAATGTATGTGTCGGCCAAA
AAATCATAGCCCTCCCCCATGACAACCGACAAGTGAGACTGTTTGATATGTCAGGAGTGCGCCTGGCGCGGCTTCCCCGGAGCAGCCGAC
AGGGCCACAGGAGAATGGTATGCTGCTCGGCATGGAGTGAAGACCACCCCGTGTGCAATCTGTTCACCTGTGGGTTTGACCGGCAAGCCA
TTGGTTGGAACATCAACATCCCTGCATTGCTACAAGAAAAATAAGGACACCGGCAGCCCTTAGTTTCACTGTTTGCCAGCACAGACCTTT
GATGGGTGCAGGCTTTTCTGCGTATTAATCAGCCATTTTTGTGAGAGTTTGACCCTGGAAAGGGTGCTTTGTATATGTTCTTTTCACATA
GTGCCCAGCTTGCATGAAATGTACAGAGAAATGTGTGGTCGTATTTTTTACTTTTGTCTTGTATATGTATGTATATTGGGTCCTCTGGGC
AGTAGAGGCAAAGCTCACCTCCCATGTAGCACATGAAATGCTTGTGAGTTGTTGACATTGGACAGGTGAACAGTAGGGCATTACATTTGT
GTGAATTAAATGTGAACTTCTGTATTACGTTGCGGCGTCGGCAGTCCTGCGTTCCCTGGAGTAACTGTACGTATCTGCCTTTGCTGGGAA
GACTGTGGGGCTGCCTGTGTTGGCTGGCGACCAGCAGGATTGCTCCAGGATTTTGTGTTTACCTCGCGTGAAGTTCAGCACGTGCTGTCG
TGTAGTCAGCTTCTACTCTAATTTCTGTTACAGTTCTGCAAAGGTAACCTGGAGTTTAGAAGTTAAAAAAAAGCATGGGATGTTGGATTT
GCACCATTTGGAGTTTCTTTAGGAAAGAAAAGTTTTCTGCTTTTTTATAGAAAATCATTTCAGTCTCCCGAGGTCTCATGCTAGCAAATT
TTGAAATAGGATTCTAATCACTGATTTCAAATATTAAGCAAAATGTAAAGCACTTTAATTTATAGCTATGGTTATAAACAGGTTTTAGAT
GTTTCAAATGACTTGTCCACTGAATGTCACTTGACCTTGATAAGAGGCCGCCTGCACACAGAGCCCAGTTAATTCTCCGCACCTCGGTTG
TGTGCTTCCGAATGGGCTCACTCCCGTGGTGGTGTTTGAGAGCCAACAACACTACCTCAGAGACGGGTCTTTGGGAAACTTTGGGTCTCA
CTGTTGCCTGGCTGGAGCACTTTGGTTTATAGCTGGAATACTGAGTTCAGTTCAGAAGGCAGGAAAGACAGTCACACCGACGTGTCCTGA
AGGTGTAGGCTCTCCACTTAGGCGCACAAGCTGACGGCTGCAGCCAGCAGGCCCCGGTGACGAGACACTTCCAGGTCTTGTGGTGGGGAC
GCCTCTCAGTGCCAGTCCCGCCACTGCTGAGTGAGCCTGGTGTTCTTGCCTTCTTGGAAATTACTGCTCACCTGGTATCTGTACGTTAAT
GTTTCTTGCTGAGTTACAGTTTTGATAAAGAGGCTCTCATTTCCTGTGTCTTGTATATTCAGTCCTTTCAATACGTCCACCTGGAGGCTC
ACCACTTGGAGAGACACAGGAAGGTAATATTTACAGCTGTCATGTGACATCCCCAGGTCTTTGTGTTTTGCCCTGTTTTACGGTGAGGTA
GGAGGGAACCCATCTGGGGACCGGTAGGTGCAGGTGCAGTAGGACGTGGGACTTTTGGACCCGTCCTTTGGTGCAGCTCGCCAGGGATGA
GAGGCACCTCCCTACTTGGGTCTTCAGGAGCTGGTCCAAGGAGCTTCGAATCTAAGTCATCTAGAATGACCCTGAAATGACTGACAGCCC
CGGGCCCAAGAAAAACCCATAACCACCTCAGATGGATCTGACGTGGCTAAGGGACAAACAGCAAATATTTCAGTCATTTTGATTTTACAA
ATAAAAAATGTGTTGTGTTTTTGTCCGACATTATTTCCTGACTGCACTGTTCTGAGAATGGAGTCCACCTGGTCCCTCTGGTTGATTAGA
ATCTCAGGTTTCAGCTCCTGCTGTCCTGAGCGAACTTGCCTGATGCAGGGCTGTGCTGTGTCCAGATGTTGCTGGGGCCTCACTTTTTCT
CTTGGCTGGAGGTCCAATTGCCAGAGCCTCCCACACTGCACATACAAAGGTCTGAGCCCAGGGCAGCTTCTGGGGCCACTGCACAGGCCA
CCTGCTTGGGTTCCTCGGAGTTTAATTTGAAAGTCTGGGTGTCTTAGGATGATGGTTAGGAACATTGAAAAATGGCTGCAAATAGCCAAA
TCAAACTTAAGAACCAGATCTCTGCCAGATTAAACATTTTTGAAGCTTTTAAAAGTCAATATTCCTAGTGGCCACTGAGTTCCAGGCACA
CTGGTGCCCTTTACTGCCACAGCTGCTCACCTTGTCTGGCAAACTGGAGGGACCTCAGAAACTGGACTCCTGCATGTCCTTGGGGGCGCA
GCCCTGTGGTGCTCAGGCAGAGCTCTCAGGAGCCGGGGCACCTTGCTGTTCGCTGCTGTGTCGTCTTCTAATGTGAGCTCATCCACTGCT
GCTGCAGCGTGGTGATCAGGAGTCACAGACAAGATCGGGGATGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGCACGTGTGTGTGGCTAAA
TTAAGTCATACTGTCAACCACACGTGATCTCGTCTGAAACAGTGTTTGGAAGTGGGAACAGTTTTGTCCTGTATGCTGATGTGTCCAGAA
TTTCATTTAATGATAGACGGAAAATGTGTGGTTACTGAAAACTGTATATGATACAGAATTTCATAAGAGCCATGCTGTTGGGCAAAGCAA
CTCTTTTTCAACCACTGCTCATCAGTTTCTGTAGAGACAAAAACTCTGTACATATTTTGGAATCTGAAGAATCCTATGTAAATCATTTGT
TACTTAAGTCTGTGAAAAACATATTTCTTTGGAGGAAAATGTATGCATTTATAAGTGTTCCATGGAATCAGTTTTTATTGTATCGATATA
ATTGTCTCTAAGTGTTGACTGTCTTCATTGCAATATGAAATTCATTAAAATGTCCATGTTCCATAATTACTATTATAAAAGCTTTGTGTT
ATTGGGAGTCTTATTATTTTTATAGTTTTTCATGTTTTGCTTTGGTGAAACATTGTGAATGACTATATAAACATCACGATGAGCTAGAAA


Top

FusionGenePPI for TRIM2_WDR37


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRIM2SIRPA, UBE2U, UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2E1, UBE2E3, UBE2H, UBE2K, UBE2W, UBE2E2, DTNBP1, TNIK, BCL2L11, ELAVL1, MTRNR2L1, OTUB2, TNFAIP3, HSP90AA1, MNAT1, TRIM8, GJB5, UBAC1, CIB3, NUFIP1, PDHA1, LCA5, LRRC8E, TRIM3WDR37EWSR1, MOV10, NXF1, CCT3, CCT7, HSPA8, CCT6B, CCT6A, CLUH, TCP1, PACS2, PACS1, SETD2, CCDC101, LRRC46, KRAS, RBM14-RBM4, IQCF1, CCT4, CCT2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRIM2_WDR37


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TRIM2_WDR37


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTRIM2C0029408Degenerative polyarthritis1CTD_human
HgeneTRIM2C3809655CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2R1ORPHANET;UNIPROT