FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39475

FusionGeneSummary for TRIM24_NTRK2

check button Fusion gene summary
Fusion gene informationFusion gene name: TRIM24_NTRK2
Fusion gene ID: 39475
HgeneTgene
Gene symbol

TRIM24

NTRK2

Gene ID

8805

4915

Gene nametripartite motif containing 24neurotrophic receptor tyrosine kinase 2
SynonymsPTC6|RNF82|TF1A|TIF1|TIF1A|TIF1ALPHA|hTIF1EIEE58|GP145-TrkB|OBHD|TRKB|trk-B
Cytomap

7q33-q34

9q21.33

Type of geneprotein-codingprotein-coding
Descriptiontranscription intermediary factor 1-alphaE3 ubiquitin-protein ligase TRIM24RING finger protein 82RING-type E3 ubiquitin transferase TIF1-alphaTIF1-alphatranscriptional intermediary factor 1BDNF/NT-3 growth factors receptorBDNF-tropomyosine receptor kinase Bneurotrophic tyrosine kinase receptor type 2tropomyosin-related kinase Btyrosine kinase receptor B
Modification date2018051920180523
UniProtAcc

O15164

Q16620

Ensembl transtripts involved in fusion geneENST00000343526, ENST00000415680, 
ENST00000497516, 
ENST00000376214, 
ENST00000376213, ENST00000395882, 
ENST00000304053, ENST00000376208, 
ENST00000277120, ENST00000323115, 
ENST00000359847, ENST00000395866, 
Fusion gene scores* DoF score6 X 6 X 5=1805 X 4 X 4=80
# samples 75
** MAII scorelog2(7/180*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TRIM24 [Title/Abstract] AND NTRK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTRIM24

GO:0016567

protein ubiquitination

19556538

HgeneTRIM24

GO:0071391

cellular response to estrogen stimulus

21164480


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-8091-01ATRIM24chr7

138258387

+NTRK2chr9

87482158

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000343526ENST00000376214TRIM24chr7

138258387

+NTRK2chr9

87482158

+
In-frameENST00000343526ENST00000376213TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000395882TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000304053TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000376208TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000277120TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000323115TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000359847TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000343526ENST00000395866TRIM24chr7

138258387

+NTRK2chr9

87482158

+
In-frameENST00000415680ENST00000376214TRIM24chr7

138258387

+NTRK2chr9

87482158

+
In-frameENST00000415680ENST00000376213TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000395882TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000304053TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000376208TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000277120TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000323115TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000359847TRIM24chr7

138258387

+NTRK2chr9

87482158

+
5CDS-intronENST00000415680ENST00000395866TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-3CDSENST00000497516ENST00000376214TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-3CDSENST00000497516ENST00000376213TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000395882TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000304053TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000376208TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000277120TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000323115TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000359847TRIM24chr7

138258387

+NTRK2chr9

87482158

+
intron-intronENST00000497516ENST00000395866TRIM24chr7

138258387

+NTRK2chr9

87482158

+

Top

FusionProtFeatures for TRIM24_NTRK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRIM24

O15164

NTRK2

Q16620

Transcriptional coactivator that interacts with numerousnuclear receptors and coactivators and modulates the transcriptionof target genes. Interacts with chromatin depending on histone H3modifications, having the highest affinity for histone H3 that isboth unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23'(H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotesubiquitination and proteasomal degradation of p53/TP53. Plays arole in the regulation of cell proliferation and apoptosis, atleast in part via its effects on p53/TP53 levels. Up-regulatesligand-dependent transcription activation by AR, GCR/NR3C1,thyroid hormone receptor (TR) and ESR1. Modulates transcriptionactivation by retinoic acid (RA) receptors, including RARA. Playsa role in regulating retinoic acid-dependent proliferation ofhepatocytes (By similarity). {ECO:0000250,ECO:0000269|PubMed:16322096, ECO:0000269|PubMed:19556538,ECO:0000269|PubMed:21164480}. Receptor tyrosine kinase involved in the development andthe maturation of the central and the peripheral nervous systemsthrough regulation of neuron survival, proliferation, migration,differentiation, and synapse formation and plasticity. Receptorfor BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is lessefficient in activating the receptor but regulates neuron survivalthrough NTRK2. Upon ligand-binding, undergoes homodimerization,autophosphorylation and activation. Recruits, phosphorylatesand/or activates several downstream effectors including SHC1,FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlappingsignaling cascades. Through SHC1, FRS2, SH2B1, SH2B2 activates theGRB2-Ras-MAPK cascade that regulates for instance neuronaldifferentiation including neurite outgrowth. Through the sameeffectors controls the Ras-PI3 kinase-AKT1 signaling cascade thatmainly regulates growth and survival. Through PLCG1 and thedownstream protein kinase C-regulated pathways controls synapticplasticity. Thereby, plays a role in learning and memory byregulating both short term synaptic function and long-termpotentiation. PLCG1 also leads to NF-Kappa-B activation and thetranscription of genes involved in cell survival. Hence, it isable to suppress anoikis, the apoptosis resulting from loss ofcell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells and mediatecommunication between neurons and glia.{ECO:0000269|PubMed:15494731}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219289_3596711051Coiled coilOntology_term=ECO:0000255
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219289_3596371017Coiled coilOntology_term=ECO:0000255
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219344_3476711051Compositional biasNote=Poly-Gln
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+12199_156711051Compositional biasNote=Poly-Ala
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219344_3476371017Compositional biasNote=Poly-Gln
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+12199_156371017Compositional biasNote=Poly-Ala
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219158_2116711051Zinc fingerB box-type 1
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219218_2596711051Zinc fingerB box-type 2
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+121956_826711051Zinc fingerRING-type
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219158_2116371017Zinc fingerB box-type 1
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219218_2596371017Zinc fingerB box-type 2
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+121956_826371017Zinc fingerRING-type
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219538_807481839DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215538_807481554DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017538_807465823DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012148_196-30478DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012197_282-30478DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012295_365-30478DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+01232_61-30478DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012538_807-30478DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114538_807465538DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320538_807465823DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421538_807481839DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012148_196-114322DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012197_282-114322DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012295_365-114322DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+01232_61-114322DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012538_807-114322DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013148_196-184478DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013197_282-184478DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013295_365-184478DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+01332_61-184478DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013538_807-184478DomainProtein kinase
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219544_552481839Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215544_552481554Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017544_552465823Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012544_552-30478Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114544_552465538Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320544_552465823Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421544_552481839Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012544_552-114322Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013544_552-184478Nucleotide bindingATP
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012116_137-30478RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+01292_113-30478RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012116_137-114322RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+01292_113-114322RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013116_137-184478RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+01392_113-184478RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+01232_430-30478Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012455_822-30478Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+01232_430-114322Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012455_822-114322Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+01332_430-184478Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013455_822-184478Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000359847+012431_454-30478TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395866+012431_454-114322TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000395882+013431_454-184478TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219932_9876711051DomainBromo
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219932_9876371017DomainBromo
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219891_9076711051MotifNuclear localization signal
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219891_9076371017MotifNuclear localization signal
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219754_7796711051RegionNote=Nuclear receptor binding site (NRBS)
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219754_7796371017RegionNote=Nuclear receptor binding site (NRBS)
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219826_8736711051Zinc fingerPHD-type
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219826_8736371017Zinc fingerPHD-type
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219148_196481839DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219197_282481839DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219295_365481839DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+121932_61481839DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215148_196481554DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215197_282481554DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215295_365481554DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+121532_61481554DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017148_196465823DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017197_282465823DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017295_365465823DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+101732_61465823DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114148_196465538DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114197_282465538DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114295_365465538DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+111432_61465538DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320148_196465823DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320197_282465823DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320295_365465823DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+132032_61465823DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421148_196481839DomainNote=LRRCT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421197_282481839DomainNote=Ig-like C2-type 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421295_365481839DomainNote=Ig-like C2-type 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+142132_61481839DomainNote=LRRNT
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219116_137481839RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+121992_113481839RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215116_137481554RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+121592_113481554RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017116_137465823RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+101792_113465823RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114116_137465538RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+111492_113465538RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320116_137465823RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+132092_113465823RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421116_137481839RepeatNote=LRR 2
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+142192_113481839RepeatNote=LRR 1
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+121932_430481839Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219455_822481839Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+121532_430481554Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215455_822481554Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+101732_430465823Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017455_822465823Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+111432_430465538Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114455_822465538Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+132032_430465823Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320455_822465823Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+142132_430481839Topological domainExtracellular
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421455_822481839Topological domainCytoplasmic
TgeneNTRK2chr7:138258387chr9:87482158ENST00000277120+1219431_454481839TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000304053+1215431_454481554TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000323115+1017431_454465823TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376208+1114431_454465538TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376213+1320431_454465823TransmembraneHelical
TgeneNTRK2chr7:138258387chr9:87482158ENST00000376214+1421431_454481839TransmembraneHelical


Top

FusionGeneSequence for TRIM24_NTRK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_1029aa
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKLLPCLHSFCQRCLPAPQRYLM
LPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVII
DTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLTSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSG
LSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRT
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGTDGKAFGSPMIDLSSPVGGSTNLPSLPDIDCS
STIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENP
QYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFT
GVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGD
FGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTE

>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_1029aa
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKLLPCLHSFCQRCLPAPQRYLM
LPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVII
DTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLTSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSG
LSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRT
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGTDGKAFGSPMIDLSSPVGGSTNLPSLPDIDCS
STIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENP
QYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFT
GVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGD
FGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTE

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_995aa
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKLLPCLHSFCQRCLPAPQRYLM
LPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVII
DTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLTSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSG
LSSNQLSKFPTQISLAQLRLQHMQQQQPPPRLINFQNHSPKPNGPVLPPHPQQLRTPPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSG
QGTPSTTNSTSSTPSSPTITSAAGTDGKAFGSPMIDLSSPVGGSTNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSS
VPSPGLAGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_995aa
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKLLPCLHSFCQRCLPAPQRYLM
LPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVII
DTLITKLMEKTKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLTSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSG
LSSNQLSKFPTQISLAQLRLQHMQQQQPPPRLINFQNHSPKPNGPVLPPHPQQLRTPPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSG
QGTPSTTNSTSSTPSSPTITSAAGTDGKAFGSPMIDLSSPVGGSTNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSS
VPSPGLAGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGA
FGKVFLAECTNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFTGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVL
MAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYR
KFTTESDVWSLGVVLWEIFTTGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVTELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_3087nt
ATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAG
AACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTGTTGGACACTTGCGCCGTGTGCCAC
CAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATG
CTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACC
CAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAACTTTTTTGTGAAGGACACTACTGAG
GTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTT
GAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTCAGACAGAAAGAGGAAGTATCTCCA
GAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAGCTGTACTGTGAGACATGTGACAAA
CTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATA
GATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAAAACAGAATTATTGAAGTAAATCAA
AATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAAAAAGGAAAAGCTCTACTGCATCAG
TTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTCTCTAAACAATTGGAGCATGTCATG
CATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATTACATACCGGTTACGGCACCTCCTT
CGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTCTGGGCTCAAAATATCATCAACTTA
GGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAACAGAATTCACAGCCACCAAGTGGT
TTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCATATGCAGCAACAGGTAATGGCTCAG
AGGCAACAGGTGCAACGGAGGCCAGCACCTGTGGGTTTACCAAACCCTAGAATGCAGGGGCCCATCCAGCAACCTTCCATCTCTCATCAG
CAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAACAACTGAGATAT
CCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAG
ATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCAGCAGGATATGAT
GGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGATATTGACTGTTCA
AGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGAACGGTCCAGTCA
CCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATC
TCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCC
CAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTA
GGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTG
AAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTAT
GGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCT
GATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATG
GTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGAC
TTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGC
ATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGG
TACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAG
CTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCT

>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_3087nt
ATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAG
AACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTGTTGGACACTTGCGCCGTGTGCCAC
CAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATG
CTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACC
CAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAACTTTTTTGTGAAGGACACTACTGAG
GTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTT
GAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTCAGACAGAAAGAGGAAGTATCTCCA
GAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAGCTGTACTGTGAGACATGTGACAAA
CTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATA
GATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAAAACAGAATTATTGAAGTAAATCAA
AATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAAAAAGGAAAAGCTCTACTGCATCAG
TTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTCTCTAAACAATTGGAGCATGTCATG
CATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATTACATACCGGTTACGGCACCTCCTT
CGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTCTGGGCTCAAAATATCATCAACTTA
GGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAACAGAATTCACAGCCACCAAGTGGT
TTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCATATGCAGCAACAGGTAATGGCTCAG
AGGCAACAGGTGCAACGGAGGCCAGCACCTGTGGGTTTACCAAACCCTAGAATGCAGGGGCCCATCCAGCAACCTTCCATCTCTCATCAG
CAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAACAACTGAGATAT
CCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAG
ATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCAGCAGGATATGAT
GGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGATATTGACTGTTCA
AGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGAACGGTCCAGTCA
CCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATC
TCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCC
CAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTA
GGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTG
AAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTAT
GGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCT
GATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATG
GTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGAC
TTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGC
ATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGG
TACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAG
CTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCT

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_2985nt
ATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAG
AACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTGTTGGACACTTGCGCCGTGTGCCAC
CAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATG
CTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACC
CAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAACTTTTTTGTGAAGGACACTACTGAG
GTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTT
GAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTCAGACAGAAAGAGGAAGTATCTCCA
GAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAGCTGTACTGTGAGACATGTGACAAA
CTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATA
GATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAAAACAGAATTATTGAAGTAAATCAA
AATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAAAAAGGAAAAGCTCTACTGCATCAG
TTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTCTCTAAACAATTGGAGCATGTCATG
CATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATTACATACCGGTTACGGCACCTCCTT
CGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTCTGGGCTCAAAATATCATCAACTTA
GGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAACAGAATTCACAGCCACCAAGTGGT
TTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCATATGCAGCAACAGCAACCGCCTCCA
CGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAACAACTGAGATATCCACCAAACCAG
AACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAGATCAGCAGTGGA
CAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCAGCAGGATATGATGGAAAGGCTTTT
GGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGATATTGACTGTTCAAGTACTATTATG
CTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGAACGGTCCAGTCACCAAATTCATCA
GTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_2985nt
ATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAG
AACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTGTTGGACACTTGCGCCGTGTGCCAC
CAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATG
CTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACC
CAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAACTTTTTTGTGAAGGACACTACTGAG
GTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTT
GAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTCAGACAGAAAGAGGAAGTATCTCCA
GAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAGCTGTACTGTGAGACATGTGACAAA
CTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATA
GATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAAAACAGAATTATTGAAGTAAATCAA
AATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAAAAAGGAAAAGCTCTACTGCATCAG
TTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTCTCTAAACAATTGGAGCATGTCATG
CATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATTACATACCGGTTACGGCACCTCCTT
CGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTCTGGGCTCAAAATATCATCAACTTA
GGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAACAGAATTCACAGCCACCAAGTGGT
TTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCATATGCAGCAACAGCAACCGCCTCCA
CGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAACAACTGAGATATCCACCAAACCAG
AACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAGATCAGCAGTGGA
CAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCAGCAGGATATGATGGAAAGGCTTTT
GGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGATATTGACTGTTCAAGTACTATTATG
CTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGAACGGTCCAGTCACCAAATTCATCA
GTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGT
AACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGC
ATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCC
TTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGT
GACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTG
GAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTG
ATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCG
TCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCC
CGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGG
AAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCA
AACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGG
TGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_5455nt
GACAGATACCCTCCTTCCGGCCGCGCCACTCGGGAGGCGGATCCCGTGGGCCTGAGGAGGCTTCCCCCGCCCGGTTTGCTTTCCCTCCCT
CGCTGGCGCTGCCGCGAGTCCACCGAGCGGCCTCTGAGGAGCAGCCGCAGGAGGAGGAGGAGGTCGTCGGGGGCGGCGGGCGGAGACCGC
GCTCTCGCTTCCCCGGCGGCGGCAAGGGCAGGACAATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGG
CCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAGAACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCC
GGCTCAACCTGTTGGACACTTGCGCCGTGTGCCACCAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCC
AGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATGCTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCG
GCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACCCAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACA
TCATAGATAACTTTTTTGTGAAGGACACTACTGAGGTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACA
ACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTTGAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAG
ACCACACTGTCAGACAGAAAGAGGAAGTATCTCCAGAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGG
AGCAGCTGAAGCTGTACTGTGAGACATGTGACAAACTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTA
TAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATAGATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAA
ATCAGATCCAAAACAGAATTATTGAAGTAAATCAAAATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAG
AAATAAATAAAAAAGGAAAAGCTCTACTGCATCAGTTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAG
TGGCTGGACTCTCTAAACAATTGGAGCATGTCATGCATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCA
AACGACTGATTACATACCGGTTACGGCACCTCCTTCGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTG
ATCCTAGTTTCTGGGCTCAAAATATCATCAACTTAGGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATC
CTGTCGTGGAACAGAATTCACAGCCACCAAGTGGTTTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTAC
GGCTCCAGCATATGCAGCAACAGGTAATGGCTCAGAGGCAACAGGTGCAACGGAGGCCAGCACCTGTGGGTTTACCAAACCCTAGAATGC
AGGGGCCCATCCAGCAACCTTCCATCTCTCATCAGCAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGAC
CAGTTCTTCCTCCTCATCCTCAACAACTGAGATATCCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGG
CTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAGATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTT
CCAGCCCCACGATTACTAGTGCAGCAGGATATGATGGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTT
ATAATCTTCCCTCTCTTCCGGATATTGACTGTTCAAGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCC
AGCCAAGACCACCCTCAAACAGAACGGTCCAGTCACCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCA
ATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTA
TTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACA
TCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTG
AGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGA
CCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATG
GGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGA
TGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCC
TGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACA
CAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGT
TGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGC
AGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCA
TCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCC
AACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTA
ACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCT
TTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCT
TACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCA
GACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCAC
TTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTT
TGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAA
GATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTG
TTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTT
TTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTT
TTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGAT
TCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTT
TACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGG
TCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACT
TATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGAC
CCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTG
AGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTAC
TCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTG
CCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATT
TGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGAC
ATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGC
TCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAA
GTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTAT

>In-frame_TRIM24_ENST00000343526_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_5455nt
GACAGATACCCTCCTTCCGGCCGCGCCACTCGGGAGGCGGATCCCGTGGGCCTGAGGAGGCTTCCCCCGCCCGGTTTGCTTTCCCTCCCT
CGCTGGCGCTGCCGCGAGTCCACCGAGCGGCCTCTGAGGAGCAGCCGCAGGAGGAGGAGGAGGTCGTCGGGGGCGGCGGGCGGAGACCGC
GCTCTCGCTTCCCCGGCGGCGGCAAGGGCAGGACAATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGG
CCTCCGGGGGGCCCTCGGCGGCGCCGAGCGGGGAGAACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCC
GGCTCAACCTGTTGGACACTTGCGCCGTGTGCCACCAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCC
AGCGCTGCCTGCCCGCGCCCCAGCGCTACCTCATGCTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCG
GCTCGCCGGTCAGCGGCTCGTCGCCGTTCGCCACCCAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACA
TCATAGATAACTTTTTTGTGAAGGACACTACTGAGGTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACA
ACGCAGAAGCCAATGGGTTTTGTGTAGAGTGTGTTGAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAG
ACCACACTGTCAGACAGAAAGAGGAAGTATCTCCAGAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGG
AGCAGCTGAAGCTGTACTGTGAGACATGTGACAAACTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTA
TAGAAGAAGCTTTTCAGAATCAGAAAGTGATCATAGATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAA
ATCAGATCCAAAACAGAATTATTGAAGTAAATCAAAATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAG
AAATAAATAAAAAAGGAAAAGCTCTACTGCATCAGTTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAG
TGGCTGGACTCTCTAAACAATTGGAGCATGTCATGCATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCA
AACGACTGATTACATACCGGTTACGGCACCTCCTTCGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTG
ATCCTAGTTTCTGGGCTCAAAATATCATCAACTTAGGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATC
CTGTCGTGGAACAGAATTCACAGCCACCAAGTGGTTTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTAC
GGCTCCAGCATATGCAGCAACAGGTAATGGCTCAGAGGCAACAGGTGCAACGGAGGCCAGCACCTGTGGGTTTACCAAACCCTAGAATGC
AGGGGCCCATCCAGCAACCTTCCATCTCTCATCAGCAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGAC
CAGTTCTTCCTCCTCATCCTCAACAACTGAGATATCCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGG
CTTTCTTGGCTCAACAAGCCATAAAACAGTGGCAGATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTT
CCAGCCCCACGATTACTAGTGCAGCAGGATATGATGGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTT
ATAATCTTCCCTCTCTTCCGGATATTGACTGTTCAAGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCC
AGCCAAGACCACCCTCAAACAGAACGGTCCAGTCACCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCA
ATGATGATGACTCTGCCAGCCCACTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTA
TTGGAATGACCAAGATCCCTGTCATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACA
TCAAGCGACATAACATTGTTCTGAAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTG
AGCAGGACAAGATCTTGGTGGCAGTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGA
CCAACCTCCAGCATGAGCACATCGTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATG
GGGACCTCAACAAGTTCCTCAGGGCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGA
TGCTGCATATAGCCCAGCAGATCGCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCC
TGGTCGGGGAGAACTTGCTGGTGAAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACA
CAATGCTGCCCATTCGCTGGATGCCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGT
TGTGGGAGATTTTCACCTATGGCAAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGC
AGCGACCCCGCACGTGCCCCCAGGAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCA
TCCATACCCTCCTTCAGAACTTGGCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCC
AACGTACTCCTCAGACGGGCTGAGAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTA
ACATCAAAGACTCCGAGAAGCTCTCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCT
TTCTCTCTTTCCATCTCCCTTGGTTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCT
TACCCTTTCTTTTGAATCAATCTGGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCA
GACACTCCAGTTTGCCCACCACAACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCAC
TTAAACTTTGTCACTTCTGCTGTACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTT
TGGATGGCTTAAGCCTGTGTATAAAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAA
GATTTATTATGAACCGCAATATGGGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTG
TTAGCTGGGAAGAATGTATTCGGCACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTT
TTCCCATCACCAGAAATGATAGCGTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTT
TTGTCTTCGTAGGTTGTGATGATAGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGAT
TCATGTCCAGAGCTCATTTCGGGGTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTT
TACAATGAACTTTTCAGATCTCACTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGG
TCTTCGTCGATTAATACCTTGTGTGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACT
TATACAATTAGGGGAAGCTAATGGAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGAC
CCTGAAGCCTGGAAATCCTCATCCACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTG
AGGGCATCACATGCACTCATGTTCAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTAC
TCCATTGTCAGTATGCTGTTTTTGTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTG
CCCAGACCAAGCACTGGAAGTGTGCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATT
TGAATGGTCAGATATACCAAGAAAGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGAC
ATCTTTATAACATGAGCCAGATTGAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGC
TCTGTTTTAGGTTTTGCTTGCGCCTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAA
GTGCAAATTAACAGAACAAAAGGAAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTAT

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376214_chr9_87482158_+_5252nt
CCGCGAGTCCACCGAGCGGCCTCTGAGGAGCAGCCGCAGGAGGAGGAGGAGGTCGTCGGGGGCGGCGGGCGGAGACCGCGCTCTCGCTTC
CCCGGCGGCGGCAAGGGCAGGACAATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGG
CCCTCGGCGGCGCCGAGCGGGGAGAACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTG
TTGGACACTTGCGCCGTGTGCCACCAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTG
CCCGCGCCCCAGCGCTACCTCATGCTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTC
AGCGGCTCGTCGCCGTTCGCCACCCAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAAC
TTTTTTGTGAAGGACACTACTGAGGTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCC
AATGGGTTTTGTGTAGAGTGTGTTGAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTC
AGACAGAAAGAGGAAGTATCTCCAGAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAG
CTGTACTGTGAGACATGTGACAAACTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCT
TTTCAGAATCAGAAAGTGATCATAGATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAA
AACAGAATTATTGAAGTAAATCAAAATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAA
AAAGGAAAAGCTCTACTGCATCAGTTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTC
TCTAAACAATTGGAGCATGTCATGCATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATT
ACATACCGGTTACGGCACCTCCTTCGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTC
TGGGCTCAAAATATCATCAACTTAGGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAA
CAGAATTCACAGCCACCAAGTGGTTTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCAT
ATGCAGCAACAGCAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAA
CAACTGAGATATCCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATA
AAACAGTGGCAGATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCA
GCAGGATATGATGGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGAT
ATTGACTGTTCAAGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGA
ACGGTCCAGTCACCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCA
CTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTC
ATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTG
AAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCA
GTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATC
GTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGG
GCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATC
GCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTG
AAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATG
CCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGC
AAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAG
GAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTG
GCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGA
GAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTC
TCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGG
TTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCT
GGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACA
ACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGT
ACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATA
AAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATG
GGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGG
CACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGC
GTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGAT
AGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGG
GTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCA
CTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTG
TGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATG
GAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATC
CACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTT
CAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTT
GTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGT
GCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAA
AGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATT
GAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGC
CTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGG
AAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAGA

>In-frame_TRIM24_ENST00000415680_chr7_138258387_+_NTRK2_ENST00000376213_chr9_87482158_+_5252nt
CCGCGAGTCCACCGAGCGGCCTCTGAGGAGCAGCCGCAGGAGGAGGAGGAGGTCGTCGGGGGCGGCGGGCGGAGACCGCGCTCTCGCTTC
CCCGGCGGCGGCAAGGGCAGGACAATGGAGGTGGCGGTGGAGAAGGCGGTGGCGGCGGCGGCAGCGGCCTCGGCTGCGGCCTCCGGGGGG
CCCTCGGCGGCGCCGAGCGGGGAGAACGAGGCCGAGAGTCGGCAGGGCCCGGACTCGGAGCGCGGCGGCGAGGCGGCCCGGCTCAACCTG
TTGGACACTTGCGCCGTGTGCCACCAGAACATCCAGAGCCGGGCGCCCAAGCTGCTGCCCTGCCTGCACTCTTTCTGCCAGCGCTGCCTG
CCCGCGCCCCAGCGCTACCTCATGCTGCCCGCGCCCATGCTGGGCTCGGCCGAGACCCCGCCACCCGTCCCTGCCCCCGGCTCGCCGGTC
AGCGGCTCGTCGCCGTTCGCCACCCAAGTTGGAGTCATTCGTTGCCCAGTTTGCAGCCAAGAATGTGCAGAGAGACACATCATAGATAAC
TTTTTTGTGAAGGACACTACTGAGGTTCCCAGCAGTACAGTAGAAAAGTCAAATCAGGTATGTACAAGCTGTGAGGACAACGCAGAAGCC
AATGGGTTTTGTGTAGAGTGTGTTGAATGGCTCTGCAAGACGTGTATCAGAGCTCATCAGAGGGTAAAGTTCACAAAAGACCACACTGTC
AGACAGAAAGAGGAAGTATCTCCAGAGGCAGTTGGTGTCACCAGCCAGCGACCAGTGTTTTGTCCTTTTCATAAAAAGGAGCAGCTGAAG
CTGTACTGTGAGACATGTGACAAACTGACATGTCGAGACTGTCAGTTGTTAGAACATAAAGAGCATAGATACCAATTTATAGAAGAAGCT
TTTCAGAATCAGAAAGTGATCATAGATACACTAATCACCAAACTGATGGAAAAAACAAAATACATAAAATTCACAGGAAATCAGATCCAA
AACAGAATTATTGAAGTAAATCAAAATCAAAAGCAGGTGGAACAGGATATTAAAGTTGCTATATTTACACTGATGGTAGAAATAAATAAA
AAAGGAAAAGCTCTACTGCATCAGTTAGAGAGCCTTGCAAAGGACCATCGCATGAAACTTATGCAACAACAACAGGAAGTGGCTGGACTC
TCTAAACAATTGGAGCATGTCATGCATTTTTCTAAATGGGCAGTTTCCAGTGGCAGCAGTACAGCATTACTTTATAGCAAACGACTGATT
ACATACCGGTTACGGCACCTCCTTCGTGCAAGGTGTGATGCATCCCCAGTGACCAACAACACCATCCAATTTCACTGTGATCCTAGTTTC
TGGGCTCAAAATATCATCAACTTAGGTTCTTTAGTAATCGAGGATAAAGAGAGCCAGCCACAAATGCCTAAGCAGAATCCTGTCGTGGAA
CAGAATTCACAGCCACCAAGTGGTTTATCATCAAACCAGTTATCCAAGTTCCCAACACAGATCAGCCTAGCTCAATTACGGCTCCAGCAT
ATGCAGCAACAGCAACCGCCTCCACGTTTGATAAACTTTCAGAATCACAGCCCCAAACCCAATGGACCAGTTCTTCCTCCTCATCCTCAA
CAACTGAGATATCCACCAAACCAGAACATACCACGACAAGCAATAAAGCCAAACCCCCTACAGATGGCTTTCTTGGCTCAACAAGCCATA
AAACAGTGGCAGATCAGCAGTGGACAGGGAACCCCATCAACTACCAACAGCACATCCTCTACTCCTTCCAGCCCCACGATTACTAGTGCA
GCAGGATATGATGGAAAGGCTTTTGGTTCACCTATGATCGATTTGAGCTCACCAGTGGGAGGGTCTTATAATCTTCCCTCTCTTCCGGAT
ATTGACTGTTCAAGTACTATTATGCTGGACAATATTGTGAGGAAAGATACTAATATAGATCATGGCCAGCCAAGACCACCCTCAAACAGA
ACGGTCCAGTCACCAAATTCATCAGTGCCATCTCCAGGCCTTGCAGGCCCAGCCTCCGTTATCAGCAATGATGATGACTCTGCCAGCCCA
CTCCATCACATCTCCAATGGGAGTAACACTCCATCTTCTTCGGAAGGTGGCCCAGATGCTGTCATTATTGGAATGACCAAGATCCCTGTC
ATTGAAAATCCCCAGTACTTTGGCATCACCAACAGTCAGCTCAAGCCAGACACATTTGTTCAGCACATCAAGCGACATAACATTGTTCTG
AAAAGGGAGCTAGGCGAAGGAGCCTTTGGAAAAGTGTTCCTAGCTGAATGCTATAACCTCTGTCCTGAGCAGGACAAGATCTTGGTGGCA
GTGAAGACCCTGAAGGATGCCAGTGACAATGCACGCAAGGACTTCCACCGTGAGGCCGAGCTCCTGACCAACCTCCAGCATGAGCACATC
GTCAAGTTCTATGGCGTCTGCGTGGAGGGCGACCCCCTCATCATGGTCTTTGAGTACATGAAGCATGGGGACCTCAACAAGTTCCTCAGG
GCACACGGCCCTGATGCCGTGCTGATGGCTGAGGGCAACCCGCCCACGGAACTGACGCAGTCGCAGATGCTGCATATAGCCCAGCAGATC
GCCGCGGGCATGGTCTACCTGGCGTCCCAGCACTTCGTGCACCGCGATTTGGCCACCAGGAACTGCCTGGTCGGGGAGAACTTGCTGGTG
AAAATCGGGGACTTTGGGATGTCCCGGGACGTGTACAGCACTGACTACTACAGGGTCGGTGGCCACACAATGCTGCCCATTCGCTGGATG
CCTCCAGAGAGCATCATGTACAGGAAATTCACGACGGAAAGCGACGTCTGGAGCCTGGGGGTCGTGTTGTGGGAGATTTTCACCTATGGC
AAACAGCCCTGGTACCAGCTGTCAAACAATGAGGTGATAGAGTGTATCACTCAGGGCCGAGTCCTGCAGCGACCCCGCACGTGCCCCCAG
GAGGTGTATGAGCTGATGCTGGGGTGCTGGCAGCGAGAGCCCCACATGAGGAAGAACATCAAGGGCATCCATACCCTCCTTCAGAACTTG
GCCAAGGCATCTCCGGTCTACCTGGACATTCTAGGCTAGGGCCCTTTTCCCCAGACCGATCCTTCCCAACGTACTCCTCAGACGGGCTGA
GAGGATGAACATCTTTTAACTGCCGCTGGAGGCCACCAAGCTGCTCTCCTTCACTCTGACAGTATTAACATCAAAGACTCCGAGAAGCTC
TCGAGGGAAGCAGTGTGTACTTCTTCATCCATAGACACAGTATTGACTTCTTTTTGGCATTATCTCTTTCTCTCTTTCCATCTCCCTTGG
TTGTTCCTTTTTCTTTTTTTAAATTTTCTTTTTCTTTTTTTTTTCGTCTTCCCTGCTTCACGATTCTTACCCTTTCTTTTGAATCAATCT
GGCTTCTGCATTACTATTAACTCTGCATAGACAAAGGCCTTAACAAACGTAATTTGTTATATCAGCAGACACTCCAGTTTGCCCACCACA
ACTAACAATGCCTTGTTGTATTCCTGCCTTTGATGTGGATGAAAAAAAGGGAAAACAAATATTTCACTTAAACTTTGTCACTTCTGCTGT
ACAGATATCGAGAGTTTCTATGGATTCACTTCTATTTATTTATTATTATTACTGTTCTTATTGTTTTTGGATGGCTTAAGCCTGTGTATA
AAAAAGAAAACTTGTGTTCAATCTGTGAAGCCTTTATCTATGGGAGATTAAAACCAGAGAGAAAGAAGATTTATTATGAACCGCAATATG
GGAGGAACAAAGACAACCACTGGGATCAGCTGGTGTCAGTCCCTACTTAGGAAATACTCAGCAACTGTTAGCTGGGAAGAATGTATTCGG
CACCTTCCCCTGAGGACCTTTCTGAGGAGTAAAAAGACTACTGGCCTCTGTGCCATGGATGATTCTTTTCCCATCACCAGAAATGATAGC
GTGCAGTAGAGAGCAAAGATGGCTTCCGTGAGACACAAGATGGCGCATAGTGTGCTCGGACACAGTTTTGTCTTCGTAGGTTGTGATGAT
AGCACTGGTTTGTTTCTCAAGCGCTATCCACAGAACCTTTGTCAACTTCAGTTGAAAAGAGGTGGATTCATGTCCAGAGCTCATTTCGGG
GTCAGGTGGGAAAGCCAAGAACTTGGAAAAGATAAGACAAGCTATAAATTCGGAGGCAAGTTTCTTTTACAATGAACTTTTCAGATCTCA
CTTCCCTCCGACCCCTAACTTCCATGCCCACCCGTCCTTTTAACTGTGCAAGCAAAATTGTGCATGGTCTTCGTCGATTAATACCTTGTG
TGCAGACACTACTGCTCCAGACGTCGTTTCCCTGATAGGTAGAGCAGATCCATAAAAAGGTATGACTTATACAATTAGGGGAAGCTAATG
GAGTTTATTAGCTGAGTATCAATGTCTCTGCGTTGTACGGTGGTGATGGGTTTTAATGAATATGGACCCTGAAGCCTGGAAATCCTCATC
CACGTCGAACCCACAGGACTGTGGGAAGGGCAGAATCAATCCCTAAGGGAAAGGAAACCTCACCCTGAGGGCATCACATGCACTCATGTT
CAGTGTACACAGGTCAAGTCCCTTGCTCTGGGCTCTAGTTGGGAGAGTGGTTTCATTCCAAGTGTACTCCATTGTCAGTATGCTGTTTTT
GTTTCCTTCACTCCATTCAAAAAGTCAAAATACAAAATTTGGCACAGCATGCCAACGGGAGGCTGTGCCCAGACCAAGCACTGGAAGTGT
GCTTCTAGGCATAGTCATTGGTTTTGCAAAAAGAGGGCTCAAATTTAAATAGAAATTTACAGCTATTTGAATGGTCAGATATACCAAGAA
AGAAAAATATTTCTGTTCCTCAAGAAAACTTGCTACCCTCTGTGAGGGGAATTTTGCTAAACTTGACATCTTTATAACATGAGCCAGATT
GAAAGGGAGTGATTTTCATTCATCTTAGGTCATGTTATTTCATATTTGTTTCTGAAGGTGCGATAGCTCTGTTTTAGGTTTTGCTTGCGC
CTGTTAATTACTGGAACACCTTATTTTTCATTAAAGGCTTTGAAAGCCAATTCTCAAAAATTCAAAAGTGCAAATTAACAGAACAAAAGG
AAATCCAGTAGCAACTGCAGTCAAGCGAGGGAGTTGACAAGATAAACCTTACGTCCATTCAAGTTATATGCTGGCCTATGAGAGATGAGA


Top

FusionGenePPI for TRIM24_NTRK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRIM24ZNF10, TRIM28, TRIM24, PML, NR3C2, ESR1, THRA, RARA, RXRA, NR3C1, AR, TRIM33, GTF2E1, TAF7, TAF11, UBE2U, ATF4, NFE2L2, STAT6, FOSL1, ESR2, PPARG, TP53, BRD7, HIST1H3A, HIST1H3D, HIST1H3C, HIST1H3E, HIST1H3I, HIST1H3G, HIST1H3J, HIST1H3H, HIST1H3B, HIST1H3F, HIST2H4B, HIST1H4I, HIST1H4A, HIST1H4D, HIST1H4F, HIST1H4K, HIST1H4C, HIST1H4H, HIST1H4B, HIST1H4E, HIST1H4L, HIST2H4A, HIST1H4J, HIST4H4, NCOA1, NONO, CDK12, SNRPA, SF3B2, SF3B1, RNF141, RNF181, TRIM8, BRCA1, RNF2, MAGEA10, RFPL4B, QPRT, HSPB1, NTRK1, MUS81, PTEN, TCF4, FOXI1, USP37, NANOG, ZNF264, ZNF483, ZNF324B, WDYHV1, ZNF695, ZIM2, SYCE3, ZNF764, ZNF785, ZNF331, ZNF133, ZNF254, ZNF550, CDC16, CNKSR1, MTNR1BNTRK2NTF3, FYN, FRS2, SHC1, PLCG1, BDNF, NTF4, SHC3, GIPC1, SQSTM1, PIK3R1, SH2B1, NCK2, PTPN1, TRAF6, HSP90AA1, POLR2G, AP1B1, NMNAT1, RANBP9, TNK2, EGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTRIM24chr7:138258387chr9:87482158ENST00000343526+1219834_8406711051histone H3 that is not methylated at 'Lys-4' (H3K4me0)
HgeneTRIM24chr7:138258387chr9:87482158ENST00000415680+1219834_8406371017histone H3 that is not methylated at 'Lys-4' (H3K4me0)


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRIM24_NTRK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneNTRK2Q16620DB00321AmitriptylineBDNF/NT-3 growth factors receptorsmall moleculeapproved

Top

RelatedDiseases for TRIM24_NTRK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTRIM24C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneTRIM24C2239176Liver carcinoma1CTD_human
TgeneNTRK2C0011570Mental Depression5PSYGENET
TgeneNTRK2C0011581Depressive disorder5PSYGENET
TgeneNTRK2C0041696Unipolar Depression5PSYGENET
TgeneNTRK2C0525045Mood Disorders5PSYGENET
TgeneNTRK2C1269683Major Depressive Disorder5PSYGENET
TgeneNTRK2C0005586Bipolar Disorder3CTD_human;PSYGENET
TgeneNTRK2C0036341Schizophrenia2PSYGENET
TgeneNTRK2C0038220Status Epilepticus2CTD_human
TgeneNTRK2C0236736Cocaine-Related Disorders2CTD_human
TgeneNTRK2C0424295Hyperactive behavior2CTD_human
TgeneNTRK2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneNTRK2C0004114Astrocytoma1CTD_human
TgeneNTRK2C0004352Autistic Disorder1CTD_human
TgeneNTRK2C0008073Developmental Disabilities1CTD_human
TgeneNTRK2C0013415Dysthymic Disorder1PSYGENET
TgeneNTRK2C0017638Glioma1CTD_human
TgeneNTRK2C0020505Hyperphagia1CTD_human;HPO
TgeneNTRK2C0027819Neuroblastoma1CTD_human
TgeneNTRK2C0028754Obesity1CTD_human;HPO
TgeneNTRK2C0036349Paranoid Schizophrenia1PSYGENET
TgeneNTRK2C0678807prenatal alcohol exposure1PSYGENET
TgeneNTRK2C0752347Lewy Body Disease1CTD_human
TgeneNTRK2C3146244Alcohol Related Birth Defect1PSYGENET
TgeneNTRK2C3151303Obesity, Hyperphagia, and Developmental Delay1UNIPROT