FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39295

FusionGeneSummary for TRA2A_AQP1

check button Fusion gene summary
Fusion gene informationFusion gene name: TRA2A_AQP1
Fusion gene ID: 39295
HgeneTgene
Gene symbol

TRA2A

AQP1

Gene ID

29896

358

Gene nametransformer 2 alpha homologaquaporin 1 (Colton blood group)
SynonymsAWMS1|HSU53209AQP-CHIP|CHIP28|CO
Cytomap

7p15.3

7p14.3

Type of geneprotein-codingprotein-coding
Descriptiontransformer-2 protein homolog alphaTRA-2 alphaTRA2-alphaTra2alphahtra-2 alphaputative MAPK activating protein PM24transformer-2 alphatransformer-2 protein homolog Aaquaporin-1aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group)aquaporin 1, Colton blood group antigenaquaporin-CHIPchannel-like integral membrane protein, 28-kDaurine water channelwater channel protein for red blood cells and kidne
Modification date2018052320180523
UniProtAcc

Q13595

P29972

Ensembl transtripts involved in fusion geneENST00000297071, ENST00000392502, 
ENST00000538367, ENST00000474586, 
ENST00000434909, ENST00000509504, 
ENST00000311813, ENST00000482461, 
ENST00000441328, ENST00000409899, 
ENST00000409611, 
Fusion gene scores* DoF score8 X 7 X 5=2803 X 2 X 3=18
# samples 103
** MAII scorelog2(10/280*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TRA2A [Title/Abstract] AND AQP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTRA2A

GO:0000398

mRNA splicing, via spliceosome

9546399

TgeneAQP1

GO:0003097

renal water transport

9096382

TgeneAQP1

GO:0006182

cGMP biosynthetic process

14561230

TgeneAQP1

GO:0006833

water transport

7521540|8576117|8584435|9321919|11914159|12172703|12766090|14561230

TgeneAQP1

GO:0015670

carbon dioxide transport

12745312|16574458|19273840

TgeneAQP1

GO:0015696

ammonium transport

16574458|19273840

TgeneAQP1

GO:0015793

glycerol transport

7491270|8584435

TgeneAQP1

GO:0019725

cellular homeostasis

19268465

TgeneAQP1

GO:0030185

nitric oxide transport

16682607

TgeneAQP1

GO:0034644

cellular response to UV

19424603

TgeneAQP1

GO:0035377

transepithelial water transport

12766090

TgeneAQP1

GO:0035378

carbon dioxide transmembrane transport

17012249

TgeneAQP1

GO:0042493

response to drug

12172703

TgeneAQP1

GO:0043066

negative regulation of apoptotic process

16565507

TgeneAQP1

GO:0048146

positive regulation of fibroblast proliferation

16565507

TgeneAQP1

GO:0070301

cellular response to hydrogen peroxide

19424603

TgeneAQP1

GO:0071241

cellular response to inorganic substance

14561230

TgeneAQP1

GO:0071260

cellular response to mechanical stimulus

19268465

TgeneAQP1

GO:0071280

cellular response to copper ion

7491270|8584435

TgeneAQP1

GO:0071288

cellular response to mercury ion

7491270|8584435|9321919|12172703|12745312

TgeneAQP1

GO:0071300

cellular response to retinoic acid

12051745|19424603

TgeneAQP1

GO:0071320

cellular response to cAMP

18538351

TgeneAQP1

GO:0071456

cellular response to hypoxia

18275976

TgeneAQP1

GO:0071472

cellular response to salt stress

18509662

TgeneAQP1

GO:0071549

cellular response to dexamethasone stimulus

16711029

TgeneAQP1

GO:0071732

cellular response to nitric oxide

14561230


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-EK-A2PM-01ATRA2Achr7

23571408

-AQP1chr7

30961681

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000297071ENST00000434909TRA2Achr7

23571408

-AQP1chr7

30961681

+
In-frameENST00000297071ENST00000509504TRA2Achr7

23571408

-AQP1chr7

30961681

+
In-frameENST00000297071ENST00000311813TRA2Achr7

23571408

-AQP1chr7

30961681

+
5CDS-3UTRENST00000297071ENST00000482461TRA2Achr7

23571408

-AQP1chr7

30961681

+
5CDS-3UTRENST00000297071ENST00000441328TRA2Achr7

23571408

-AQP1chr7

30961681

+
5CDS-3UTRENST00000297071ENST00000409899TRA2Achr7

23571408

-AQP1chr7

30961681

+
5CDS-3UTRENST00000297071ENST00000409611TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000392502ENST00000434909TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000392502ENST00000509504TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000392502ENST00000311813TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000392502ENST00000482461TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000392502ENST00000441328TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000392502ENST00000409899TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000392502ENST00000409611TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000538367ENST00000434909TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000538367ENST00000509504TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3CDSENST00000538367ENST00000311813TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000538367ENST00000482461TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000538367ENST00000441328TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000538367ENST00000409899TRA2Achr7

23571408

-AQP1chr7

30961681

+
5UTR-3UTRENST00000538367ENST00000409611TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3CDSENST00000474586ENST00000434909TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3CDSENST00000474586ENST00000509504TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3CDSENST00000474586ENST00000311813TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3UTRENST00000474586ENST00000482461TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3UTRENST00000474586ENST00000441328TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3UTRENST00000474586ENST00000409899TRA2Achr7

23571408

-AQP1chr7

30961681

+
intron-3UTRENST00000474586ENST00000409611TRA2Achr7

23571408

-AQP1chr7

30961681

+

Top

FusionProtFeatures for TRA2A_AQP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TRA2A

Q13595

AQP1

P29972

Sequence-specific RNA-binding protein which participatesin the control of pre-mRNA splicing. {ECO:0000269|PubMed:9546399}. Forms a water-specific channel that provides the plasmamembranes of red cells and kidney proximal tubules with highpermeability to water, thereby permitting water to move in thedirection of an osmotic gradient. {ECO:0000269|PubMed:1373524}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04159_162128270Compositional biasNote=Poly-Arg
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04159_16277219Compositional biasNote=Poly-Arg
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04159_16213155Compositional biasNote=Poly-Arg
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15159_16245187Compositional biasNote=Poly-Arg
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04187_192128270Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04193_200128270IntramembraneNote=Helical%3B Name%3DHelix E
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04187_19277219Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04193_20077219IntramembraneNote=Helical%3B Name%3DHelix E
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0477_8477219IntramembraneNote=Helical%3B Name%3DHelix B
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04187_19213155Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04193_20013155IntramembraneNote=Helical%3B Name%3DHelix E
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0471_7613155Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0477_8413155IntramembraneNote=Helical%3B Name%3DHelix B
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15187_19245187Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15193_20045187IntramembraneNote=Helical%3B Name%3DHelix E
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1571_7645187Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1577_8445187IntramembraneNote=Helical%3B Name%3DHelix B
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04192_194128270MotifNote=NPA 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04192_19477219MotifNote=NPA 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0476_7877219MotifNote=NPA 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04192_19413155MotifNote=NPA 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0476_7813155MotifNote=NPA 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15192_19445187MotifNote=NPA 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1576_7845187MotifNote=NPA 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04156_166128270Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04184_186128270Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04201_207128270Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04229_269128270Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04116_13677219Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04156_16677219Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04184_18677219Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04201_20777219Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04229_26977219Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0485_9477219Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04116_13613155Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04156_16613155Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04184_18613155Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04201_20713155Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04229_26913155Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0437_4813155Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0467_7013155Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0485_9413155Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15116_13645187Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15156_16645187Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15184_18645187Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15201_20745187Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15229_26945187Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1567_7045187Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1585_9445187Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04137_155128270TransmembraneNote=Helical%3B Name%3DHelix 4
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04167_183128270TransmembraneNote=Helical%3B Name%3DHelix 5
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04208_228128270TransmembraneNote=Helical%3B Name%3DHelix 6
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04137_15577219TransmembraneNote=Helical%3B Name%3DHelix 4
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04167_18377219TransmembraneNote=Helical%3B Name%3DHelix 5
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+04208_22877219TransmembraneNote=Helical%3B Name%3DHelix 6
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0495_11577219TransmembraneNote=Helical%3B Name%3DHelix 3
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04137_15513155TransmembraneNote=Helical%3B Name%3DHelix 4
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04167_18313155TransmembraneNote=Helical%3B Name%3DHelix 5
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+04208_22813155TransmembraneNote=Helical%3B Name%3DHelix 6
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0449_6613155TransmembraneNote=Helical%3B Name%3DHelix 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+0495_11513155TransmembraneNote=Helical%3B Name%3DHelix 3
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15137_15545187TransmembraneNote=Helical%3B Name%3DHelix 4
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15167_18345187TransmembraneNote=Helical%3B Name%3DHelix 5
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+15208_22845187TransmembraneNote=Helical%3B Name%3DHelix 6
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1549_6645187TransmembraneNote=Helical%3B Name%3DHelix 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1595_11545187TransmembraneNote=Helical%3B Name%3DHelix 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTRA2Achr7:23571408chr7:30961681ENST00000297071-18226_28212283Compositional biasNote=Arg/Ser-rich (RS2 domain)
HgeneTRA2Achr7:23571408chr7:30961681ENST00000297071-1830_11212283Compositional biasNote=Arg/Ser-rich (RS1 domain)
HgeneTRA2Achr7:23571408chr7:30961681ENST00000297071-18119_19712283DomainRRM
HgeneTRA2Achr7:23571408chr7:30961681ENST00000297071-18198_22512283RegionNote=Linker
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0471_76128270Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0477_84128270IntramembraneNote=Helical%3B Name%3DHelix B
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0471_7677219Intramembrane.
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0476_78128270MotifNote=NPA 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+04116_136128270Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+042_7128270Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0437_48128270Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0467_70128270Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0485_94128270Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+042_777219Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0437_4877219Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0467_7077219Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+042_713155Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+152_745187Topological domainCytoplasmic
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+1537_4845187Topological domainExtracellular
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0449_66128270TransmembraneNote=Helical%3B Name%3DHelix 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+048_36128270TransmembraneNote=Helical%3B Name%3DHelix 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000311813+0495_115128270TransmembraneNote=Helical%3B Name%3DHelix 3
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+0449_6677219TransmembraneNote=Helical%3B Name%3DHelix 2
TgeneAQP1chr7:23571408chr7:30961681ENST00000409611+048_3677219TransmembraneNote=Helical%3B Name%3DHelix 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000409899+048_3613155TransmembraneNote=Helical%3B Name%3DHelix 1
TgeneAQP1chr7:23571408chr7:30961681ENST00000441328+158_3645187TransmembraneNote=Helical%3B Name%3DHelix 1


Top

FusionGeneSequence for TRA2A_AQP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000434909_chr7_30961681_+_154aa
MSDVEENNFEGRLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNF

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000509504_chr7_30961681_+_154aa
MSDVEENNFEGRLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNF

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000311813_chr7_30961681_+_154aa
MSDVEENNFEGRLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000434909_chr7_30961681_+_462nt
ATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACC
CTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCTTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTA
GCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTC
AGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGTACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGT
GACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGCCGACGACATCAACTCCAGGGTGGAGATG

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000509504_chr7_30961681_+_462nt
ATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACC
CTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCTTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTA
GCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTC
AGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGTACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGT
GACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGCCGACGACATCAACTCCAGGGTGGAGATG

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000311813_chr7_30961681_+_462nt
ATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAACTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACC
CTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCTTGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTA
GCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGCTCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTC
AGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGTACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGT
GACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGACCTGGATGCCGACGACATCAACTCCAGGGTGGAGATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000434909_chr7_30961681_+_862nt
GCCCGCCCCCTTTACGTCGTGCTCTGAGGAGGCCAGGAGATTTCTGGCGGCGCCGGCGCCATTTTGCTGGAGCCTGCGACCGAGTGGGAG
TGGAGTGGAGCGGCTGTGGTTGCCGACTCTTTCCTCTTCCCCACGGTCCAGTCAGCGGGTTAATTAGGCCATCGGCCCTCGAGCCGAGAC
TTGTCTCTTATTTAGTTCTGGGGAGCGCCTCGTCGACATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAA
CTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCT
TGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGC
TCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTCAGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGT
ACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGTGACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGA
CCTGGATGCCGACGACATCAACTCCAGGGTGGAGATGAAGCCCAAATAGAAGGGGTCTGGCCCGGGCATCCACGTAGGGGGCAGGGGCAG
GGGCGGGCGGAGGGAGGGGAGGGGTGAAATCCATACTGTAGACACTCTGACAAGCTGGCCAAAGTCACTTCCCCAAGATCTGCCAGACCT

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000509504_chr7_30961681_+_862nt
GCCCGCCCCCTTTACGTCGTGCTCTGAGGAGGCCAGGAGATTTCTGGCGGCGCCGGCGCCATTTTGCTGGAGCCTGCGACCGAGTGGGAG
TGGAGTGGAGCGGCTGTGGTTGCCGACTCTTTCCTCTTCCCCACGGTCCAGTCAGCGGGTTAATTAGGCCATCGGCCCTCGAGCCGAGAC
TTGTCTCTTATTTAGTTCTGGGGAGCGCCTCGTCGACATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAA
CTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCT
TGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGC
TCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTCAGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGT
ACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGTGACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGA
CCTGGATGCCGACGACATCAACTCCAGGGTGGAGATGAAGCCCAAATAGAAGGGGTCTGGCCCGGGCATCCACGTAGGGGGCAGGGGCAG
GGGCGGGCGGAGGGAGGGGAGGGGTGAAATCCATACTGTAGACACTCTGACAAGCTGGCCAAAGTCACTTCCCCAAGATCTGCCAGACCT

>In-frame_TRA2A_ENST00000297071_chr7_23571408_-_AQP1_ENST00000311813_chr7_30961681_+_2566nt
GCCCGCCCCCTTTACGTCGTGCTCTGAGGAGGCCAGGAGATTTCTGGCGGCGCCGGCGCCATTTTGCTGGAGCCTGCGACCGAGTGGGAG
TGGAGTGGAGCGGCTGTGGTTGCCGACTCTTTCCTCTTCCCCACGGTCCAGTCAGCGGGTTAATTAGGCCATCGGCCCTCGAGCCGAGAC
TTGTCTCTTATTTAGTTCTGGGGAGCGCCTCGTCGACATGAGTGATGTGGAGGAAAACAACTTCGAGGGCAGACTGGCTGATGGTGTGAA
CTCGGGCCAGGGCCTGGGCATCGAGATCATCGGGACCCTCCAGCTGGTGCTATGCGTGCTGGCTACTACCGACCGGAGGCGCCGTGACCT
TGGTGGCTCAGCCCCCCTTGCCATCGGCCTCTCTGTAGCCCTTGGACACCTCCTGGCTATTGACTACACTGGCTGTGGGATTAACCCTGC
TCGGTCCTTTGGCTCCGCGGTGATCACACACAACTTCAGCAACCACTGGATTTTCTGGGTGGGGCCATTCATCGGGGGAGCCCTGGCTGT
ACTCATCTACGACTTCATCCTGGCCCCACGCAGCAGTGACCTCACAGACCGCGTGAAGGTGTGGACCAGCGGCCAGGTGGAGGAGTATGA
CCTGGATGCCGACGACATCAACTCCAGGGTGGAGATGAAGCCCAAATAGAAGGGGTCTGGCCCGGGCATCCACGTAGGGGGCAGGGGCAG
GGGCGGGCGGAGGGAGGGGAGGGGTGAAATCCATACTGTAGACACTCTGACAAGCTGGCCAAAGTCACTTCCCCAAGATCTGCCAGACCT
GCATGGTCAAGCCTCTTATGGGGGTGTTTCTATCTCTTTCTTTCTCTTTCTGTTTCCTGGCCTCAGAGCTTCCTGGGGACCAAGATTTAC
CAATTCACCCACTCCCTTGAAGTTGTGGAGGAGGTGAAAGAAAGGGACCCACCTGCTAGTCGCCCCTCAGAGCATGATGGGAGGTGTGCC
AGAAAGTCCCCCCTCGCCCCAAAGTTGCTCACCGACTCACCTGCGCAAGTGCCTGGGATTCTACCGTAATTGCTTTGTGCCTTTGGGCAC
GGCCCTCCTTCTTTTCCTAACATGCACCTTGCTCCCAATGGTGCTTGGAGGGGGAAGAGATCCCAGGAGGTGCAGTGGAGGGGGCAAGCT
TTGCTCCTTCAGTTCTGCTTGCTCCCAAGCCCCTGACCCGCTCGGACTTACTGCCTGACCTTGGAATCGTCCCTATATCAGGGCCTGAGT
GACCTCCTTCTGCAAAGTGGCAGGGACCGGCAGAGCTCTACAGGCCTGCAGCCCCTAAGTGCAAACACAGCATGGGTCCAGAAGACGTGG
TCTAGACCAGGGCTGCTCTTTCCACTTGCCCTGTGTTCTTTCCCCAGGGGCATGACTGTCGCCACACGCCTCTGTGTACATGTGTGCAGA
GCAGACAGGCTACAAAGCAGAGATCGACAGACAGCCAGGTAGTTGGAACTTTCTGTTCCCTATGGAGAGGCTTCCCTACACAGGGCCTGC
TATTGCAGAATGAAGCCATTTAGAGGGTGAAGGAGAAATACCCATGTTACTTCTCTGAGTTTTAGTTGGTCTTTCCATCTATCACTGCAT
TATCTTGCTCATTCTTCAGTTCTCTACTCCCTCTTGTCAGTGTAGACACAGGTCACCATTATGCTGGTGTATGTTTATCAAAGAGCACTT
GAGCTGTCTGAAGCCCAAAGCCTGAGGACAGAAAGACCCTGATGCAGGTCAGCCCATGGAGGCAGATGCCCTTGCTGGGCCTGGGGGTTT
TCCAAGCCCTCAGCTGGTCCTGACCAGGATGGAGCAAGCTCTTCCCTTGCTCATGAGCTCCTGATCAGAGGCATTTGAGCAGCTGAATAA
CCTGCACAGGCTTGCTGTATGACCCCTGGCCACAGCCTTCCCTCTGCATTGACCTGGAGGGGAGAGGTCAGCCTTGACCTAATGAGGTAG
CTATAGTTGCAGCCCAAGGACAGTTCAGAGATCAGGATCAGCTTTGAAGGCTGGATTCTATCTACATAAGTCCTTTCAATTCCACCAGGG
CCAGAGCAGCTCCACCACTGTGCACTTAGCCATGATGGCAACAGAAACCAAGAGACACAATTACGCAGGTATTTAGAAGCAGAGGGACAA
CCAGAAGGCCCTTAACTATCACCAGTGCATCACATCTGCACACTCTCTTCTCCATTCCCTAGCAGGAACTTCTAGCTCATTTAACAGATA
AAGAAACTGAGGCCCACGGTTTCAGCTAGACAATGATTTGGCCAGGCCTAGTAACCAAGGCCCTGTCTCTGGCTACTCCCTGGACCACGA
GGCTGATTCCTCTCATTTCCAGCTTCTCAGTTTCTGCCTGGGCAATGGCCAGGGGCCAGGAGTGGGGAGAGTTGTGATGGAGGGGAGAGG
GGTCACACCCACCCCCTGCCTGGTTCTAGGCTGCTGCACACCAAGGCCCTGCATCTGTCTGCTCTGCATATATGTCTCTTTGGAGTTGGA


Top

FusionGenePPI for TRA2A_AQP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TRA2ATADA2A, YWHAG, NUDT21, SELENBP1, CRABP1, TNNT1, CDK2AP2, C11orf58, ELAVL1, CUL3, CUL5, COPS5, SRSF10, RBM25, SRSF5, CDC5L, SEPT2, NFIA, NHP2L1, NCSTN, SF3A1, BUD31, SF3B3, PHGDH, S100A9, HNRNPC, HNRNPU, PRPF40A, SF3B6, HNRNPM, SAP18, PRPF6, IK, HP1BP3, SEPT7, SMARCB1, PLEC, BARD1, PAXIP1, MAGOH, EIF4A3, PPP1CC, DHX15, U2SURP, CDK6, LBP, NXF1, YTHDC1, CLK3, SRPK2, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, ZNF22, LARP7, SRRM1, MRPS9, MRPS26, THRAP3, LUC7L2, LUC7L, ZNF768, PTCD1, PTCD3, SRRM2, C17orf85, ZFR, PABPC4L, PABPC4, RBBP6, ELAVL2, RPL6, MRPS23, MRPS27, TRUB2, MRPS6, RPL26L1, MTERF3, PAIP1, MRPS18B, MRPL32, C10orf2, MRPS10, DAP3, MEPCE, UPF1, PPIG, LARP1, LARP1B, PHAX, MRPS31, MKRN1, MRPS18C, MRPS5, MRPS7, MRPS22, MRPS15, MRPS35, MRPS25, RRP9, NGRN, MRPS2, MOV10, MRPS33, SRRT, PRPF3, MRPS11, PNN, SRP14, GAR1, MRPS24, CASC3, WDR33, CSNK1E, CSNK1D, MRPS14, GAPDHS, ZCCHC3, MKRN2, ZC3H11A, NOA1, TRA2B, ISY1, SRSF8, CLK1, SRSF7, APOBEC3F, HIST1H2AG, SRSF12, CLK2, MRPL34, MRPS21, SNIP1, NTRK1, SRSF3, SRSF6, EWSR1, CNTRL, CDK2, FEN1, U2AF2, SNRNP70, ZC3H18, C11orf57, SNRPN, NCOA5, PABPC1, SYF2, APOBEC3D, NR3C1, FOXA1AQP1MDFI, EFEMP2, KCTD17, KRTAP4-12, TRIP6, CCDC85B, ADAMTSL4, AQP1, TRIM23, FOS, KRT31, KRT33B, SIAH1, TCF4, TRAF1, TRAF2, RGS20, TNK2, SPRY2, MID2, IKZF3, IKZF2, MTUS2, RGS17, KCTD9, CRTAC1, CSRNP1, CCDC136, CEP44, KRTAP9-2, KRTAP4-2, RIMBP3, FSD2, KRT40, KIAA1958, CCDC57, NBPF22P, CCDC36, KRTAP10-7, KRTAP10-3, NOTCH2NL, CREB3, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TRA2A_AQP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneAQP1P29972DB09338MersalylAquaporin-1small moleculeapproved
TgeneAQP1P29972DB00819AcetazolamideAquaporin-1small moleculeapproved|vet_approved

Top

RelatedDiseases for TRA2A_AQP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTRA2AC0037274Dermatologic disorders1CTD_human
HgeneTRA2AC0311375Arsenic Poisoning1CTD_human
TgeneAQP1C0008340Choledochal Cyst1CTD_human
TgeneAQP1C0010606Adenoid Cystic Carcinoma1CTD_human
TgeneAQP1C0013608Edema, Cardiac1CTD_human
TgeneAQP1C0020538Hypertensive disease1CTD_human
TgeneAQP1C0020550Hyperthyroidism1CTD_human
TgeneAQP1C0024667Animal Mammary Neoplasms1CTD_human
TgeneAQP1C0024668Mammary Neoplasms, Experimental1CTD_human
TgeneAQP1C0030193Pain1CTD_human
TgeneAQP1C0036095Salivary Gland Neoplasms1CTD_human
TgeneAQP1C0036983Septic Shock1CTD_human
TgeneAQP1C0085548Autosomal Recessive Polycystic Kidney Disease1CTD_human