FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39287

FusionGeneSummary for TPX2_EYS

check button Fusion gene summary
Fusion gene informationFusion gene name: TPX2_EYS
Fusion gene ID: 39287
HgeneTgene
Gene symbol

TPX2

EYS

Gene ID

22974

346007

Gene nameTPX2, microtubule nucleation factoreyes shut homolog (Drosophila)
SynonymsC20orf1|C20orf2|DIL-2|DIL2|FLS353|GD:C20orf1|HCA519|HCTP4|REPP86|p100C6orf178|C6orf179|C6orf180|EGFL10|EGFL11|RP25|SPAM|bA166P24.2|bA307F22.3|bA74E24.1|dJ1018A4.2|dJ22I17.2|dJ303F19.1
Cytomap

20q11.21

6q12

Type of geneprotein-codingprotein-coding
Descriptiontargeting protein for Xklp2TPX2, microtubule-associated protein homologTPX2, microtubule-associated, homologdifferentially expressed in cancerous and non-cancerous lung cells 2differentially expressed in lung cellshepatocellular carcinoma-associated protein eyes shut homologEGF-like-domain, multiple 10EGF-like-domain, multiple 11epidermal growth factor-like protein 10epidermal growth factor-like protein 11protein spacemaker homolog
Modification date2018051920180519
UniProtAcc

Q9ULW0

Q5T1H1

Ensembl transtripts involved in fusion geneENST00000340513, ENST00000300403, 
ENST00000503581, ENST00000370621, 
ENST00000370616, ENST00000393380, 
ENST00000342421, ENST00000370618, 
ENST00000486069, 
Fusion gene scores* DoF score14 X 8 X 12=134426 X 15 X 12=4680
# samples 2327
** MAII scorelog2(23/1344*10)=-2.54682737183439
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/4680*10)=-4.11547721741994
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TPX2 [Title/Abstract] AND EYS [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTPX2

GO:0032147

activation of protein kinase activity

14580337|19801554

HgeneTPX2

GO:0090307

mitotic spindle assembly

26165940


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-60-2706-01ATPX2chr20

30347982

+EYSchr6

64791895

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000340513ENST00000503581TPX2chr20

30347982

+EYSchr6

64791895

-
In-frameENST00000340513ENST00000370621TPX2chr20

30347982

+EYSchr6

64791895

-
In-frameENST00000340513ENST00000370616TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000340513ENST00000393380TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000340513ENST00000342421TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000340513ENST00000370618TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000340513ENST00000486069TPX2chr20

30347982

+EYSchr6

64791895

-
In-frameENST00000300403ENST00000503581TPX2chr20

30347982

+EYSchr6

64791895

-
In-frameENST00000300403ENST00000370621TPX2chr20

30347982

+EYSchr6

64791895

-
In-frameENST00000300403ENST00000370616TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000300403ENST00000393380TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000300403ENST00000342421TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000300403ENST00000370618TPX2chr20

30347982

+EYSchr6

64791895

-
5CDS-intronENST00000300403ENST00000486069TPX2chr20

30347982

+EYSchr6

64791895

-

Top

FusionProtFeatures for TPX2_EYS


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TPX2

Q9ULW0

EYS

Q5T1H1

Spindle assembly factor required for normal assembly ofmitotic spindles. Required for normal assembly of microtubulesduring apoptosis. Required for chromatin and/or kinetochoredependent microtubule nucleation. Mediates AURKA localization tospindle microtubules (PubMed:18663142, PubMed:19208764). ActivatesAURKA by promoting its autophosphorylation at 'Thr-288' andprotects this residue against dephosphorylation (PubMed:18663142,PubMed:19208764). TPX2 is inactivated upon binding to importin-alpha (PubMed:26165940). At the onset of mitosis, GOLGA2 interactswith importin-alpha, liberating TPX2 from importin-alpha, allowingTPX2 to activates AURKA kinase and stimulates local microtubulenucleation (PubMed:26165940). {ECO:0000269|PubMed:18663142,ECO:0000269|PubMed:19208764, ECO:0000269|PubMed:26165940}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091004_1040-111595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091042_1077-111595DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091079_1115-111595DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091117_1159-111595DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091161_1197-111595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09170_212-111595DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-091883_2063-111595DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092099_2140-111595DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09213_254-111595DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092145_2339-111595DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092335_2368-111595DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092371_2408-111595DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092419_2609-111595DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09256_292-111595DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092610_2646-111595DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092648_2689-111595DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092717_2895-111595DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092896_2932-111595DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092933_2970-111595DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-092975_3165-111595DomainLaminin G-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09332_368-111595DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09370_406-111595DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09567_602-111595DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09643_679-111595DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09681_720-111595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09733_769-111595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09771_807-111595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09809_847-111595DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09849_888-111595DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09890_926-111595DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09928_964-111595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000342421-09966_1002-111595DomainEGF-like 15
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412145_233921413166DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412335_236821413166DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412371_240821413166DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412419_260921413166DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412610_264621413166DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412648_268921413166DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412717_289521413166DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412896_293221413166DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412933_297021413166DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412975_316521413166DomainLaminin G-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111004_1040-176595DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111042_1077-176595DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111079_1115-176595DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111117_1159-176595DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111161_1197-176595DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011170_212-176595DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0111883_2063-176595DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112099_2140-176595DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011213_254-176595DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112145_2339-176595DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112335_2368-176595DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112371_2408-176595DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112419_2609-176595DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011256_292-176595DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112610_2646-176595DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112648_2689-176595DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112717_2895-176595DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112896_2932-176595DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112933_2970-176595DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-0112975_3165-176595DomainLaminin G-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011332_368-176595DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011370_406-176595DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011567_602-176595DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011643_679-176595DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011681_720-176595DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011733_769-176595DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011771_807-176595DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011809_847-176595DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011849_888-176595DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011890_926-176595DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011928_964-176595DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370618-011966_1002-176595DomainEGF-like 15
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442145_233921413166DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442335_236821413166DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442371_240821413166DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442419_260921413166DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442610_264621413166DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442648_268921413166DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442717_289521413166DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442896_293221413166DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442933_297021413166DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442975_316521413166DomainLaminin G-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121004_1040-180620DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121042_1077-180620DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121079_1115-180620DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121117_1159-180620DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121161_1197-180620DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012170_212-180620DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0121883_2063-180620DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122099_2140-180620DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012213_254-180620DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122145_2339-180620DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122335_2368-180620DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122371_2408-180620DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122419_2609-180620DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012256_292-180620DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122610_2646-180620DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122648_2689-180620DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122717_2895-180620DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122896_2932-180620DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122933_2970-180620DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-0122975_3165-180620DomainLaminin G-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012332_368-180620DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012370_406-180620DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012567_602-180620DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012643_679-180620DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012681_720-180620DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012733_769-180620DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012771_807-180620DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012809_847-180620DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012849_888-180620DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012890_926-180620DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012928_964-180620DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000393380-012966_1002-180620DomainEGF-like 15
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432145_233921413145DomainLaminin G-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432335_236821413145DomainEGF-like 22
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432371_240821413145DomainEGF-like 23
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432419_260921413145DomainLaminin G-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432610_264621413145DomainEGF-like 24
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432648_268921413145DomainEGF-like 25
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432717_289521413145DomainLaminin G-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432896_293221413145DomainEGF-like 26
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432933_297021413145DomainEGF-like 27
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432975_316521413145DomainLaminin G-like 5

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411004_104021413166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411042_107721413166DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411079_111521413166DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411117_115921413166DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411161_119721413166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741170_21221413166DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27411883_206321413166DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-27412099_214021413166DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741213_25421413166DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741256_29221413166DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741332_36821413166DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741370_40621413166DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741567_60221413166DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741643_67921413166DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741681_72021413166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741733_76921413166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741771_80721413166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741809_84721413166DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741849_88821413166DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741890_92621413166DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741928_96421413166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370616-2741966_100221413166DomainEGF-like 15
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441004_104021413166DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441042_107721413166DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441079_111521413166DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441117_115921413166DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441161_119721413166DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044170_21221413166DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30441883_206321413166DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-30442099_214021413166DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044213_25421413166DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044256_29221413166DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044332_36821413166DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044370_40621413166DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044567_60221413166DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044643_67921413166DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044681_72021413166DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044733_76921413166DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044771_80721413166DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044809_84721413166DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044849_88821413166DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044890_92621413166DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044928_96421413166DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000370621-3044966_100221413166DomainEGF-like 15
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431004_104021413145DomainEGF-like 16%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431042_107721413145DomainEGF-like 17
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431079_111521413145DomainEGF-like 18
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431117_115921413145DomainEGF-like 19
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431161_119721413145DomainEGF-like 20%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043170_21221413145DomainEGF-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30431883_206321413145DomainLaminin G-like 1
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-30432099_214021413145DomainEGF-like 21
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043213_25421413145DomainEGF-like 2
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043256_29221413145DomainEGF-like 3
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043332_36821413145DomainEGF-like 4
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043370_40621413145DomainEGF-like 5
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043567_60221413145DomainEGF-like 6
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043643_67921413145DomainEGF-like 7
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043681_72021413145DomainEGF-like 8%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043733_76921413145DomainEGF-like 9%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043771_80721413145DomainEGF-like 10%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043809_84721413145DomainEGF-like 11
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043849_88821413145DomainEGF-like 12
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043890_92621413145DomainEGF-like 13
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043928_96421413145DomainEGF-like 14%3B calcium-binding
TgeneEYSchr20:30347982chr6:64791895ENST00000503581-3043966_100221413145DomainEGF-like 15


Top

FusionGeneSequence for TPX2_EYS


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_1080aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSIS
DPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHI
IKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCD
GTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYI
KYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTL
IKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVTDGDEQNEVT_

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_1101aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILI
VILEKPKPAERKVKKEALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLG
DRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIIN
NQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWV
GRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMST
NNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNI

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_1101aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILI
VILEKPKPAERKVKKEALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLG
DRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIIN
NQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWV
GRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMST
NNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNI

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_1080aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSIS
DPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLGDRTIILETLQKVTINGSTWHI
IKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCD
GTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWVGRTCENKTSFSTAKFMGNSYI
KYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMSTNNGTFCCNKWHHVVVIQNQTL
IKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVTDGDEQNEVT_

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_1101aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILI
VILEKPKPAERKVKKEALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLG
DRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIIN
NQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWV
GRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMST
NNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNI

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_1101aa
MSQVKSSTSTDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPDAGLFFPSFNGNST
LELPFLKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKTGCGNSQNILTVSANYSINTNAFTPITIRYTT
PVGSPGVVCMIEMTADGKPPVQKKDTEISHASQATFESMFLGHIPANVQIHKKAGPVTGFRGCILDLQVNNKEFFIIDEARHGKNIENCH
VPWCAHHLCRNNGTCISDNENLFCECPRLTSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPTGRSGPLCTDAINITQPRFSGTDAFG
YTSFLATSRISDISFHTEFHLKFQLANNHSALQNNLIFFTGQKGHGLNGDDFLAVGLLNGSVVTSTNLGSGIASIRSEPLNLSLGVHTVH
LGKFFQEGWLKVDDHKNKSIIAPGRLVGLNVFSQFTVGGYSEYTPDLLPNGADFKNGFQGCIFTLQVRTEKDGHFRGLGNPEGHPNAGRS
VGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGWKGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALILI
VILEKPKPAERKVKKEALSISDPSFRSNELSWMSFASFHVRKKTHIQLQFQPLAADGILFTAAQHLKAQSGDFLCISLVNSSVQLRYNLG
DRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTDFTIGGVSSLNLVNPMAIENEPVGFQGCIRQVIIN
NQELQLTEFGAKGGSNVGDCDGTACGYNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCTLGWV
GRTCENKTSFSTAKFMGNSYIKYIDPNTRMRNLQFTTISLNFSTTKTEGLIVWMGIAQNEENDFLAIGLHNQTLKIAVNLGERISVPMST
NNGTFCCNKWHHVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNTDGICTLGGFETGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_3240nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGT
GATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAG
CCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGT
TCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATA
ATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTG
GACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAA
GGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGAT
GGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGG
GCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTAC
AGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATT
AAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATT
GTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGA
GAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTT
ATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGT
TATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTT
GTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAA

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_3303nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATT
GTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTA
TCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTT
TATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGC
GACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAA
GGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGA
GGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAAT
AATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGC
AGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTG
TCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTG
GGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATG
AGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAA
GAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTAT
AACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTA
ATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGA
AAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATT

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_3303nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATT
GTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTA
TCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTT
TATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGC
GACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAA
GGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGA
GGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAAT
AATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGC
AGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTG
TCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTG
GGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATG
AGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAA
GAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTAT
AACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTA
ATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGA
AAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATT

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_3240nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGT
GATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAG
CCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGT
TCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATA
ATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTG
GACACAAATACAGACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAA
GGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGAT
GGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGG
GCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTAC
AGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATT
AAATACATTGATCCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATT
GTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGA
GAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTT
ATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGT
TATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTT
GTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAA

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_3303nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATT
GTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTA
TCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTT
TATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGC
GACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAA
GGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGA
GGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAAT
AATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGC
AGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTG
TCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTG
GGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATG
AGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAA
GAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTAT
AACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTA
ATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGA
AAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATT

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_3303nt
ATGTCACAAGTTAAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAAC
ATAGATTCATGGTTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCT
TTGAGAAAGGCTAATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTAT
TTAGAACTGCCCTTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAAT
GGAACTATTCTTTACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGG
TGTGGAAATTCTCAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACG
CCTGTTGGCAGCCCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCAT
GCCTCTCAGGCATATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTC
AGGGGCTGCATTCTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCAC
GTCCCTTGGTGTGCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTAT
TCAGGCAAGCTGTGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTC
TGCCTCTGCCCATATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGA
TACACCTCATTCCTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCA
GCACTGCAAAATAACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGC
AGTGTGGTTTATAGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCAT
CTGGGCAAGTTCTTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAAT
GTCTTCAGTCAGTTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGC
TGTATTTTCACTCTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGT
GTTGGCCAGTGTCATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAAT
TGTACCACTGGGTGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGA
GCAACCTGCATTTCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATT
GTGATCTTGGAAAAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTA
TCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTT
TATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGC
GACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAA
GGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGA
GGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAAT
AATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGC
AGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTG
TCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTG
GGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATG
AGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAA
GAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTAT
AACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTA
ATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGA
AAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_4384nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTC
AGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCA
GATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTT
CGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGA
AGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACA
GACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGA
CAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGT
GGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACA
TGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGT
ACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGAT
CCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGA
ATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCT
GTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTAC
ATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGC
TTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAG
GAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGA
GATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATT
ACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTA
TCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTAC
CTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCA
GTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACC
ATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATG

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_4291nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAA
AAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCT
TTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAA
CACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATC
ATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGAT
CTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCT
TTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTA
CAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGT
GAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAAT
AATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGT
GAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAG
TTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTT
CTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACA
TTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAG
GATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATC
GTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAA
TTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATG
CAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATA
TCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTA
ACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAAT
CAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACA

>In-frame_TPX2_ENST00000340513_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_3831nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAA
AAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCT
TTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAA
CACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATC
ATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGAT
CTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCT
TTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTA
CAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGT
GAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAAT
AATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGT
GAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAG
TTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTT
CTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACA
TTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAG
GATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATC
GTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAA

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000503581_chr6_64791895_-_4384nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCTTTATCCATAAGTGATCCATCTTTC
AGAAGCAATGAGTTATCCTGGATGTCTTTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCA
GATGGTATCCTATTTTATGCTGCACAACACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTT
CGCTACAACCTTGGCGACAGAACTATCATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGA
AGAGTTGGTGCAGAAGGCTACCTGGATCTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACA
GACTTCTATATTGGAGGAGTATCTTCTTTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGA
CAAGTTATCATAAATAATCAAGAATTACAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGT
GGGTACAACACATGCAGAAATGGAGGTGAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACA
TGTAACCAGTCTGTGTCCTGTTTGAATAATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGT
ACTTTGGGTTGGGTGGGAAGGTATTGTGAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGAT
CCAAATTATAGAATGAGAAACCTCCAGTTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGA
ATAGCTCAAAATGAAGAAAATGATTTTCTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCT
GTGCCTATGAGCTATAACAATGGCACATTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTAC
ATAAATAACAGTCTAATTCTTTCCGAGGATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGC
TTTGAATATGGTAGAAAGGTAAATATCGTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAG
GAACCAAAAAACATTGAACTAATTAAATTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGA
GATTTTAGTACACACTATACATAAATGCAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATT
ACCTGAAATAGTCTAAATGCTAACATATCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTA
TCTGTATATATTTTGATTCATGTTTTAACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTAC
CTATCCCTAATGCTTACATTTTAAAATCAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCA
GTTGGGAATGAATTAGGGATAGGTACAAATAAGAAAAAAATCAAGTTATTAATCAAAGGAAAAATAAAAATTATACAAAGCAATGTAACC
ATATTGTATTACATGGCTTAGCTACAACTTATTTATATGATTCAACAATGTAAAACTTGAACATAGATTTAAACCAAAAATTATTGCATG

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370621_chr6_64791895_-_4291nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAA
AAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCT
TTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAA
CACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATC
ATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGAT
CTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCT
TTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTA
CAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGT
GAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAAT
AATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGT
GAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAG
TTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTT
CTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACA
TTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAG
GATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATC
GTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAA
TTAGAAGGATACAATGTTTATGATGGAGATGAACAAAATGAGGTTACATAAGTTAACACTAGAGATTTTAGTACACACTATACATAAATG
CAGTTATTTTGATAGTTATTTCTTTGATACATTGCTTACGGGGAATCAACTGTTTACTATATTACCTGAAATAGTCTAAATGCTAACATA
TCTTTTTGATAAGATTGTAAAATGTCACTGAAGGTTCTGATTGTTTTTCCTACATCTAATTTATCTGTATATATTTTGATTCATGTTTTA
ACTCCATTAGTTCAGTGCTTATTCACAGAATGTGCTTATTCACTTTGCTTATTCACTTTTTACCTATCCCTAATGCTTACATTTTAAAAT
CAACGTGTAAACACAATTTTAAAAATCAATGTGTAAGCTGAACTTTAAAATGTTTAAAATTCAGTTGGGAATGAATTAGGGATAGGTACA

>In-frame_TPX2_ENST00000300403_chr20_30347982_+_EYS_ENST00000370616_chr6_64791895_-_3831nt
TCAAAATTTCAACGATACTGAATGAGTCCCGCGGCGGGTTGGCTCGCGCTTCGTTGTCAGATCTGAGGCGAGGCTAGGTGAGCCGTGGGA
AGAAAAGAGGGAGCAGCTAGGGCGCGGGTCTCCCTCCTCCCGGAGTTTGGAACGGCTGAAGTTCACCTTCCAGCCCCTAGCGCCGTTCGC
GCCGCTAGGCCTGGCTTCTGAGGCGGTTGCGGTGCTCGGTCGCCGCCTAGGCGGGGCAGGGTGCGAGCAGGGGCTTCGGGCCACGCTTCT
CTTGGCGACAGGATTTTGCTGTGAAGTCCGTCCGGGAAACGGAGGAAAAAAAGAGTTGCGGGAGGCTGTCGGCTAATAACGGTTCTTGAT
ACATATTTGCCAGACTTCAAGATTTCAGAAAAGGGGTGAAAGAGAAGATTGCAACTTTGAGTCAGACCTGTAGGCCTGATAGACTGATTA
AACCACAGAAGGTGACCTGCTGAGAAAAGTGGTACAAATACTGGGAAAAACCTGCTCTTCTGCGTTAAGTGGGAGACAATGTCACAAGTT
AAAAGCTCTTATTCCTATGATGCCCCCTCGGATTTCATCAATTTTTCATCCTTGGATGATGAAGGAGATACTCAAAACATAGATTCATGG
TTTGAGGAGAAGGCCAATTTGGAGAATAAGTTACTGGGGAAGAATGGAACTGGAGGGCTTTTTCAGGGCAAAACTCCTTTGAGAAAGGCT
AATCTTCAGCAAGCTATTGTCACACCTTTGAAACCAGATGCAGGTTTATTCTTTCCATCTTTCAATGGGAATTCCTATTTAGAACTGCCC
TTTTTGAAGTTTGTCCTGGAGAAGGAACATAACAGAACTGTTACCATCTACTTGACTATAAAAACAAACAGTTTAAATGGAACTATTCTT
TACAGTAATGGGAATAATTGTGGAAAGCAGTTTCTTCATTTATTTCTTGTGGAAGGAAGGCCATCAGTTAAATATGGGTGTGGAAATTCT
CAAAATATTTTGACTGTTTCTGCTAATTACAGCATTAACACAAATGCATTCACCCCTATCACAATACGCTACACAACGCCTGTTGGCAGC
CCTGGAGTTGTTTGTATGATTGAAATGACTGCAGATGGAAAACCTCCAGTACAGAAGAAAGACACAGAGATTTCCCATGCCTCTCAGGCA
TATTTTGAATCAATGTTCCTTGGCCATATTCCTGCAAATGTTCAAATTCATAAGAAAGCAGGTCCTGTTTATGGGTTCAGGGGCTGCATT
CTAGACCTTCAAGTAAACAACAAAGAATTCTTCATCATCGATGAAGCACGACATGGAAAGAATATTGAGAACTGCCACGTCCCTTGGTGT
GCTCATCATCTGTGCCGCAACAATGGCACCTGCATCAGTGATAATGAAAATCTGTTTTGTGAGTGTCCAAGGCTGTATTCAGGCAAGCTG
TGCCAGTTTGCAAGTTGTGAAAACAACCCATGTGGAAATGGTGCCACCTGTGTTCCAAAATCCGGAACAGATATTGTCTGCCTCTGCCCA
TATGGGAGGTCTGGACCCCTCTGCACTGATGCTATTAATATTACTCAGCCAAGGTTCAGTGGCACAGATGCCTTTGGATACACCTCATTC
CTGGCTTATTCACGGATCTCAGACATCAGCTTCCATTATGAATTCCACCTGAAGTTTCAGCTGGCAAACAACCACTCAGCACTGCAAAAT
AACTTGATATTTTTTACTGGACAGAAAGGCCATGGGTTGAATGGCGATGACTTCCTGGCTGTGGGCCTGCTCAATGGCAGTGTGGTTTAT
AGTTATAACCTGGGGTCTGGCATAGCAAGCATCAGGAGCGAGCCCCTCAATCTGAGCCTTGGAGTCCACACTGTTCATCTGGGCAAGTTC
TTCCAAGAGGGCTGGCTGAAGGTAGATGATCATAAAAATAAATCCATTATCGCCCCAGGAAGACTGGTTGGTCTCAATGTCTTCAGTCAG
TTTTATGTAGGTGGCTACAGTGAATACACTCCAGATCTCTTACCAAATGGAGCAGATTTTAAAAATGGTTTTCAAGGCTGTATTTTCACT
CTTCAAGTTCGCACTGAGAAGGATGGCCATTTCAGAGGACTGGGAAATCCTGAGGGCCACCCAAATGCTGGACGCAGTGTTGGCCAGTGT
CATGCTTCTCCCTGCAGTTTAATGAAATGTGGCAATGGTGGGACATGCATAGAGAGTGGAACTAGTGTTTACTGCAATTGTACCACTGGG
TGGAAAGGATCATTCTGCACAGAGACAGTTTCTACCTGTGATCCTGAACATGACCCTCCACACCACTGTAGCAGAGGAGCAACCTGCATT
TCATTACCTCATGGATACACCTGTTTCTGTCCTCTAGGAACCACTGGAATCTACTGTGAACAAGCACTTATCCTCATTGTGATCTTGGAA
AAGCCAAAACCAGCAGAACGGAAAGTGAAGAAGGAGGCTTTATCCATAAGTGATCCATCTTTCAGAAGCAATGAGTTATCCTGGATGTCT
TTTGCTTCCTTTCATGTTCGAAAAAAGACACATATTCAATTGCAGTTTCAGCCTCTCGCTGCAGATGGTATCCTATTTTATGCTGCACAA
CACTTAAAAGCCCAATCAGGTGATTTTTTATGCATCTCTTTAGTAAATAGTTCCGTTCAACTTCGCTACAACCTTGGCGACAGAACTATC
ATTCTAGAAACTCTCCAAAAAGTAACTATAAACGGAAGTACTTGGCATATAATAAAAGCAGGAAGAGTTGGTGCAGAAGGCTACCTGGAT
CTAGATGGGATAAATGTAACAGAAAAGGCCTCCACTAAAATGAGTTCTCTGGACACAAATACAGACTTCTATATTGGAGGAGTATCTTCT
TTAAATCTTGTAAATCCCATGGCAATAGAAAATGAACCTGTAGGTTTTCAAGGCTGTATCCGACAAGTTATCATAAATAATCAAGAATTA
CAATTAACTGAATTTGGAGCAAAAGGTGGCTCAAATGTAGGTGACTGTGATGGGACAGCCTGTGGGTACAACACATGCAGAAATGGAGGT
GAATGTACAGTAAATGGCACAACTTTTTCTTGCAGATGTTTGCCAGATTGGGCTGGAAATACATGTAACCAGTCTGTGTCCTGTTTGAAT
AATCTTTGCCTCCACCAATCTTTATGTATACCTGACCAATCATTTTCTTACAGTTGCCTGTGTACTTTGGGTTGGGTGGGAAGGTATTGT
GAAAACAAAACTTCATTTTCAACTGCAAAATTTATGGGTAATTCTTACATTAAATACATTGATCCAAATTATAGAATGAGAAACCTCCAG
TTCACTACTATATCCTTAAATTTCAGTACCACTAAAACAGAAGGTCTAATTGTATGGATGGGAATAGCTCAAAATGAAGAAAATGATTTT
CTGGCAATTGGTCTCCATAATCAGACCTTGAAAATAGCAGTTAACTTGGGAGAAAGAATCTCTGTGCCTATGAGCTATAACAATGGCACA
TTCTGTTGTAATAAATGGCACCATGTAGTTGTAATTCAAAATCAGACTCTTATCAAGGCCTACATAAATAACAGTCTAATTCTTTCCGAG
GATATTGATCCACATAAAAACTTTGTGGCTCTAAACTATGATGGCATTTGTTATCTAGGGGGCTTTGAATATGGTAGAAAGGTAAATATC
GTTACTCAAGAGATTTTTAAAACCAATTTTGTTGGCAAAATTAAAGATGTTGTATTTTTTCAGGAACCAAAAAACATTGAACTAATTAAA


Top

FusionGenePPI for TPX2_EYS


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TPX2AURKA, FZR1, KPNA1, KPNB1, HMMR, BRCA1, SIAH2, ZNF598, NDUFA7, THUMPD2, DNAJC8, MRPL53, SERPINH1, UBE2S, PPIF, SARNP, TWF1, SCAMP3, CDK6, IKBKB, CHUK, IKBKG, AURKB, LMNA, HDAC9, THAP11, NAP1L1, RPA3, RPA2, RPA1, GOLGA2, MAPK14, GSTM3, HIST1H2BG, AFAP1, SAP130, RBPJ, CDC5L, RNF111EYSEGFR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TPX2_EYS


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TPX2_EYS


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneEYSC1864446Retinitis Pigmentosa 252CTD_human;UNIPROT
TgeneEYSC0035334Retinitis Pigmentosa1CTD_human;ORPHANET