FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39170

FusionGeneSummary for TP53_PXDNL

check button Fusion gene summary
Fusion gene informationFusion gene name: TP53_PXDNL
Fusion gene ID: 39170
HgeneTgene
Gene symbol

TP53

PXDNL

Gene ID

7158

137902

Gene nametumor protein p53 binding protein 1peroxidasin like
Synonyms53BP1|TDRD30|TP53|p202|p53BP1PMR1|PRM1|VPO2
Cytomap

15q15.3

8q11.22-q11.23

Type of geneprotein-codingprotein-coding
DescriptionTP53-binding protein 1p53-binding protein 1tumor protein 53-binding protein, 1tumor suppressor p53-binding protein 1peroxidasin-like proteincardiac peroxidasecardiovascular peroxidase 2peroxidasin homolog-likepolysomal ribonuclease 1 homologvascular peroxidase 2
Modification date2018052720180523
UniProtAcc

P04637

A1KZ92

Ensembl transtripts involved in fusion geneENST00000413465, ENST00000359597, 
ENST00000269305, ENST00000455263, 
ENST00000420246, ENST00000445888, 
ENST00000574684, 
ENST00000356297, 
ENST00000543296, 
Fusion gene scores* DoF score22 X 7 X 7=10784 X 3 X 3=36
# samples 214
** MAII scorelog2(21/1078*10)=-2.35989594508638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TP53 [Title/Abstract] AND PXDNL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTP53

GO:0006303

double-strand break repair via nonhomologous end joining

23333306|23760478|28241136

HgeneTP53

GO:0006974

cellular response to DNA damage stimulus

17500065|28241136

HgeneTP53

GO:0045830

positive regulation of isotype switching

23345425

HgeneTP53

GO:0051260

protein homooligomerization

23345425

HgeneTP53

GO:2000042

negative regulation of double-strand break repair via homologous recombination

23333306|23345425


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A7EF-01ATP53chr17

7577499

-PXDNLchr8

52567320

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000413465ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000413465ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
In-frameENST00000359597ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000359597ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000269305ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
In-frameENST00000269305ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
In-frameENST00000455263ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000455263ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
In-frameENST00000420246ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000420246ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
Frame-shitENST00000445888ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
In-frameENST00000445888ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-
intron-3CDSENST00000574684ENST00000356297TP53chr17

7577499

-PXDNLchr8

52567320

-
intron-3CDSENST00000574684ENST00000543296TP53chr17

7577499

-PXDNLchr8

52567320

-

Top

FusionProtFeatures for TP53_PXDNL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TP53

P04637

PXDNL

A1KZ92

Isoform PMR1: Endonuclease selectively degrading sometarget mRNAs while they are engaged by translating ribosomes,among which albumin and beta-globin mRNAs.{ECO:0000269|PubMed:22543864}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-71117_25260394MotifNote=TADI
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-71148_56260394MotifNote=TADII
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-71217_25260774MotifNote=TADI
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-71248_56260774MotifNote=TADII
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-71117_25260394MotifNote=TADI
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-71148_56260394MotifNote=TADII
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-71217_25260755MotifNote=TADI
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-71248_56260755MotifNote=TADII
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-7111_44260394RegionNote=Transcription activation (acidic)
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-7121_44260774RegionNote=Transcription activation (acidic)
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-7111_44260394RegionNote=Transcription activation (acidic)
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-7121_44260755RegionNote=Transcription activation (acidic)
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-0231393_1451541464DomainVWFC
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023180_233541464DomainNote=LRRCT
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023234_322541464DomainNote=Ig-like C2-type 1
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023330_414541464DomainNote=Ig-like C2-type 2
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023419_504541464DomainNote=Ig-like C2-type 3
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023507_596541464DomainNote=Ig-like C2-type 4
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-0211393_1451541388DomainVWFC
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021180_233541388DomainNote=LRRCT
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021234_322541388DomainNote=Ig-like C2-type 1
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021330_414541388DomainNote=Ig-like C2-type 2
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021419_504541388DomainNote=Ig-like C2-type 3
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021507_596541388DomainNote=Ig-like C2-type 4
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023123_144541464RepeatNote=LRR 4
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-023147_168541464RepeatNote=LRR 5
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-02351_72541464RepeatNote=LRR 1
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-02375_96541464RepeatNote=LRR 2
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-02399_120541464RepeatNote=LRR 3
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021123_144541388RepeatNote=LRR 4
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-021147_168541388RepeatNote=LRR 5
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-02151_72541388RepeatNote=LRR 1
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-02175_96541388RepeatNote=LRR 2
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-02199_120541388RepeatNote=LRR 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711102_292260394DNA binding.
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712102_292260774DNA binding.
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711102_292260394DNA binding.
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712102_292260755DNA binding.
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711305_321260394MotifNote=Bipartite nuclear localization signal
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711339_350260394MotifNote=Nuclear export signal
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711370_372260394MotifNote=[KR]-[STA]-K motif
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712305_321260774MotifNote=Bipartite nuclear localization signal
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712339_350260774MotifNote=Nuclear export signal
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712370_372260774MotifNote=[KR]-[STA]-K motif
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711305_321260394MotifNote=Bipartite nuclear localization signal
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711339_350260394MotifNote=Nuclear export signal
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711370_372260394MotifNote=[KR]-[STA]-K motif
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712305_321260755MotifNote=Bipartite nuclear localization signal
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712339_350260755MotifNote=Nuclear export signal
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712370_372260755MotifNote=[KR]-[STA]-K motif
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711325_356260394RegionNote=Oligomerization
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711368_387260394RegionNote=Basic (repression of DNA-binding)
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712325_356260774RegionNote=Oligomerization
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712368_387260774RegionNote=Basic (repression of DNA-binding)
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711325_356260394RegionNote=Oligomerization
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711368_387260394RegionNote=Basic (repression of DNA-binding)
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712325_356260755RegionNote=Oligomerization
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712368_387260755RegionNote=Basic (repression of DNA-binding)
TgenePXDNLchr17:7577499chr8:52567320ENST00000356297-02324_50541464DomainNote=LRRNT
TgenePXDNLchr17:7577499chr8:52567320ENST00000543296-02124_50541388DomainNote=LRRNT


Top

FusionGeneSequence for TP53_PXDNL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TP53_ENST00000413465_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_1670aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVETLDDRNTFRHSVVVPTEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSRDLRFNRIRE
IPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLTLYLTKNEIHALDKQTFKGLISLEHLTIHFNQLEMLQPETFGDLLRLERLFLH
NNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCETPRRLHGRAVASVTVEEFNCQSPRITFEPQDVE
VPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQGVTQCMARNSAGEAKTQSAMLRYSSLPAKPSFVI
QPQDTEVLIGTSTTLECMATGHPHPLITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQFTVT
PKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQHDQGQTECQAVSSLGVKKVSVQLTVKPKALAVFT
QLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRTECVARNSFGLAVTNMFLTVTAIQGRQ
AGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMARAGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDL
VSPRSLSLIANLSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVA
TVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRP
SATVDSVTAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEH
LALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFR
FGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAATSAAVDSAATIIQR
GRDHGIPPTVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWT
ENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRSAQYS
TPVDKDMELSHLRSRQQDKITVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALREQINKLEARLRQAGCTDVRGVPRKAEERWMKEDC

>In-frame_TP53_ENST00000359597_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_1670aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVETLDDRNTFRHSVVVPTEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSRDLRFNRIRE
IPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLTLYLTKNEIHALDKQTFKGLISLEHLTIHFNQLEMLQPETFGDLLRLERLFLH
NNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCETPRRLHGRAVASVTVEEFNCQSPRITFEPQDVE
VPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQGVTQCMARNSAGEAKTQSAMLRYSSLPAKPSFVI
QPQDTEVLIGTSTTLECMATGHPHPLITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQFTVT
PKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQHDQGQTECQAVSSLGVKKVSVQLTVKPKALAVFT
QLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRTECVARNSFGLAVTNMFLTVTAIQGRQ
AGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMARAGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDL
VSPRSLSLIANLSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVA
TVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRP
SATVDSVTAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEH
LALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFR
FGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAATSAAVDSAATIIQR
GRDHGIPPTVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWT
ENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRSAQYS
TPVDKDMELSHLRSRQQDKITVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALREQINKLEARLRQAGCTDVRGVPRKAEERWMKEDC

>In-frame_TP53_ENST00000269305_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_260aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE

>In-frame_TP53_ENST00000455263_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_1670aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVETLDDRNTFRHSVVVPTEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSRDLRFNRIRE
IPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLTLYLTKNEIHALDKQTFKGLISLEHLTIHFNQLEMLQPETFGDLLRLERLFLH
NNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCETPRRLHGRAVASVTVEEFNCQSPRITFEPQDVE
VPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQGVTQCMARNSAGEAKTQSAMLRYSSLPAKPSFVI
QPQDTEVLIGTSTTLECMATGHPHPLITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQFTVT
PKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQHDQGQTECQAVSSLGVKKVSVQLTVKPKALAVFT
QLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRTECVARNSFGLAVTNMFLTVTAIQGRQ
AGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMARAGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDL
VSPRSLSLIANLSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVA
TVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRP
SATVDSVTAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEH
LALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFR
FGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAATSAAVDSAATIIQR
GRDHGIPPTVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWT
ENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRSAQYS
TPVDKDMELSHLRSRQQDKITVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALREQINKLEARLRQAGCTDVRGVPRKAEERWMKEDC

>In-frame_TP53_ENST00000420246_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_1670aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVETLDDRNTFRHSVVVPTEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSRDLRFNRIRE
IPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLTLYLTKNEIHALDKQTFKGLISLEHLTIHFNQLEMLQPETFGDLLRLERLFLH
NNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCETPRRLHGRAVASVTVEEFNCQSPRITFEPQDVE
VPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQGVTQCMARNSAGEAKTQSAMLRYSSLPAKPSFVI
QPQDTEVLIGTSTTLECMATGHPHPLITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQFTVT
PKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQHDQGQTECQAVSSLGVKKVSVQLTVKPKALAVFT
QLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRTECVARNSFGLAVTNMFLTVTAIQGRQ
AGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMARAGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDL
VSPRSLSLIANLSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVA
TVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRP
SATVDSVTAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHRANEH
LALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFR
FGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAATSAAVDSAATIIQR
GRDHGIPPTVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWT
ENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRSAQYS
TPVDKDMELSHLRSRQQDKITVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALREQINKLEARLRQAGCTDVRGVPRKAEERWMKEDC

>In-frame_TP53_ENST00000445888_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_260aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPS
WPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TP53_ENST00000413465_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5010nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA

>In-frame_TP53_ENST00000359597_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5010nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA

>In-frame_TP53_ENST00000269305_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_782nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT

>In-frame_TP53_ENST00000455263_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5010nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA

>In-frame_TP53_ENST00000420246_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5010nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA

>In-frame_TP53_ENST00000445888_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_782nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TP53_ENST00000413465_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5322nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA
ACCTGCTGTCCAGTTTGCAGAGACCGAGGAATGCCAAGTGATTCCCCAGAGAAGCGCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATG
GGAAATTTCTCAGGAAGAGACATTTAGGACTTCAGAACTTTTAACTTGTAGTCACATTGTTGATATGGAAACCACTGACTTAAGCAACTT
AGTTCATCTAATCTTACATATACTTACGATCTTTTATTTTTTCATTTTCTAACATACCTTGAAATAATTCAAAACTAAAAGCAATAAAGT
GCATATGAAGTGTTTGATCATAAGAAATATTTCTTACTGTAAGCTGTCAGTTTTATATGCCACACCTGGAAATAAAAAGAATATCATGGA

>In-frame_TP53_ENST00000359597_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5322nt
ATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAAC
GTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCA
GATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCC
TGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAG
TCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACA
CCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAG
CGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAAC
ACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGT
TCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAA
ATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTT
GAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTG
GAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCAT
AACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGT
GACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGG
AGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAG
GTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTG
GATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAG
TGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATC
CAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACC
AGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGT
CGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACC
CCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAA
ACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGC
CAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACT
CAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGG
AATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGAC
CAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAA
GCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCA
CAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATT
TTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTG
GTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCAT
GCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAG
CCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCC
ACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTG
GACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCC
ATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCC
TCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAG
CGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTG
CCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCAT
CTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGA
AACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGAC
CCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGA
TTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCG
CTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCC
TCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGG
GGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAA
ATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGAC
CTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTAT
GAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATT
CAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTG
TGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGCAGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGC
TATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCAACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACA
GTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGCGGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAAC
AAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGC
ACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGA
ACCTGCTGTCCAGTTTGCAGAGACCGAGGAATGCCAAGTGATTCCCCAGAGAAGCGCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATG
GGAAATTTCTCAGGAAGAGACATTTAGGACTTCAGAACTTTTAACTTGTAGTCACATTGTTGATATGGAAACCACTGACTTAAGCAACTT
AGTTCATCTAATCTTACATATACTTACGATCTTTTATTTTTTCATTTTCTAACATACCTTGAAATAATTCAAAACTAAAAGCAATAAAGT
GCATATGAAGTGTTTGATCATAAGAAATATTTCTTACTGTAAGCTGTCAGTTTTATATGCCACACCTGGAAATAAAAAGAATATCATGGA

>In-frame_TP53_ENST00000269305_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_5261nt
GTTTTCCCCTCCCATGTGCTCAAGACTGGCGCTAAAAGTTTTGAGCTTCTCAAAAGTCTAGAGCCACCGTCCAGGGAGCAGGTAGCTGCT
GGGCTCCGGGGACACTTTGCGTTCGGGCTGGGAGCGTGCTTTCCACGACGGTGACACGCTTCCCTGGATTGGCAGCCAGACTGCCTTCCG
GGTCACTGCCATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCAGGAAACATTTTCAGACCTATGGAAACTACTTCC
TGAAAACAACGTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTCCCCGGACGATATTGAACAATGGTTCACTGAAGA
CCCAGGTCCAGATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACC
AGCCCCCTCCTGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGG
GACAGCCAAGTCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGT
TGATTCCACACCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCC
CCACCATGAGCGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGA
TGACAGAAACACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGGCTCTGACTGTACCACCATCCACTACAACTACAT
GTGTAACAGTTCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCACACTGGAAGACTCCAGAGACTTGAGGTTTAACAG
AATAAGAGAAATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCTGCTGAACAACAACCACATCAGAAAGATTTCCAG
AAATGCTTTTGAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAATCCATGCACTAGATAAGCAAACATTTAAAGGACT
CATATCTTTGGAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACT
ATTTTTGCATAACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGATTCATTAAAAAGATTGCGTCTGGATTCCAACGC
CCTGGTTTGTGACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCAACACGGCCACACCCAGGCTGCGGCTACCTGCGA
ATATCCCAGGAGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCA
GGATGTGGAGGTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAACCCCAAACCTGAGATTATTTGGATACACAACAA
CCACTCATTGGATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACTCATGATCCGAAACACCAGAGAGTCAGACCAAGG
TGTCTATCAGTGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAG
CTTTGTAATCCAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGAATGTATGGCCACAGGCCACCCACACCCTCTTAT
CACTTGGACCAGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTCCAGTGGACTTTACTTACAGAACATCACACAACG
GGATCATGGTCGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGCAGCAAACATAATTGTACAAGCTCCTCCACAATT
TACAGTAACCCCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGT
CTGGACAAAAACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCA
CGATCAAGGCCAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGC
AGTGTTTACTCAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACATTTCATGTCATGCTCAAGGAGAACCACAGCCCAT
AATTACTTGGAATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGATGATGAAGGCACGCTGACTATCTACGACGCAGG
GTTCCCTGACCAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGTGACCAACATGTTTCTTACAGTCACGGCTATACA
GGGTAGACAAGCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAGAGTTGACAGTGCAATTAACTCCACACGAAGACA
TTTGTTTTCACAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGC
AGGGGAGATTTTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTA
CAATGACTTGGTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCG
GTGTTTCCATGCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCG
CCTGCTGCAGCCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCG
GCTGGTCGCCACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGA
GCACGACTTGGACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCC
TTGTTTCCCCATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAG
CGGCCGTCCCTCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCAAACAGCCTACATCGATGGCTCCAACGTTTACGG
GAGCTCGGAGCGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAA
GCCCTTATTGCCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGC
CAACGAGCATCTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCA
CTGGGAGGGAAACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCAGCACATCACCTACAGCCACTGGCTGCCTAAGGT
CCTGGGGGACCCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGTGAATGCAGGCATCATTAACTCTTTTGCTACTGC
AGCCTTTAGATTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTT
CCATAAAGCGCTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATG
GCGGGCACCCTCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCAT
CATTCAAAGGGGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCT
TCAAAATGAAATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTAT
GGTTGAAGACCTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAG
GTTCTGGTATGAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGG
TGACAGCATTCAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGA
CCTGCGAGTGTGGCAAGACTGCTGTGCAGATAAACAAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAA
GGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGCACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCC
CGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGAACCTGCTGTCCAGTTTGCAGAGACCGAGGAATGCCAAGTGATTCCCCAGAGAAGC
GCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATGGGAAATTTCTCAGGAAGAGACATTTAGGACTTCAGAACTTTTAACTTGTAGTCAC
ATTGTTGATATGGAAACCACTGACTTAAGCAACTTAGTTCATCTAATCTTACATATACTTACGATCTTTTATTTTTTCATTTTCTAACAT
ACCTTGAAATAATTCAAAACTAAAAGCAATAAAGTGCATATGAAGTGTTTGATCATAAGAAATATTTCTTACTGTAAGCTGTCAGTTTTA

>In-frame_TP53_ENST00000455263_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5455nt
CTAGAGCCACCGTCCAGGGAGCAGGTAGCTGCTGGGCTCCGGGGACACTTTGCGTTCGGGCTGGGAGCGTGCTTTCCACGACGGTGACAC
GCTTCCCTGGATTGGCAGCCAGACTGCCTTCCGGGTCACTGCCATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCA
GGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAACGTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTC
CCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCAGATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGC
ACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCCTGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAG
CTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAGTCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCA
ACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACACCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTC
ACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAGCGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCG
AGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAACACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGG
CTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGTTCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCAC
ACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAAATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCT
GCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTTGAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAAT
CCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTGGAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGA
GACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCATAACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGA
TTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGTGACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCA
ACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGGAGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAA
TTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAGGTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAA
CCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTGGATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACT
CATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAGTGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCAT
GCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATCCAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGA
ATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACCAGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTC
CAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGTCGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGC
AGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACCCCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTG
TGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAAACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTC
TGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGCCAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTC
TGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACTCAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACAT
TTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGGAATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGA
TGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGACCAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGT
GACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAAGCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAG
AGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCACAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCC
GCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATTTTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCT
CACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTGGTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCAC
AGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCATGCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCC
CACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAGCCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCC
TGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCCACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACAC
GCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTGGACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCG
GCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCCATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCAT
GCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCCTCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCA
AACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAGCGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCT
GAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTGCCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGA
GAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCATCTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAG
GATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGAAACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCA
GCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGACCCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGT
GAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGATTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCAC
CTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCGCTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGT
TCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCCTCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGC
TTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGGGGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTG
TAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAAATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTC
TCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGACCTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGT
TACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTATGAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCA
GGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATTCAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGA
TTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTGTGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGC
AGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGCTATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCA
ACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACAGTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGC
GGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAACAAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGG
GGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGCACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGAT
TTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGAACCTGCTGTCCAGTTTGCAGAGACCGAGGAATGCCAAGTGATTCCCC
AGAGAAGCGCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATGGGAAATTTCTCAGGAAGAGACATTTAGGACTTCAGAACTTTTAACTT
GTAGTCACATTGTTGATATGGAAACCACTGACTTAAGCAACTTAGTTCATCTAATCTTACATATACTTACGATCTTTTATTTTTTCATTT
TCTAACATACCTTGAAATAATTCAAAACTAAAAGCAATAAAGTGCATATGAAGTGTTTGATCATAAGAAATATTTCTTACTGTAAGCTGT

>In-frame_TP53_ENST00000420246_chr17_7577499_-_PXDNL_ENST00000356297_chr8_52567320_-_5455nt
CTAGAGCCACCGTCCAGGGAGCAGGTAGCTGCTGGGCTCCGGGGACACTTTGCGTTCGGGCTGGGAGCGTGCTTTCCACGACGGTGACAC
GCTTCCCTGGATTGGCAGCCAGACTGCCTTCCGGGTCACTGCCATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAGTCA
GGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAACGTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCTGTC
CCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCAGATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCCTGC
ACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCCTGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGGCAG
CTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAGTCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTGCCA
ACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACACCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCAGTC
ACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAGCGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTATCCG
AGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAACACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGTTGG
CTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGTTCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCATCAC
ACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAAATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACTTCT
GCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTTGAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGAAAT
CCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTGGAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCCAGA
GACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCATAACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCTGGA
TTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGTGACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGCCCA
ACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGGAGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATTCAA
TTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAGGTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGGAAA
CCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTGGATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCACACT
CATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAGTGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGCCAT
GCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATCCAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTTGGA
ATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACCAGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAACGTC
CAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGTCGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGCTGC
AGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACCCCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCTCTG
TGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAAACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTCCTC
TGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGCCAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGTGTC
TGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACTCAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAACAT
TTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGGAATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGTGGA
TGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGACCAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGCTGT
GACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAAGCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACAGAG
AGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCACAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTACCC
GCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATTTTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGGGCT
CACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTGGTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATGCAC
AGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCATGCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCAGCC
CACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAGCCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCTTCC
TGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCCACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTACAC
GCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTGGACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGGGCG
GCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCCATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTGCAT
GCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCCTCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCAGCA
AACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAGCGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCTCCT
GAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTGCCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCAGGA
GAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCATCTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAACAG
GATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGAAACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCTGCA
GCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGACCCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAACGT
GAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGATTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGCCAC
CTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCGCTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCCGGT
TCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCCTCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGCGGC
TTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGGGGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTTCTG
TAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAAATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGGCTC
TCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGACCTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTTTGT
TACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTATGAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAAGCA
GGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATTCAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACAGGA
TTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTGTGGCAAGACTGCTGTGCAGACTGTAGGAGTAGAGGACAGTTCAGAGC
AGTGACGCAAGAGTCTCAAAAGAAACGCTCAGCTCAATACAGCTATCCTGTTGATAAGGATATGGAGTTAAGTCATCTAAGAAGTAGGCA
ACAAGATAAAATATATGTGGGTGAAGATGCTAGAAATGTGACAGTTCTGGCAAAAACAAAGTTCTCCCAAGATTTCAGCACGTTTGCAGC
GGAAATTCAGGAAACCATCACAGCACTCAGAGAGCAGATAAACAAGCTGGAGGCACGCCTGAGGCAGGCAGGGTGTACAGATGTTAGAGG
GGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGCACTCACTGCATTTGTGAGAGTGGCCAGGTCACCTGTGTGGTGGAGAT
TTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGAACCTGCTGTCCAGTTTGCAGAGACCGAGGAATGCCAAGTGATTCCCC
AGAGAAGCGCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATGGGAAATTTCTCAGGAAGAGACATTTAGGACTTCAGAACTTTTAACTT
GTAGTCACATTGTTGATATGGAAACCACTGACTTAAGCAACTTAGTTCATCTAATCTTACATATACTTACGATCTTTTATTTTTTCATTT
TCTAACATACCTTGAAATAATTCAAAACTAAAAGCAATAAAGTGCATATGAAGTGTTTGATCATAAGAAATATTTCTTACTGTAAGCTGT

>In-frame_TP53_ENST00000445888_chr17_7577499_-_PXDNL_ENST00000543296_chr8_52567320_-_5207nt
AAAAGTCTAGAGCCACCGTCCAGGGAGCAGGTAGCTGCTGGGCTCCGGGGACACTTTGCGTTCGGGCTGGGAGCGTGCTTTCCACGACGG
TGACACGCTTCCCTGGATTGGCCAGACTGCCTTCCGGGTCACTGCCATGGAGGAGCCGCAGTCAGATCCTAGCGTCGAGCCCCCTCTGAG
TCAGGAAACATTTTCAGACCTATGGAAACTACTTCCTGAAAACAACGTTCTGTCCCCCTTGCCGTCCCAAGCAATGGATGATTTGATGCT
GTCCCCGGACGATATTGAACAATGGTTCACTGAAGACCCAGGTCCAGATGAAGCTCCCAGAATGCCAGAGGCTGCTCCCCCCGTGGCCCC
TGCACCAGCAGCTCCTACACCGGCGGCCCCTGCACCAGCCCCCTCCTGGCCCCTGTCATCTTCTGTCCCTTCCCAGAAAACCTACCAGGG
CAGCTACGGTTTCCGTCTGGGCTTCTTGCATTCTGGGACAGCCAAGTCTGTGACTTGCACGTACTCCCCTGCCCTCAACAAGATGTTTTG
CCAACTGGCCAAGACCTGCCCTGTGCAGCTGTGGGTTGATTCCACACCCCCGCCCGGCACCCGCGTCCGCGCCATGGCCATCTACAAGCA
GTCACAGCACATGACGGAGGTTGTGAGGCGCTGCCCCCACCATGAGCGCTGCTCAGATAGCGATGGTCTGGCCCCTCCTCAGCATCTTAT
CCGAGTGGAAGGAAATTTGCGTGTGGAGTATTTGGATGACAGAAACACTTTTCGACATAGTGTGGTGGTGCCCTATGAGCCGCCTGAGGT
TGGCTCTGACTGTACCACCATCCACTACAACTACATGTGTAACAGTTCCTGCATGGGCGGCATGAACCGGAGGCCCATCCTCACCATCAT
CACACTGGAAGACTCCAGAGACTTGAGGTTTAACAGAATAAGAGAAATTCCAGGGAGCGCCTTCAAGAAACTCAAGAATTTGAACACACT
TCTGCTGAACAACAACCACATCAGAAAGATTTCCAGAAATGCTTTTGAAGGACTTGAAAATTTGCTATATCTGTACCTGTATAAGAATGA
AATCCATGCACTAGATAAGCAAACATTTAAAGGACTCATATCTTTGGAACATCTGTATATTCATTTCAACCAACTAGAAATGCTACAGCC
AGAGACCTTTGGAGACCTTCTGAGATTAGAGCGACTATTTTTGCATAACAACAAATTATCTAAAATTCCAGCTGGGAGCTTTTCTAATCT
GGATTCATTAAAAAGATTGCGTCTGGATTCCAACGCCCTGGTTTGTGACTGTGATCTGATGTGGCTGGGGGAGCTTTTACAAGGCTTTGC
CCAACACGGCCACACCCAGGCTGCGGCTACCTGCGAATATCCCAGGAGACTCCATGGGCGTGCAGTTGCTTCAGTAACAGTAGAGGAATT
CAATTGCCAGAGCCCCCGAATTACTTTTGAGCCGCAGGATGTGGAGGTACCATCAGGAAATACCGTCTACTTCACCTGCCGGGCGGAAGG
AAACCCCAAACCTGAGATTATTTGGATACACAACAACCACTCATTGGATTTGGAAGATGATACTCGACTTAATGTGTTTGATGATGGCAC
ACTCATGATCCGAAACACCAGAGAGTCAGACCAAGGTGTCTATCAGTGCATGGCCAGAAATTCCGCTGGGGAAGCCAAGACACAGAGTGC
CATGCTCAGATACTCCAGTCTTCCAGCCAAACCAAGCTTTGTAATCCAGCCTCAGGACACAGAGGTTTTAATTGGCACCAGCACAACTTT
GGAATGTATGGCCACAGGCCACCCACACCCTCTTATCACTTGGACCAGGGACAATGGATTGGAGCTGGATGGATCCAGGCACGTGGCAAC
GTCCAGTGGACTTTACTTACAGAACATCACACAACGGGATCATGGTCGATTTACCTGTCATGCCAACAATAGCCACGGCACTGTTCAAGC
TGCAGCAAACATAATTGTACAAGCTCCTCCACAATTTACAGTAACCCCCAAGGATCAAGTGGTGCTGGAAGAACATGCTGTAGAGTGGCT
CTGTGAAGCTGACGGCAACCCACCTCCTGTTATTGTCTGGACAAAAACAGGAGGGCAGCTCCCTGTGGAAGGCCAGCATACAGTTCTCTC
CTCTGGCACTTTGAGAATTGACCGTGCAGCACAGCACGATCAAGGCCAATATGAATGTCAAGCAGTCAGTTCGTTGGGGGTGAAAAAGGT
GTCTGTGCAGCTGACTGTAAAACCCAAAGCTCTTGCAGTGTTTACTCAACTTCCTCAGGATACAAGTGTCGAGGTTGGAAAGAATATAAA
CATTTCATGTCATGCTCAAGGAGAACCACAGCCCATAATTACTTGGAATAAGGAAGGTGTGCAGATTACTGAGAGTGGTAAATTCCATGT
GGATGATGAAGGCACGCTGACTATCTACGACGCAGGGTTCCCTGACCAGGGAAGATATGAATGTGTGGCTCGGAATTCTTTTGGCCTTGC
TGTGACCAACATGTTTCTTACAGTCACGGCTATACAGGGTAGACAAGCTGGCGATGACTTTGTTGAATCTTCCATTCTTGATGCTGTACA
GAGAGTTGACAGTGCAATTAACTCCACACGAAGACATTTGTTTTCACAAAAACCTCACACCTCCAGTGACCTGCTGGCTCAATTTCATTA
CCCGCGTGACCCACTGATTGTGGAAATGGCAAGAGCAGGGGAGATTTTTGAGCACACGCTGCAGCTGATACGGGAACGTGTGAAGCAGGG
GCTCACTGTGGACTTGGAAGGCAAAGAATTCCGGTACAATGACTTGGTGTCCCCGCGCTCCCTCAGCCTCATCGCCAATTTATCTGGATG
CACAGCTCGCAGGCCTCTGCCAAACTGCTCCAACCGGTGTTTCCATGCGAAGTACCGCGCCCACGACGGCACGTGCAACAACCTGCAGCA
GCCCACGTGGGGCGCGGCGCTGACCGCCTTCGCGCGCCTGCTGCAGCCAGCCTACCGGGACGGCATCCGCGCGCCCCGCGGGCTCGGCCT
TCCTGTGGGCTCCCGCCAGCCCCTCCCGCCGCCCCGGCTGGTCGCCACAGTGTGGGCGCGCGCGGCGGCCGTCACCCCCGACCACAGCTA
CACGCGCATGCTCATGCACTGGGGCTGGTTTCTAGAGCACGACTTGGACCACACAGTGCCTGCGCTGAGCACAGCCCGCTTCTCGGATGG
GCGGCCGTGCAGCTCCGTCTGCACCAACGACCCTCCTTGTTTCCCCATGAACACCCGGCACGCCGACCCCCGGGGCACCCACGCGCCCTG
CATGCTCTTCGCGCGCTCCAGCCCCGCGTGTGCCAGCGGCCGTCCCTCTGCGACGGTGGATTCAGTCTATGCACGAGAGCAGATCAACCA
GCAAACAGCCTACATCGATGGCTCCAACGTTTACGGGAGCTCGGAGCGGGAATCCCAGGCTCTCAGAGACCCTTCGGTGCCTCGGGGTCT
CCTGAAGACAGGCTTTCCTTGGCCTCCCTCCGGAAAGCCCTTATTGCCCTTTTCTACAGGCCCACCCACCGAGTGCGCGCGACAGGAGCA
GGAGAGCCCCTGTTTCCTGGCCGGGGACCACCGGGCCAACGAGCATCTGGCTCTGGCCGCCATGCACACCCTGTGGTTCCGGGAACACAA
CAGGATGGCCACGGAGCTGTCCGCCCTGAACCCCCACTGGGAGGGAAACACGGTTTACCAGGAAGCCAGGAAGATCGTGGGCGCGGAGCT
GCAGCACATCACCTACAGCCACTGGCTGCCTAAGGTCCTGGGGGACCCTGGCACTAGGATGCTGAGGGGTTACCGAGGCTACAACCCCAA
CGTGAATGCAGGCATCATTAACTCTTTTGCTACTGCAGCCTTTAGATTTGGCCACACATTAATCAATCCTATTCTTTACCGACTGAATGC
CACCTTAGGTGAAATTTCCGAAGGCCACCTTCCGTTCCATAAAGCGCTCTTTTCACCGTCCAGAATAATCAAGGAAGGTGGGATAGACCC
GGTTCTCCGGGGGCTGTTTGGCGTGGCTGCTAAATGGCGGGCACCCTCCTACCTTCTCAGTCCTGAGCTGACCCAGAGGCTCTTCTCCGC
GGCTTATTCTGCGGCCGTGGATTCGGCTGCCACCATCATTCAAAGGGGTAGAGACCACGGGATCCCACCATATGTTGACTTCAGAGTTTT
CTGTAATTTGACTTCAGTTAAGAACTTTGAGGATCTTCAAAATGAAATTAAAGATTCAGAGATTAGACAAAAACTGAGAAAGTTGTACGG
CTCTCCAGGTGACATTGACCTCTGGCCCGCCCTTATGGTTGAAGACCTGATTCCTGGTACAAGAGTGGGACCAACACTTATGTGCCTGTT
TGTTACCCAGTTTCAGCGGCTAAGAGATGGAGATAGGTTCTGGTATGAAAACCCTGGAGTATTTACCCCGGCACAACTCACTCAGCTGAA
GCAGGCGTCCCTGAGCCGGGTGCTTTGTGACAATGGTGACAGCATTCAGCAAGTGCAGGCTGATGTCTTTGTAAAGGCAGAATACCCACA
GGATTACCTGAACTGCAGCGAGATCCCGAAGGTGGACCTGCGAGTGTGGCAAGACTGCTGTGCAGATAAACAAGCTGGAGGCACGCCTGA
GGCAGGCAGGGTGTACAGATGTTAGAGGGGTTCCAAGGAAGGCCGAGGAGCGCTGGATGAAAGAAGACTGCACTCACTGCATTTGTGAGA
GTGGCCAGGTCACCTGTGTGGTGGAGATTTGTCCCCCGGCTCCCTGTCCCAGTCCTGAATTGGTGAAAGGAACCTGCTGTCCAGTTTGCA
GAGACCGAGGAATGCCAAGTGATTCCCCAGAGAAGCGCTAATAAAAGTTTTGTGCTGTTGAGCCCCAAATGGGAAATTTCTCAGGAAGAG
ACATTTAGGACTTCAGAACTTTTAACTTGTAGTCACATTGTTGATATGGAAACCACTGACTTAAGCAACTTAGTTCATCTAATCTTACAT
ATACTTACGATCTTTTATTTTTTCATTTTCTAACATACCTTGAAATAATTCAAAACTAAAAGCAATAAAGTGCATATGAAGTGTTTGATC


Top

FusionGenePPI for TP53_PXDNL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TP53WWOX, CDC14A, MAGEB18, DVL2, TP53BP1, BAK1, ATM, BLM, BRCA1, ATR, TFAP2A, EPHA3, BARD1, RAD51, BRCA2, BRE, BRCC3, MDM2, TP53, RPA1, CHEK1, AR, PRKDC, S100B, SFN, TFAP2C, CDKN1A, LINC01194, EP300, PRMT1, CARM1, ANKRD2, YBX1, APTX, PARP1, XRCC1, CABLES2, CABLES1, RPL11, CDKN2A, MDC1, PHB, MTA1, MTA2, PML, EEF2, TP53INP1, ING4, ING5, HIPK1, TP53RK, RCHY1, UBE2A, PTEN, RRM2B, RRM2, HIF1A, HDAC1, CREBBP, SMARCB1, SMARCA4, SMARCC1, SUMO1, UBE2I, CHD3, HIPK3, TDG, TADA3, CREB1, HIPK2, KAT2B, KIAA0087, RAB4A, THAP8, CCDC106, FAM173A, S100A8, ZCCHC10, ANXA3, ARL3, ATF3, BCR, CCT5, COX17, DLEU1, FXYD6, GSTM4, HSPB1, PNP, STX5, WDR33, ARIH2, BTBD2, CCL18, CDC42, EIF2S2, LAMA4, MAD2L1BP, MPHOSPH6, PAFAH1B3, PCDHA4, PPA1, PSMD11, SAT1, SERPINB9, SNRPN, SULT1E1, TK1, CDKN2C, ERH, ZNF24, PLAGL1, THRB, ELL, E4F1, ABL1, GSK3B, HSP90AA1, TOP1, BRF1, ESR1, EIF2AK2, S100A4, HMGB1, APEX1, HNF4A, NDN, PLK3, HTT, PTGS2, AURKA, RFC1, CDK1, CDK2, CCNA2, PIN1, GPS2, CCNG1, YWHAZ, MDM4, TFDP1, NFKBIA, ZNF148, PPP1R13L, MED1, WRN, TBP, CDC14B, STK11, MED17, IFI16, GTF2H1, PIAS1, EFEMP2, ERCC3, ERCC2, ERCC6, MAPK8, MAPK9, MAPK10, CEBPZ, PPP4C, NCL, TSG101, TAF1, BAG1, TOP2A, TOP2B, CDK9, EGR1, PRKRIR, CDK7, MNAT1, GNL3, TAF1B, TAF1A, TAF1C, MAPK3, MAPK1, TOPORS, USP7, HSPA9, ING1, POLA1, SMN1, TEP1, CCNH, TP53BP2, KPNB1, HSPA8, WT1, PTTG1, TAF9, CUL9, NR3C1, FKBP3, RYBP, AIMP2, UCHL1, CFLAR, ITCH, DHFR, CCAR1, PSME3, HSPA4, STUB1, PTK2, NUMB, SERPINH1, COPS5, VRK1, ZMIZ1, ZMIZ2, CDK5, ZMYND11, KAT7, ETHE1, CHD8, DAPK1, TXN, OTUD5, USP11, USP39, WDR48, PADI4, NR4A1, FBXO11, UBE2N, HDAC2, SP1, STAT6, TAF6, RFWD2, ADH5, AGBL2, ASF1A, ASPM, BRD8, NPRL3, TRAPPC11, DAB2IP, DNAJB6, DPH1, AGO1, AGO2, GTPBP4, IGF2BP1, LOC613037, LRPPRC, MTHFSD, MYL9, PIWIL1, RNF38, SMARCD2, SPSB1, TRMT11, TTLL5, CUL7, BANP, RNF20, ZBTB7A, KAT8, PSMD10, SMYD2, SETD7, BACH1, MAFK, NCOR1, KAT6A, XRCC6, CTBP1, MAGEA2, NPM1, KAT5, RPL5, RPL23, YY1, VRK2, SETD2, VHL, RAD23A, HABP4, SERBP1, ZBTB2, ZNF420, KDM1A, H2AFX, SP3, TRRAP, MSH2, ING2, KMT2A, RBBP5, MEN1, WDR5, NFYA, NFYB, HECW2, CHEK2, PHF1, KAT2A, TAF5L, SUPT3H, SUPT7L, TADA1, TADA2A, TAF10, SIRT1, SIN3A, PRAM1, PIAS2, DNMT1, KMT2E, RB1CC1, PRDM2, EHMT1, HMGA1, USP29, VDR, UBE3A, EHMT2, NOC2L, AURKB, SIVA1, MDH1, RNF34, RFFL, HDAC9, G3BP1, G3BP2, KPNA4, TRIM24, L3MBTL1, PSMC5, ZNF668, USP10, UBR5, GNL3L, SETD8, IKBKB, BTRC, MSL2, RYK, UIMC1, NUB1, SKI, SOX4, CDK8, MED21, UBE4B, BAIAP2L1, TTK, DAXX, IGF1R, RFWD3, RPS7, HDAC5, HUWE1, RPS3, PSMC3, PSMD4, UHRF2, FBXO42, USP42, SMURF1, NOTCH4, UTP14A, CSNK1A1, HSPA5, ZNHIT1, SYVN1, OTUB1, PDLIM7, APOH, BMP1, SENP3, UFD1L, RAP1B, BCL2L1, RCC1, ANXA7, GADD45A, TPT1, HSPA1A, USO1, SMAD2, SMAD3, RPL26, TRIM27, BCL2, TRIAP1, TRIM28, PRMT3, AXIN1, SIN3B, AGT, MSH6, SET, ARID1A, ETS1, ETS2, ACTL6A, CSNK2B, MAPK14, MAP9, NR0B2, NCOA1, NCOA3, SIRT7, KDM4D, COPS2, SMARCD1, EWSR1, CCDC8, UBE2B, RANBP2, RPS10, LYN, PPARGC1A, HECW1, GAPDH, SRSF1, CRYAB, FBXO4, CUL4A, DTL, PCNA, RB1, PPP1CC, RNF43, CSNK2A1, PRKD1, GPS1, DHCR24, TP63, PRKCD, NQO1, TFAP4, PIAS4, ZHX1, DMTF1, HEXIM1, MUL1, TSC22D1, UBD, ANG, PDCD5, MIF, ITPK1, TXNRD1, MAP3K1, ERCC8, ARID3A, CSNK1D, VPRBP, ELAVL1, TAF5, ERBB4, PLK1, CASP8, SCAMP1, HRAS, MAGED2, UBE2M, DAPK3, SOCS1, SMAD7, PARK7, SMAD1, BMI1, RING1, RNF2, MUC1, ECT2, TRIM39, HNRNPK, NABP2, TWIST1, PHF20, HECTD3, VCP, EP400, MYC, SNAI1, MTOR, TNFAIP3, MKRN1, PPP1CA, TMED9, RNF39, TRIM8, BHLHE40, RABL6, PAN2, ANXA2, MYBBP1A, GTF2H4, RPS26, ECD, TXNIP, UBE2K, FCAMR, GPX2, SQSTM1, PSMB3, ANK2, NCOA2, CLK3, ICK, CREBZF, C10orf90, RPS27A, XPC, PSMD6, CUL4B, PTTG1IP, HERC2, DNAJB1, ZBTB16, NLK, MCL1, BCL2L2, RUNX2, ATRX, RNF128, TNK2, DNAJC7, ZBTB8A, PATZ1, MVP, MAPK7, ABR, ACSL4, ACTA2, ACTB, AIFM2, AKAP12, ATP5A1, BAG2, PRRC2A, PRRC2C, CAD, CAPN1, CCT2, CCT3, CCT4, CCT6A, CCT7, CCT8, CEP55, CPNE7, CRTC2, TUBB, DDB1, DDX5, DGCR14, DNAJA1, DNAJA2, DOCK7, EBNA1BP2, EEF1A1, EIF4E2, ENAH, MRPS18B, RCN2, RPL24, EXOSC7, EXOSC8, MZT2B, FAU, FBL, FBXO21, FTH1, MOGS, GIGYF2, GPATCH8, GRWD1, GTF3C3, GTF3C4, RPL27AP6, HECTD1, HNRNPA1, HNRNPA2B1, HNRNPF, HNRNPH1, HNRNPM, HNRNPU, HPCA, HSP90AB1, HSPA1L, IDH3B, IGF2BP3, ARHGEF17, IQGAP1, IRS4, ITPKC, RPS15P2, LY6G5B, MFAP4, MRPL24, MRPL38, MRPL39, MRPL41, MRPS14, MRPS2, MRPS22, MRPS23, MRPS25, MRPS27, MRPS28, MRPS5, MRPS9, OBSL1, RPL13, PABPC1, PCBP1, PCMT1, PDCD6, PHKA2, PHKB, PHKG2, POLDIP2, PPFIBP1, PPP3CA, PPP3R1, PTCD3, RAE1, RAVER1, RBBP4, RBBP7, RBX1, RDH13, RFC3, RFC4, TRMT10C, RPL7A, RPL10A, RPL10L, RPL12, RPL14, RPL15, RPL18, RPL18A, RPL19, RPL21, RPL23A, RPL26L1, RPL27, RPL3, RPL30, RPL31, RPL37A, RPL4, RPL6, RPL7, RPL8, RPLP0, RPLP2, RPRD1A, RPS14, RPS15, RPS17, RPS2, RPS24, RPS25, RPS27, RPS3A, RPS6, RPS8, RPS9, RRP1B, SART1, SCO2, SF3B2, SKP1, SLC2A12, SNRPD3, SNW1, SUPT6H, TBC1D4, TCEAL4, TCP1, TFRC, TIMM50, TOR1AIP2, TUBA1A, TUBA1C, TUBA4A, TUBB2A, TUBB4B, TUBG1, UBB, UBR4, VASP, VAT1, DCAF7, YTHDF1, YWHAE, ZWINT, SNAI2, PER2, TRIM59, TSC22D3, UBC, TRIM32, HSPA1B, HSPA2, HSPA6, BAG5, RBM3, RBM39, SRSF6, DDX3X, ACTBL2, TUBA8, MYH9, MYLK, MYO1C, MYO6, TPM1, TPM3, TPM4, CAPZB, GSN, VIM, CKAP4, CORO1C, DBN1, FLNA, LIMA1, LMNA, RPL28, RPS4X, RPS13, RPS16, RPS18, RPS19, HNRNPL, ALYREF, CALD1, CHMP4B, CLTA, CLTB, CLTC, DHRS4, EIF5B, GNB2, GTF2I, HADHB, KCTD17, LSM14A, LYZ, NME4, PPP1R12A, PRMT5, SLC25A5, THRAP3, WDR77, MAP1LC3B, FAM175B, XAF1, FZR1, SENP1, PPP1R13B, RELA, CHUK, CXXC1, ASH2L, SETD1A, WDR82, S100A6, ZNF302, IRF7, RANBP9, CAPG, NMT1, NMT2, BCL6, NABP1, NEIL3, PADI1, TOP1MT, YY2, ZIC3, TCF4, SRPK1, SAFB, SAFB2, MAPKAPK5, KDM6A, ABCE1, CELA2B, TCEAL1, BRD7, HERC5, SRC, ZBTB33, GUCY1A3, COPS4, BIRC6, FBXW11, TFAP2B, KLF5, AAGAB, ACVR1C, ADAM28, ARMCX5, ARPP21, CENPA, CLCA3P, CPA5, CYP20A1, C12orf49, DCLRE1C, DDX50, DKK2, DOT1L, DPP6, DZIP1, EGFR, ELL3, EPG5, ETV1, EXOSC4, RMDN1, FHIT, GABRG3, GFPT2, GK2, GOLGA2P5, GPSM3, GRIN2B, HAUS1, HAUS4, HINT3, HOXA9, HYAL4, IL1A, CXCL8, IMP3, INSIG1, IRX1, JMJD8, KLHL40, KLRF1, LAPTM5, LAP3, LGI4, MCM8, MED8, MED22, MFSD12, MIA2, MORN2, MYBPC1, MYOT, NEUROG2, NT5C3A, PACRG, PDIA5, PHYH, PKIA, PLAC8, POLD3, POLR1D, PRPF6, PSD3, PTX3, PURG, RECQL5, RETNLB, RNASE4, RPL36P14, RPUSD4, SACS, SAMD7, SBF2, SEC63, SLAMF1, SLC7A2, SNX12, SPESP1, STAM2, STT3B, STXBP4, STX2, TBC1D24, THAP1, NELFCD, TMEM200A, TOM1L1, TTC28, UBQLN2, UMPS, USH2A, USP1, ZNF300, ZNF619, ZNF763, TERT, RBBP6, PLCG2, CRK, APPL1, ZBTB17, UBE2Q1, OFD1, SSX2IP, CEP120, CEP152, SPICE1, CEP128, CEP135, NINL, NIN, RPGRIP1L, HINFP, RNF125, FOXO3, PPP2R5C, BAX, PPP2R1A, STK4, CSNK1E, TP73, GLI1, NFATC1, SMARCA5, FBXW8, MOV10, NPAS3, PES1, POLRMT, RNASEL, RPA2, RPL29P11, SMG5, FOXA3, FOXB1, FOXC1, FOXG1, FOXJ3, FOXK1, FOXK2, REV1, HSP90B1, BRINP1, FOXN1, FOXP1, FOXQ1, FOXS1, TFIP11, ERN1, DNMT3L, UHRF1, LAMTOR5, TGM2, NAT10, CCND1, USP24, GMPS, NR1I2, TRIM65, BCL2L12, DGKZ, TSNAX, KIF2A, CDKN1C, HBB, EEA1, GLTSCR2, LRRK2, POLI, ATXN3, USP15, CYLD, USP21, STAMBP, KIT, NGFR, HYPK, TRAF6, SMG7, BECN1, TBPL1, MSI2, OTUD1, FBXW7, FAM111A, GPR156, RORC, HOMER3, HR, OLIG2, KDR, AIPL1, DACH1, DLST, PDHA1, RBPJ, CETP, ACKR3, RAB7A, SLC9A9, STARD10, UBE2V2, ZNF679, ZNF839, HEY1, TRIM45, PARK2, YWHABPXDNLCUL3, CSPP1, CARM1, CUTA, SPTAN1, OSTF1, PPP1R16B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-7111_83260394HRMT1L2
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-7121_83260774HRMT1L2
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-7111_83260394HRMT1L2
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-7121_83260755HRMT1L2
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711241_248260394the 53BP2 SH3 domain
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712241_248260774the 53BP2 SH3 domain
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711241_248260394the 53BP2 SH3 domain
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712241_248260755the 53BP2 SH3 domain
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-71166_110260394WWOX
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-71266_110260774WWOX
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-71166_110260394WWOX
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-71266_110260755WWOX


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711116_292260394AXIN1
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712116_292260774AXIN1
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711116_292260394AXIN1
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712116_292260755AXIN1
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711300_393260394CARM1
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712300_393260774CARM1
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711300_393260394CARM1
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712300_393260755CARM1
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-7111_320260394CCAR2
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-7121_320260774CCAR2
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-7111_320260394CCAR2
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-7121_320260755CCAR2
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711273_280260394DNA
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712273_280260774DNA
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711273_280260394DNA
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712273_280260755DNA
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711256_294260394E4F1
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712256_294260774E4F1
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711256_294260394E4F1
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712256_294260755E4F1
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711100_370260394HIPK1
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712100_370260774HIPK1
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711100_370260394HIPK1
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712100_370260755HIPK1
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711319_360260394HIPK2
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712319_360260774HIPK2
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711319_360260394HIPK2
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712319_360260755HIPK2
HgeneTP53chr17:7577499chr8:52567320ENST00000269305-711359_363260394USP7
HgeneTP53chr17:7577499chr8:52567320ENST00000420246-712359_363260774USP7
HgeneTP53chr17:7577499chr8:52567320ENST00000445888-711359_363260394USP7
HgeneTP53chr17:7577499chr8:52567320ENST00000455263-712359_363260755USP7


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TP53_PXDNL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneTP53P04637DB01593ZincCellular tumor antigen p53small moleculeapproved|investigational
HgeneTP53P04637DB00945Acetylsalicylic acidCellular tumor antigen p53small moleculeapproved|vet_approved

Top

RelatedDiseases for TP53_PXDNL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTP53C1835398LI-FRAUMENI SYNDROME 119CTD_human;UNIPROT
HgeneTP53C0009404Colorectal Neoplasms8CTD_human
HgeneTP53C0033578Prostatic Neoplasms6CTD_human;HPO
HgeneTP53C2239176Liver carcinoma6CTD_human;HPO
HgeneTP53C0024121Lung Neoplasms5CTD_human
HgeneTP53C1458155Mammary Neoplasms5CTD_human
HgeneTP53C0005695Bladder Neoplasm4CTD_human
HgeneTP53C0007134Renal Cell Carcinoma4CTD_human;HPO
HgeneTP53C0001418Adenocarcinoma3CTD_human
HgeneTP53C0007117Basal cell carcinoma3CTD_human
HgeneTP53C0007131Non-Small Cell Lung Carcinoma3CTD_human
HgeneTP53C0009375Colonic Neoplasms3CTD_human;HPO
HgeneTP53C0017638Glioma3CTD_human
HgeneTP53C0025202melanoma3CTD_human
HgeneTP53C0206686Adrenocortical carcinoma3CTD_human;HPO;ORPHANET
HgeneTP53C0001969Alcoholic Intoxication2PSYGENET
HgeneTP53C0001973Alcoholic Intoxication, Chronic2PSYGENET
HgeneTP53C0007137Squamous cell carcinoma2CTD_human
HgeneTP53C0014859Esophageal Neoplasms2CTD_human
HgeneTP53C0016978gallbladder neoplasm2CTD_human
HgeneTP53C0023903Liver neoplasms2CTD_human
HgeneTP53C0036920Sezary Syndrome2CTD_human
HgeneTP53C0038356Stomach Neoplasms2CTD_human;HPO
HgeneTP53C0149925Small cell carcinoma of lung2CTD_human;ORPHANET
HgeneTP53C0311375Arsenic Poisoning2CTD_human
HgeneTP53C0001430Adenoma1CTD_human
HgeneTP53C0001624Adrenal Gland Neoplasms1CTD_human
HgeneTP53C0002736Amyotrophic Lateral Sclerosis1CTD_human
HgeneTP53C0004698Balkan Nephropathy1CTD_human
HgeneTP53C0007138Carcinoma, Transitional Cell1CTD_human
HgeneTP53C0007194Hypertrophic Cardiomyopathy1CTD_human
HgeneTP53C0007273Carotid Artery Diseases1CTD_human
HgeneTP53C0007621Neoplastic Cell Transformation1CTD_human
HgeneTP53C0007786Brain Ischemia1CTD_human
HgeneTP53C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneTP53C0011303Demyelinating Diseases1CTD_human
HgeneTP53C0011853Diabetes Mellitus, Experimental1CTD_human
HgeneTP53C0013990Pathological accumulation of air in tissues1CTD_human
HgeneTP53C0018923Hemangiosarcoma1CTD_human
HgeneTP53C0020538Hypertensive disease1CTD_human
HgeneTP53C0021361Female infertility1CTD_human
HgeneTP53C0021364Male infertility1CTD_human
HgeneTP53C0022116Ischemia1CTD_human
HgeneTP53C0022593Keratosis1CTD_human
HgeneTP53C0022783Vulvar Lichen Sclerosus1CTD_human
HgeneTP53C0023434Chronic Lymphocytic Leukemia1CTD_human;ORPHANET
HgeneTP53C0023897Liver Diseases, Parasitic1CTD_human
HgeneTP53C0023904Liver Neoplasms, Experimental1CTD_human
HgeneTP53C0024117Chronic Obstructive Airway Disease1CTD_human
HgeneTP53C0024809Marijuana Abuse1PSYGENET
HgeneTP53C0026640Mouth Neoplasms1CTD_human
HgeneTP53C0027627Neoplasm Metastasis1CTD_human
HgeneTP53C0029463Osteosarcoma1CTD_human;HPO
HgeneTP53C0030849Penile Neoplasms1CTD_human
HgeneTP53C0032578Polyploidy1CTD_human
HgeneTP53C0033860Psoriasis1CTD_human
HgeneTP53C0036341Schizophrenia1CTD_human
HgeneTP53C0037286Skin Neoplasms1CTD_human;HPO
HgeneTP53C0040100Thymoma1CTD_human
HgeneTP53C0040136Thyroid Neoplasm1CTD_human
HgeneTP53C0042065Genitourinary Neoplasms1CTD_human
HgeneTP53C0042076Urologic Neoplasms1CTD_human
HgeneTP53C0079772T-Cell Lymphoma1CTD_human
HgeneTP53C0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneTP53C0085136Central Nervous System Neoplasms1CTD_human
HgeneTP53C0085390Li-Fraumeni Syndrome1CTD_human;ORPHANET
HgeneTP53C0206681Adenocarcinoma, Clear Cell1CTD_human
HgeneTP53C0206698Cholangiocarcinoma1CTD_human
HgeneTP53C0262584Carcinoma, Small Cell1CTD_human
HgeneTP53C0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneTP53C0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneTP53C0345967Malignant mesothelioma1CTD_human
HgeneTP53C0677886Epithelial ovarian cancer1CTD_human
HgeneTP53C1168401Squamous cell carcinoma of the head and neck1CTD_human
HgeneTP53C1261473Sarcoma1CTD_human;HPO
HgeneTP53C1860789Leukemia, Megakaryoblastic, of Down Syndrome1CTD_human
HgeneTP53C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human
HgeneTP53C2609414Acute kidney injury1CTD_human
HgeneTP53C2931713Chromosome 17 deletion1CTD_human
HgeneTP53C2931822Nasopharyngeal carcinoma1CTD_human