FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39136

FusionGeneSummary for TP53BP1_DMXL2

check button Fusion gene summary
Fusion gene informationFusion gene name: TP53BP1_DMXL2
Fusion gene ID: 39136
HgeneTgene
Gene symbol

TP53BP1

DMXL2

Gene ID

7158

23312

Gene nametumor protein p53 binding protein 1Dmx like 2
Synonyms53BP1|TDRD30|TP53|p202|p53BP1DFNA71|PEPNS|RC3
Cytomap

15q15.3

15q21.2

Type of geneprotein-codingprotein-coding
DescriptionTP53-binding protein 1p53-binding protein 1tumor protein 53-binding protein, 1tumor suppressor p53-binding protein 1dmX-like protein 2rabconnectin-3
Modification date2018052720180523
UniProtAcc

Q12888

Q8TDJ6

Ensembl transtripts involved in fusion geneENST00000263801, ENST00000382039, 
ENST00000382044, ENST00000450115, 
ENST00000605155, 
ENST00000251076, 
ENST00000543779, ENST00000449909, 
ENST00000560421, 
Fusion gene scores* DoF score6 X 6 X 5=1801 X 1 X 1=1
# samples 61
** MAII scorelog2(6/180*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: TP53BP1 [Title/Abstract] AND DMXL2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTP53BP1

GO:0006303

double-strand break repair via nonhomologous end joining

23333306|23760478|28241136

HgeneTP53BP1

GO:0006974

cellular response to DNA damage stimulus

17500065|28241136

HgeneTP53BP1

GO:0045830

positive regulation of isotype switching

23345425

HgeneTP53BP1

GO:0051260

protein homooligomerization

23345425

HgeneTP53BP1

GO:2000042

negative regulation of double-strand break repair via homologous recombination

23333306|23345425


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A7-A26G-01ATP53BP1chr15

43724392

-DMXL2chr15

51809364

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263801ENST00000251076TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000263801ENST00000543779TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000263801ENST00000449909TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
5CDS-intronENST00000263801ENST00000560421TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382039ENST00000251076TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382039ENST00000543779TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382039ENST00000449909TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
5CDS-intronENST00000382039ENST00000560421TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382044ENST00000251076TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382044ENST00000543779TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000382044ENST00000449909TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
5CDS-intronENST00000382044ENST00000560421TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000450115ENST00000251076TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000450115ENST00000543779TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
In-frameENST00000450115ENST00000449909TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
5CDS-intronENST00000450115ENST00000560421TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
intron-3CDSENST00000605155ENST00000251076TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
intron-3CDSENST00000605155ENST00000543779TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
intron-3CDSENST00000605155ENST00000449909TP53BP1chr15

43724392

-DMXL2chr15

51809364

-
intron-intronENST00000605155ENST00000560421TP53BP1chr15

43724392

-DMXL2chr15

51809364

-

Top

FusionProtFeatures for TP53BP1_DMXL2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TP53BP1

Q12888

DMXL2

Q8TDJ6

Double-strand break (DSB) repair protein involved inresponse to DNA damage, telomere dynamics and class-switchrecombination (CSR) during antibody genesis (PubMed:12364621,PubMed:22553214, PubMed:23333306, PubMed:17190600,PubMed:21144835, PubMed:28241136). Plays a key role in the repairof double-strand DNA breaks (DSBs) in response to DNA damage bypromoting non-homologous end joining (NHEJ)-mediated repair ofDSBs and specifically counteracting the function of the homologousrecombination (HR) repair protein BRCA1 (PubMed:22553214,PubMed:23727112, PubMed:23333306). In response to DSBs,phosphorylation by ATM promotes interaction with RIF1 anddissociation from NUDT16L1/TIRR, leading to recruitment to DSBssites (PubMed:28241136). Recruited to DSBs sites by recognizingand binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub)and histone H4 dimethylated at 'Lys-20' (H4K20me2), two histonemarks that are present at DSBs sites (PubMed:23760478,PubMed:28241136, PubMed:17190600). Required for immunoglobulinclass-switch recombination (CSR) during antibody genesis, aprocess that involves the generation of DNA DSBs(PubMed:23345425). Participates to the repair and the orientationof the broken DNA ends during CSR (By similarity). In contrast, itis not required for classic NHEJ and V(D)J recombination (Bysimilarity). Promotes NHEJ of dysfunctional telomeres viainteraction with PAXIP1 (PubMed:23727112).{ECO:0000250|UniProtKB:P70399, ECO:0000269|PubMed:12364621,ECO:0000269|PubMed:17190600, ECO:0000269|PubMed:21144835,ECO:0000269|PubMed:22553214, ECO:0000269|PubMed:23333306,ECO:0000269|PubMed:23345425, ECO:0000269|PubMed:23727112,ECO:0000269|PubMed:23760478, ECO:0000269|PubMed:28241136}. May serve as a scaffold protein for MADD and RAB3GA onsynaptic vesicles (PubMed:11809763). Plays a role in the brain asa key controller of neuronal and endocrine homeostatic processes(By similarity). {ECO:0000250|UniProtKB:Q8BPN8,ECO:0000269|PubMed:11809763}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432122_21538123037Coiled coilOntology_term=ECO:0000255
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412122_21538122401Coiled coilOntology_term=ECO:0000255
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432122_21538123038Coiled coilOntology_term=ECO:0000255
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12431000_10378123037RepeatNote=WD 8
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12431163_12048123037RepeatNote=WD 9
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12431244_12818123037RepeatNote=WD 10
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432761_28008123037RepeatNote=WD 11
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432804_28438123037RepeatNote=WD 12
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432850_28928123037RepeatNote=WD 13
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432898_29378123037RepeatNote=WD 14
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432940_29798123037RepeatNote=WD 15
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-12432992_30308123037RepeatNote=WD 16
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243878_9208123037RepeatNote=WD 7
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12411000_10378122401RepeatNote=WD 8
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12411163_12048122401RepeatNote=WD 9
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12411244_12818122401RepeatNote=WD 10
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412761_28008122401RepeatNote=WD 11
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412804_28438122401RepeatNote=WD 12
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412850_28928122401RepeatNote=WD 13
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412898_29378122401RepeatNote=WD 14
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412940_29798122401RepeatNote=WD 15
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-12412992_30308122401RepeatNote=WD 16
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241878_9208122401RepeatNote=WD 7
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12431000_10378123038RepeatNote=WD 8
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12431163_12048123038RepeatNote=WD 9
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12431244_12818123038RepeatNote=WD 10
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432761_28008123038RepeatNote=WD 11
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432804_28438123038RepeatNote=WD 12
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432850_28928123038RepeatNote=WD 13
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432898_29378123038RepeatNote=WD 14
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432940_29798123038RepeatNote=WD 15
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-12432992_30308123038RepeatNote=WD 16
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243878_9208123038RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281642_164612201973Compositional biasNote=Poly-Ser
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281760_176412201973Compositional biasNote=Poly-Glu
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281642_164612251978Compositional biasNote=Poly-Ser
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281760_176412251978Compositional biasNote=Poly-Glu
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281724_184812201973DomainBRCT 1
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281864_196412201973DomainBRCT 2
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281724_184812251978DomainBRCT 1
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281864_196412251978DomainBRCT 2
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281396_140312201973MotifGAR
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281604_163112201973MotifUDR
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281396_140312251978MotifGAR
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281604_163112251978MotifUDR
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281484_160312201973RegionTudor-like
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281484_160312251978RegionTudor-like
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243108_1458123037RepeatNote=WD 1
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243167_2078123037RepeatNote=WD 2
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243230_2788123037RepeatNote=WD 3
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243492_5328123037RepeatNote=WD 4
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243595_6348123037RepeatNote=WD 5
TgeneDMXL2chr15:43724392chr15:51809364ENST00000251076-1243751_8038123037RepeatNote=WD 6
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241108_1458122401RepeatNote=WD 1
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241167_2078122401RepeatNote=WD 2
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241230_2788122401RepeatNote=WD 3
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241492_5328122401RepeatNote=WD 4
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241595_6348122401RepeatNote=WD 5
TgeneDMXL2chr15:43724392chr15:51809364ENST00000449909-1241751_8038122401RepeatNote=WD 6
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243108_1458123038RepeatNote=WD 1
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243167_2078123038RepeatNote=WD 2
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243230_2788123038RepeatNote=WD 3
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243492_5328123038RepeatNote=WD 4
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243595_6348123038RepeatNote=WD 5
TgeneDMXL2chr15:43724392chr15:51809364ENST00000543779-1243751_8038123038RepeatNote=WD 6


Top

FusionGeneSequence for TP53BP1_DMXL2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_3445aa
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA
DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQD
VEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFSPKASV
AAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSS
DLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPI
PSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPS
PATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVET
SVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTKEEKSV
EYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS
ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK
LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGD
HTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAA
TQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNTQLLHV
FQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVPGQKNV
DSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFWKCCME
ANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQT
IHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNSKDGVA
VITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQDHSTFK
SNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDAGEGTK
RHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDIPTDDI
DLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGLRYLLA
MRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNND
ALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAM
VIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYN
YLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMD
DVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLT
PQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQ
EEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLP
TTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTGMAYQG
LLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWA
AVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDSG
VIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMD
QFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGGK
AKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSS
LPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLSI
WQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKG
HVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSCG

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_3446aa
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA
DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQD
VEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFSPKASV
AAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSS
DLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPI
PSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPS
PATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVET
SVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTKEEKSV
EYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS
ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK
LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGD
HTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAA
TQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNTQLLHV
FQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVPGQKNV
DSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFWKCCME
ANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQT
IHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNSKDGVA
VITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQDHSTFK
SNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDAGEGTK
RHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDIPTDDI
DLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGLRYLLA
MRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNND
ALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAM
VIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYN
YLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMD
DVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLT
PQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQ
EEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLP
TTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSSQTEGNQFTGMAYQ
GLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMW
AAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDS
GVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKM
DQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGG
KAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPS
SLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLS
IWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRK
GHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSC

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_2809aa
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA
DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQD
VEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFSPKASV
AAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSS
DLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPI
PSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPS
PATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVET
SVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTKEEKSV
EYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS
ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK
LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGD
HTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAA
TQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNTQLLHV
FQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLGRDTLDECGLRYLLAMRLHTC
LLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDALDAAL
FYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAMVIARLY
ESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNYLRTHP
LLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDDVPSHS
KALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTPQEEDD
PEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQEEMVDK
PDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPTTLPLL
SASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTGMAYQGLLLSDR
RRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAAVFGGG
VKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDSGVIYDSD
ESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQFEGPP
PNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGGKAKVIHK
ESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSLPWLGT
GQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLSIWQVNQT
ASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGHVCIFD
IRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSCGADGTLK

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_3450aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTG
MAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLN
NRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLP
LSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQIL
QEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLG
YPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQV
HPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGE
GFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLIS
GGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNR

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_3451aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSSQTEGNQFT
GMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPL
NNRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFL
PLSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQI
LQEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADL
GYPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQ
VHPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADG
EGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLI
SGGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGN

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_2814aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLGRDTLDECGLRYLLAM
RLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDA
LDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAMV
IARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNY
LRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDD
VPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTP
QEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQE
EMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPT
TLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTGMAYQGL
LLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAA
VFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDSGV
IYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQ
FEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGGKA
KVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSL
PWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLSIW
QVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGH
VCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSCGA

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_3450aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTG
MAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLN
NRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLP
LSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQIL
QEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLG
YPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQV
HPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGE
GFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLIS
GGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNR

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_3451aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSSQTEGNQFT
GMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPL
NNRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFL
PLSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQI
LQEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADL
GYPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQ
VHPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADG
EGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLI
SGGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGN

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_2814aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLGRDTLDECGLRYLLAM
RLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDA
LDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAMV
IARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNY
LRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDD
VPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTP
QEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQE
EMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPT
TLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTGMAYQGL
LLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAA
VFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDSGV
IYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQ
FEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGGKA
KVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSL
PWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLSIW
QVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGH
VCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSCGA

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_3450aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTG
MAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLN
NRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLP
LSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQIL
QEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLG
YPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQV
HPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGE
GFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLIS
GGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNR

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_3451aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVP
GQKNVDSSPETSPSVSPMPHSSSIANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCSDNKVRFW
KCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTGRLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEW
VLEQTIHLDDLVKVGSVLDSRVSVDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGIVTEQTNS
KDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQD
HSTFKSNMLARKSVVEGTAISDDVFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVAIVRDPDA
GEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQDTSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDI
PTDDIDLEPEKRENKSKVINLSQYGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASF
QRNNDALDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVA
FSFYNYLRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFI
SHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDP
NMLLTPQEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVES
DLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQS
PLPLPTTLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSSQTEGNQFT
GMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPL
NNRMWAAVFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFL
PLSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQI
LQEKMDQFEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADL
GYPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQ
VHPPSSLPWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADG
EGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLI
SGGRKGHVCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGN

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_2814aa
MPGEQMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLK
ENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLEL
SQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFS
PKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSL
STNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPP
GSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHR
IDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGS
QAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEA
MEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTK
EEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSF
CESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKL
CLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKE
KLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPE
TVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQKLIGEVFNIVSQQSTARPGCIIELDAITNQCGSNT
QLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKDSNNNSILHMWHLHLKSVQACLGRDTLDECGLRYLLAM
RLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDA
LDAALFYLSMKKKAVVWGLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMEDIQLAMV
IARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSLAYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNY
LRTHPLLIRRNLASPEGTLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAKKDQPDFISHRMDD
VPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTP
QEEDDPEGDTEVDVIAEQLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSKTYSKVESDLLDQE
EMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLSYCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPT
TLPLLSASIASTKTVIANPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQTEGNQFTGMAYQGL
LLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKLNILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAA
VFGGGVKLVVKPRRQSENISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYFVAKPFLPLSDSGV
IYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALHNVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQ
FEGPPPNYINTYPTDLSVGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQSEVEADLGYPGGKA
KVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIWIGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSL
PWLGTGQTSTGASVLMKRNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNKCGVADGEGFLSIW
QVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVCLWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGH
VCIFDIRQRQLIHTFQAHDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQIDIIQGNRLFSCGA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_10335nt
ATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAG
GTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGAT
GTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCA
GACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTT
CTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACT
TCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGAT
GTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTG
GATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCA
CAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTT
GCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTG
TCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCT
TTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCA
GATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAG
CCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCC
CCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATC
CCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATG
CATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGG
GATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGA
GAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAAT
CCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTA
GCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCA
CCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCA
GGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCAC
CTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACC
AGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT
TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAG
TGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTA
GAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCA
GATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCT
AATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT
GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAA
TTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATG
GTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAA
CTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACT
GCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT
GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGAC
CATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAA
GGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGT
AAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCA
ACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG
GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTG
AGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTG
TTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGA
TACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTT
CATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTA
GATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTG
AGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCT
TCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAA
GCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGC
AGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCAT
AATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACA
ATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGAT
GCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATT
CTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCT
GTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTT
GATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCA
CAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAA
TCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGC
TTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGA
AGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAG
CGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAG
ATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATA
CCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATT
GATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGG
GTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCT
ACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCT
ATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCC
TGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCT
ATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGAT
GCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACA
ACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAA
CAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATG
GTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGAT
GGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTG
GACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAAC
TACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAAC
TTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTG
GAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGAT
GATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGG
AGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGAT
GCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACA
CCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATG
ACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCT
GCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAG
GAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAA
AGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTG
GCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCT
ACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGAT
ATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCA
CTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGA
CTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTG
AGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTAC
TTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCT
GCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATA
GATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGA
CCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGT
GTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCA
AATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAA
TTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGAT
CAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCA
ATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAG
GTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAG
GCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACAT
GATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCA
GATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCT
CTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACAC
CCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGT
CAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATC
TGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACC
TCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTC
ATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGA
CACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCC
TATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGT
GAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGT

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_10338nt
ATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAG
GTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGAT
GTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCA
GACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTT
CTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACT
TCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGAT
GTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTG
GATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCA
CAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTT
GCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTG
TCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCT
TTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCA
GATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAG
CCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCC
CCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATC
CCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATG
CATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGG
GATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGA
GAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAAT
CCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTA
GCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCA
CCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCA
GGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCAC
CTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACC
AGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT
TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAG
TGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTA
GAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCA
GATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCT
AATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT
GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAA
TTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATG
GTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAA
CTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACT
GCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT
GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGAC
CATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAA
GGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGT
AAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCA
ACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG
GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTG
AGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTG
TTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGA
TACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTT
CATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTA
GATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTG
AGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCT
TCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAA
GCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGC
AGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCAT
AATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACA
ATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGAT
GCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATT
CTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCT
GTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTT
GATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCA
CAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAA
TCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGC
TTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGA
AGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAG
CGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAG
ATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATA
CCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATT
GATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGG
GTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCT
ACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCT
ATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCC
TGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCT
ATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGAT
GCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACA
ACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAA
CAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATG
GTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGAT
GGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTG
GACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAAC
TACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAAC
TTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTG
GAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGAT
GATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGG
AGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGAT
GCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACA
CCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATG
ACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCT
GCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAG
GAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAA
AGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTG
GCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCT
ACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGAT
ATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCA
CTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAA
GGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGT
GTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTT
TACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGG
GCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGAC
ATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAA
AGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGT
GGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGAT
CCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTG
GAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATG
GATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAA
GCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAA
GAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGA
AAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACA
CATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGT
TCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCA
TCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCA
CACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTT
CGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGT
ATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATT
ACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGC
CTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAA
GGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGAT
CCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAA
AGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGT

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8427nt
ATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAG
GTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGAT
GTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCA
GACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTT
CTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACT
TCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGAT
GTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTG
GATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCA
CAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTT
GCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTG
TCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCT
TTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCA
GATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAG
CCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCC
CCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATC
CCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATG
CATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGG
GATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGA
GAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAAT
CCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTA
GCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCA
CCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCA
GGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCAC
CTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACC
AGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACT
TCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAG
TGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTA
GAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCA
GATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCT
AATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGT
GAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAA
TTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATG
GTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAA
CTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACT
GCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGT
GAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGAC
CATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAA
GGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGT
AAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCA
ACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGG
GGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTG
AGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTG
TTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGA
TACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTT
CATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGC
CTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAG
GCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGG
GTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTA
TTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAAC
TTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTC
TTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATAT
GAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGC
AAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAA
ACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCT
TTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAAC
CTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATT
CCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCA
AAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAA
GTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATG
AAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGAT
CCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTG
GCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGT
AATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAA
CCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTG
CAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAA
CTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTT
TCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTT
CAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTAC
CAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGT
AGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTT
TTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACAT
GCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGT
GTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGA
TTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAA
TTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGAT
GAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCT
CTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTA
ACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCC
CCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAAT
ACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTT
ATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAG
GAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGAT
GTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGT
GGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACT
GGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTAT
CTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGA
GTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACT
GCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCC
ACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGC
CACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGAC
ATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACC
ACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCC
ATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAA

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_10350nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGA
ATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCT
CAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCT
GTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAAT
AATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTC
CTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCG
GTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCT
TTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAG
GAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCT
ATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTG
CAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATT
CTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTC
CTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGC
TATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTT
TTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGA
GAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTG
CATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAG
AGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAA
CTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAG
GGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGAC
TTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCA
CCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCG
GGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCT
CTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATT
CATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGG
CTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAA

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_10353nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACA
GGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCT
GCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAA
GCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTA
AATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCT
GTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCA
CCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTT
CCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATA
CAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTT
CCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATC
TTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCT
ATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCAT
TTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTG
GGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATT
GTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGAC
AGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAG
GTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTT
AAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAG
CAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGA
GAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGT
GACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATA
TCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATC
TCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAG
GCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTA
ATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAAT
CGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTA

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8442nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATG
CGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGG
GCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATG
GGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCC
TTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACA
TTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAA
TCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTT
ATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGC
TCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGAC
ACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTAC
CTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTT
GTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAG
GTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGAT
GTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGT
CAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCT
GTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCT
CAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACT
GAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCC
TTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAA
GAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGA
CGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCT
TCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACC
ACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATA
CTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTT
TCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTT
CTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGC
TCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTA
AGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCT
GTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGAT
AAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCA
TCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTT
ATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAAT
TCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTC
TCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAG
TTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATG
CTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTC
CTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCG
AAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGAT
GTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGAT
GATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTG
CCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCA
GTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAA
GCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGG
CAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCT
TCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATT
CATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACAC
GTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTAT
GAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAA
CATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCA

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_10350nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGA
ATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCT
CAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCT
GTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAAT
AATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTC
CTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCG
GTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCT
TTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAG
GAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCT
ATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTG
CAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATT
CTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTC
CTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGC
TATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTT
TTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGA
GAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTG
CATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAG
AGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAA
CTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAG
GGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGAC
TTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCA
CCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCG
GGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCT
CTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATT
CATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGG
CTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAA

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_10353nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACA
GGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCT
GCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAA
GCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTA
AATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCT
GTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCA
CCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTT
CCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATA
CAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTT
CCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATC
TTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCT
ATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCAT
TTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTG
GGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATT
GTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGAC
AGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAG
GTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTT
AAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAG
CAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGA
GAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGT
GACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATA
TCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATC
TCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAG
GCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTA
ATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAAT
CGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTA

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8442nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATG
CGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGG
GCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATG
GGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCC
TTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACA
TTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAA
TCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTT
ATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGC
TCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGAC
ACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTAC
CTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTT
GTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAG
GTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGAT
GTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGT
CAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCT
GTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCT
CAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACT
GAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCC
TTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAA
GAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGA
CGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCT
TCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACC
ACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATA
CTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTT
TCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTT
CTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGC
TCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTA
AGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCT
GTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGAT
AAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCA
TCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTT
ATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAAT
TCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTC
TCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAG
TTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATG
CTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTC
CTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCG
AAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGAT
GTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGAT
GATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTG
CCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCA
GTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAA
GCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGG
CAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCT
TCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATT
CATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACAC
GTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTAT
GAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAA
CATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCA

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_10350nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGA
ATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCT
CAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCT
GTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAAT
AATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTC
CTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCG
GTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCT
TTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAG
GAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCT
ATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTG
CAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATT
CTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTC
CTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGC
TATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTT
TTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGA
GAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTG
CATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAG
AGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAA
CTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAG
GGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGAC
TTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCA
CCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCG
GGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCT
CTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATT
CATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGG
CTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAA

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_10353nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCT
GGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCC
AGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCA
GGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGG
AAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAA
GGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAG
CAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGG
GTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTG
TATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAA
GATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGT
AAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGAC
TTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAA
ATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGAT
CATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTA
ATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGAT
TTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCT
GGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACT
CGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAA
GAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATA
CCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGC
CAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTG
GCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTG
AGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCT
ACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGG
TCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTT
CAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCAT
GATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGA
AAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGAT
ATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTG
GGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGAT
TACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCA
TTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTC
AAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGC
CCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATT
TCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCA
TCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGAT
GAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCT
AACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGT
TTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTT
GAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGT
GATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAA
CGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCC
CAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCT
CCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAAT
AATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCAT
TCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACA
GGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCT
GCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAA
GCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTA
AATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCT
GTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCA
CCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTT
CCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATA
CAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTT
CCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATC
TTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCT
ATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCAT
TTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTG
GGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATT
GTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGAC
AGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAG
GTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTT
AAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAG
CAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGA
GAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGT
GACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATA
TCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATC
TCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAG
GCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTA
ATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAAT
CGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTA

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8442nt
ATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCT
CAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAA
AATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAA
GAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAAC
AGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAG
AAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTC
TCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACC
AGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGAC
ATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGC
CCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCA
GAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAG
GAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTT
TCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAA
GGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTG
GAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCT
GGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAG
AAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGG
CTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGA
ATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGAT
AGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGAT
GACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGT
CAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCA
GAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAG
AGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCT
ATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCT
TGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTG
GAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAG
GAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTA
CCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAA
GACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTC
TGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTT
ATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTC
ATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTA
TGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGA
AAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAG
AATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAA
AAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAG
AAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAAT
AAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAA
ACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACA
GTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAA
GTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACA
CAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTT
CAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTG
CATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATG
CGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGG
GCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATG
GGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCC
TTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACA
TTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAA
TCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTT
ATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGC
TCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGAC
ACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTAC
CTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTT
GTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAG
GTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGAT
GTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGT
CAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCT
GTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCT
CAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACT
GAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCC
TTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAA
GAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGA
CGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCT
TCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACC
ACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATA
CTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTT
TCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTT
CTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGC
TCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTA
AGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCT
GTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGAT
AAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCA
TCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTT
ATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAAT
TCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTC
TCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAG
TTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATG
CTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTC
CTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCG
AAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGAT
GTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGAT
GATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTG
CCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCA
GTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAA
GCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGG
CAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCT
TCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATT
CATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACAC
GTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTAT
GAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAA
CATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_11861nt
GAGGGGAGCCATCTTGTCCCTCTCTGCCTCCGAGTTTGTATCGTTGCCTCCATCTGTGTCTGTGTGTCTGTATTATCGTTGTTTGGCGTG
TTTTTTTTTTTTTTTGTTTTTTGTCACTGCCTGCCTGGGTCCTGCCCGAGGTCTCCATCCTCGGTTTCCCTGTCCTTGCCCCGGGCCCTG
GGAGTGCTCTGGAAGGCTGCGCAGTATTGGAGGGGACAGAATGACCTTCCGGCCTTGAGTCCCTGGGGAGCAGATGGACCCTACTGGAAG
TCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTC
TGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGA
ACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTC
TAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGA
ATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACA
TTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGT
GCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAAT
TAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGT
ACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAA
AGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTT
GTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGC
CACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTC
TCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGT
GTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTC
CACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTT
TTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGAC
AGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGAT
GCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGA
GGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGA
AGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGG
CAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGA
GGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGA
AATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAAC
TCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGA
TTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGT
TGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTC
ATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCT
GAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACT
TGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAG
CTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTT
CACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACA
CAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCC
CATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGAC
TGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGT
TGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCAC
ACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAG
TCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCA
AGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAG
GCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAA
TGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACC
AGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGC
TCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCAT
TATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATT
TTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACA
AGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAGAAAC
CTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGGTGTA
TAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATCCAGT
GTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGTGTAA
TAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCATTGT
GGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTTCTAA
AGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATGATTT
GGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCAAGGA
TAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAGTCGG
TGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTACCACT
AGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTTCACT
GCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATGCTGT
CAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGGCAAG
AAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTGCACA
TGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCATTCT
CTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTCGAAC
TATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCCCTCC
ACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATGAAGA
TCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTGAAAA
GAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTCATCT
TATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTGAGCT
TGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATG
CCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGA
GGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTG
GGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACT
ATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAA
CTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTT
CTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATA
TGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTG
CAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACA
AACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCC
TTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAA
CCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAAT
TCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTC
AAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAA
AGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGAT
GAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGA
TCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATT
GGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATG
TAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAA
ACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTT
GCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGA
ACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCT
TTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGT
TCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTA
CCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCG
TAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCT
TTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACA
TGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGG
TGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAG
ATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAA
ATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGA
TGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGC
TCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGT
AACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACC
CCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAA
TACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATT
TATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAA
GGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGA
TGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCG
TGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCAC
TGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTA
TCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAG
AGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAAC
TGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGC
CACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTG
CCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGA
CATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTAC
CACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTC
CATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAA
AACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAG
TTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATAT
GACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAAACCTAGT
ATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGAAATAATG
AAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATGCCTGCAG
TCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGAGCAGTGC
GCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTAGTACTGT
AACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTATTTAAAT
ATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTACTTTTTC
TTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAAAATGAAT
GTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGAGTTAAAT
ATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGAAACTAAT
GTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATACAATGGC
ATAAAAGTAACTTTCTCTGAAGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAAAATAAATGTTATTTGTTAGAGTTTTTAGT

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_11787nt
GAGGGGAGCCATCTTGTCCCTCTCTGCCTCCGAGTTTGTATCGTTGCCTCCATCTGTGTCTGTGTGTCTGTATTATCGTTGTTTGGCGTG
TTTTTTTTTTTTTTTGTTTTTTGTCACTGCCTGCCTGGGTCCTGCCCGAGGTCTCCATCCTCGGTTTCCCTGTCCTTGCCCCGGGCCCTG
GGAGTGCTCTGGAAGGCTGCGCAGTATTGGAGGGGACAGAATGACCTTCCGGCCTTGAGTCCCTGGGGAGCAGATGGACCCTACTGGAAG
TCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTC
TGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGA
ACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTC
TAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGA
ATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACA
TTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGT
GCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAAT
TAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGT
ACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAA
AGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTT
GTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGC
CACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTC
TCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGT
GTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTC
CACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTT
TTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGAC
AGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGAT
GCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGA
GGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGA
AGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGG
CAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGA
GGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGA
AATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAAC
TCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGA
TTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGT
TGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTC
ATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCT
GAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACT
TGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAG
CTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTT
CACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACA
CAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCC
CATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGAC
TGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGT
TGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCAC
ACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAG
TCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCA
AGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAG
GCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAA
TGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACC
AGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGC
TCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCAT
TATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATT
TTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACA
AGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAGAAAC
CTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGGTGTA
TAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATCCAGT
GTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGTGTAA
TAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCATTGT
GGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTTCTAA
AGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATGATTT
GGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCAAGGA
TAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAGTCGG
TGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTACCACT
AGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTTCACT
GCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATGCTGT
CAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGGCAAG
AAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTGCACA
TGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCATTCT
CTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTCGAAC
TATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCCCTCC
ACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATGAAGA
TCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTGAAAA
GAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTCATCT
TATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTGAGCT
TGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATG
CCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGA
GGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTG
GGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACT
ATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAA
CTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTT
CTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATA
TGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTG
CAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACA
AACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCC
TTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAA
CCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAAT
TCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTC
AAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAA
AGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGAT
GAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGA
TCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATT
GGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATG
TAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAA
ACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTT
GCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGA
ACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCT
TTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGT
TCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTA
CCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGA
TCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAA
TCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGAT
ACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGG
CGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAG
GAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGA
AAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTC
TGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTG
GGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCC
TGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCC
ACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGA
AAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGAC
ATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCA
TAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACT
TGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTA
TCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGG
CACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATA
CTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGC
AAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCA
AACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGT
TGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCAC
GTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTT
TGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTT
TACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCA
GTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCT
GAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTT
CAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAA
TATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAAACCT
AGTATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGAAATA
ATGAAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATGCCTG
CAGTCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGAGCAG
TGCGCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTAGTAC
TGTAACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTATTTA
AATATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTACTTT
TTCTTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAAAATG
AATGTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGAGTTA
AATATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGAAACT
AATGTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATACAAT

>In-frame_TP53BP1_ENST00000263801_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8852nt
GAGGGGAGCCATCTTGTCCCTCTCTGCCTCCGAGTTTGTATCGTTGCCTCCATCTGTGTCTGTGTGTCTGTATTATCGTTGTTTGGCGTG
TTTTTTTTTTTTTTTGTTTTTTGTCACTGCCTGCCTGGGTCCTGCCCGAGGTCTCCATCCTCGGTTTCCCTGTCCTTGCCCCGGGCCCTG
GGAGTGCTCTGGAAGGCTGCGCAGTATTGGAGGGGACAGAATGACCTTCCGGCCTTGAGTCCCTGGGGAGCAGATGGACCCTACTGGAAG
TCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTC
TGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGA
ACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTC
TAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGA
ATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACA
TTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGT
GCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAAT
TAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGT
ACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAA
AGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTT
GTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGC
CACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTC
TCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGT
GTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTC
CACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTT
TTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGAC
AGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGAT
GCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGA
GGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGA
AGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGG
CAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGA
GGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGA
AATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAAC
TCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGA
TTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGT
TGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTC
ATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCT
GAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACT
TGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAG
CTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTT
CACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACA
CAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCC
CATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGAC
TGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGT
TGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCAC
ACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAG
TCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCA
AGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAG
GCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAA
TGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACC
AGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGC
TCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCAT
TATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATT
TTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACA
AGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCC
TCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGAT
TAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACAC
GCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAA
GAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATG
GCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATT
GAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGAC
TTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGA
TCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGA
TGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAA
TCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATT
ATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAAC
ATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGG
CAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCT
TAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAG
GGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGA
AGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGT
AGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTAT
TAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTA
TGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCT
CCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACA
AGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTC
AACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACC
TCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAG
TCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGA
AAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGA
TGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTC
CTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAA
ACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCT
CGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACT
TAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGA
TGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAAT
GGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTAT
TGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACAC
ATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCG
GGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCAC
TAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCAT
GGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGC
CTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCT
TTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGG
AGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGA
CGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTT
TAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACC
TTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAA
TGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCAC
GGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCT
CATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGG
TAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGG
GGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAA
TGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACAG
TCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATTA

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_11685nt
CTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTG
GAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATG
ATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATC
CTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATT
CTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAG
TGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTA
CACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATA
CTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTG
CAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGG
ATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAG
CAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAG
ACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTC
CTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTC
CTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGT
CAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTG
AGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTC
AGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTT
TGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGT
TGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGA
TTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATG
GTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCA
AGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGAT
CTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGG
AAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTG
AAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTA
TTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCA
GTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCC
AGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAG
ATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAA
GACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGC
TAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTC
ATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGA
GACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATG
ATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTG
AGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGT
CTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCA
CCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGC
AGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTC
CTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTG
AAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAA
AGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGA
AACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTA
CTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACT
TCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCAC
CATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTG
TACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAG
AAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGG
TGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATC
CAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGT
GTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCA
TTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTT
CTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATG
ATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCA
AGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAG
TCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTAC
CACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTT
CACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATG
CTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGG
CAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTG
CACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCA
TTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTC
GAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCC
CTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATG
AAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTG
AAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTC
ATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTG
AGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACA
CATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATT
CTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGAT
GGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTG
CACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCC
ACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTT
TTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTT
TATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCA
GTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGG
AACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTC
ATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAA
TTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCA
AAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCAC
ATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAG
TAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAG
TGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGG
ATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAA
CATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGA
TATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAG
ACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGT
GGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGA
TGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTC
TGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTA
TTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAA
TTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTG
ATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTA
ATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGA
TACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAG
GCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTA
GGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAG
AAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATT
CTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCT
GGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGC
CTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTC
CACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTG
AAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGA
CATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCC
ATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAAC
TTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATT
ATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGG
GCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAAT
ACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATG
CAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACC
AAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAG
TTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCA
CGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTT
TTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATT
TTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGC
AGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGC
TGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATT
TCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGA
ATATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAAACC
TAGTATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGAAAT
AATGAAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATGCCT
GCAGTCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGAGCA
GTGCGCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTAGTA
CTGTAACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTATTT
AAATATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTACTT
TTTCTTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAAAAT
GAATGTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGAGTT
AAATATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGAAAC
TAATGTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATACAA
TGGCATAAAAGTAACTTTCTCTGAAGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAAAATAAATGTTATTTGTTAGAGTTTT

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_11611nt
CTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTG
GAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATG
ATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATC
CTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATT
CTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAG
TGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTA
CACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATA
CTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTG
CAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGG
ATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAG
CAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAG
ACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTC
CTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTC
CTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGT
CAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTG
AGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTC
AGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTT
TGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGT
TGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGA
TTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATG
GTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCA
AGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGAT
CTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGG
AAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTG
AAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTA
TTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCA
GTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCC
AGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAG
ATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAA
GACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGC
TAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTC
ATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGA
GACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATG
ATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTG
AGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGT
CTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCA
CCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGC
AGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTC
CTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTG
AAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAA
AGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGA
AACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTA
CTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACT
TCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCAC
CATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTG
TACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAG
AAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGG
TGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATC
CAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGT
GTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCA
TTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTT
CTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATG
ATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCA
AGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAG
TCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTAC
CACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTT
CACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATG
CTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGG
CAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTG
CACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCA
TTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTC
GAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCC
CTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATG
AAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTG
AAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTC
ATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTG
AGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACA
CATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATT
CTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGAT
GGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTG
CACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCC
ACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTT
TTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTT
TATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCA
GTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGG
AACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTC
ATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAA
TTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCA
AAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCAC
ATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAG
TAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAG
TGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGG
ATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAA
CATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGA
TATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAG
ACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGT
GGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGA
TGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTC
TGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTA
TTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAA
TTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAA
GTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTA
TTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTAT
TGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTG
GAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACC
GTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACA
AAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATG
ATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATA
GCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGC
TGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAG
GTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAAC
CTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAG
AGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCA
TCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAG
AACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTG
ATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGC
TGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATC
AATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCA
ATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTA
ACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTC
TAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTT
TCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCA
TTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAAT
ATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTA
AGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCA
CGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATAC
ATTTCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATT
TGAATATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAA
ACCTAGTATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGA
AATAATGAAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATG
CCTGCAGTCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGA
GCAGTGCGCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTA
GTACTGTAACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTA
TTTAAATATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTA
CTTTTTCTTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAA
AATGAATGTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGA
GTTAAATATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGA
AACTAATGTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATA
CAATGGCATAAAAGTAACTTTCTCTGAAGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAAAATAAATGTTATTTGTTAGAGT

>In-frame_TP53BP1_ENST00000382039_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8676nt
CTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTG
GAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATG
ATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATC
CTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATT
CTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAG
TGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTA
CACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATA
CTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTG
CAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGG
ATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAG
CAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAG
ACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTC
CTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTC
CTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGT
CAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTG
AGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTC
AGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTT
TGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGT
TGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGA
TTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATG
GTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCA
AGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGAT
CTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGG
AAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTG
AAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTA
TTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCA
GTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCC
AGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAG
ATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAA
GACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGC
TAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTC
ATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGA
GACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATG
ATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTG
AGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGT
CTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCA
CCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGC
AGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTC
CTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTG
AAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAA
AGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGA
AACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTA
CTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACT
TCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCAC
CATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTG
TACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGC
TGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAAC
TGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTA
ACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAA
TGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATA
GATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTT
CATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTG
AGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATC
CTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGG
ATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAA
GAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAA
AATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCA
AAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTG
ATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAAC
CTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATG
CCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATA
CTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATG
AAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAG
TTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTT
CCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAG
ATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGC
TACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTG
CGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACAC
CACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTG
ACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGA
CAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCC
AAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAA
ATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTG
TGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAA
TGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCG
AACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATA
GTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGA
CAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAG
GTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCA
ACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGT
CCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTT
TCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGA
TCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTAC
TGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAA
CTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCA
CTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTC
AGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTAT
ATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTA
AACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACT
CCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTG
CCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGC
AGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAG
AAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACA
TTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGC
CCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACT
ACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGT

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_11751nt
GTGACGGGAAAGGGGGAGTTCGCGGCCGGTGGCGGCGGTGGCGACAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCA
GAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCT
CTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGC
TATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAAC
GAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTT
CCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGG
AAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATA
CTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAG
AGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCA
ACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAA
ATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAG
AACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAA
CAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGC
AGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTA
CTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAG
AGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCT
CAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTC
CTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTT
CAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATA
GTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTC
CAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATG
ATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAG
AAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAG
ATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTG
AAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTC
TTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAA
TACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAG
AGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAG
AAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAA
CAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGC
CCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGA
AGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTG
ATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTA
GCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAG
GGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTT
TGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCA
TGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGC
TCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCA
TTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAG
ATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAG
GAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCA
GTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATG
ATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTG
AACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATA
AGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAG
TAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTT
CAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCA
TGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCC
CAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAG
TGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAA
TTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTA
GCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTT
GTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTAC
TTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATA
TCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATG
GAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAG
GAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGG
TAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAG
CTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAA
CAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTC
CACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTA
TTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTA
CAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTAC
TTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAG
AGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAG
TAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAG
GCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGA
GTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTC
CTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTA
ATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGC
TTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGA
AGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGC
GAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGA
AAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTT
CATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATC
CTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATG
AACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATC
TTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTAT
TCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACAT
CTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCA
ATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTA
ATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGG
AAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAG
TTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAG
ATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTA
AAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATG
AGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCC
TGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAG
AATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAA
CAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTC
ATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTC
ATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAA
GCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATG
AAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCT
CCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAAC
CTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCG
TCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTA
GTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATG
AAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGG
TTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTG
CTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACAT
ATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGG
ATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTA
AGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGG
CATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCT
GTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTT
ATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAG
CTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACG
GCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTA
ATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTT
ATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATG
ACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGG
TACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCA
TTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTA
ACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGG
CTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATG
CTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACAGTC
ATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATTATC
TAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAAACCTAGTATTGTATGAAGGATAGCTAT
TCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGAAATAATGAAAAGGACGTTTATACCAAA
TTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATGCCTGCAGTCTCCTCCTCTGTTGAATGA
AGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGAGCAGTGCGCAGTGACCAGTTCTCTGCT
GTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTAGTACTGTAACTTGCAAATGAGTGCAAA
TTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTATTTAAATATTTGCCTTCATGTTAGGAA
TGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTACTTTTTCTTTTCGTGTATTCAAGGTTA
AACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAAAATGAATGTTAGGCTTCTTGTGGCCAG
TTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGAGTTAAATATTTGCTTGTAAAATATTAG
CCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGAAACTAATGTCTGTGTGTTTAAATGTTT
ACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATACAATGGCATAAAAGTAACTTTCTCTGA
AGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAAAATAAATGTTATTTGTTAGAGTTTTTAGTTTGATACTGTTTTTGACCAT

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_11677nt
GTGACGGGAAAGGGGGAGTTCGCGGCCGGTGGCGGCGGTGGCGACAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCA
GAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCT
CTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGC
TATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAAC
GAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTT
CCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGG
AAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATA
CTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAG
AGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCA
ACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAA
ATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAG
AACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAA
CAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGC
AGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTA
CTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAG
AGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCT
CAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTC
CTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTT
CAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATA
GTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTC
CAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATG
ATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAG
AAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAG
ATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTG
AAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTC
TTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAA
TACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAG
AGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAG
AAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAA
CAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGC
CCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGA
AGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTG
ATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTA
GCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAG
GGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTT
TGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCA
TGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGC
TCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCA
TTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAG
ATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAG
GAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCA
GTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATG
ATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTG
AACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATA
AGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAG
TAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTT
CAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAGAAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCA
TGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAACTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCC
CAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCATCTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAG
TGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGTTGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAA
TTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAAGATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTA
GCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCTATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTT
GTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTAGAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTAC
TTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGCAAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATA
TCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGCTCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATG
GAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGATGGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAG
GAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTATCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGG
TAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCATGTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAG
CTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCGACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAA
CAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAAGATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTC
CACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGGAAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTA
TTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAAGGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTA
CAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGATTATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTAC
TTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGTACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAG
AGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACGGATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAG
TAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAACATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAG
GCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGATACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGA
GTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTC
CTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTA
ATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGC
TTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGA
AGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGC
GAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGA
AAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTT
CATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATC
CTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATG
AACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATC
TTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTAT
TCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACAT
CTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCA
ATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTA
ATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGG
AAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAG
TTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAG
ATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTA
AAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATG
AGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCC
TGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAG
AATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAA
CAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTC
ATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTC
ATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAG
AAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAG
ATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATT
CCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGA
AACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGC
TCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAAC
TTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTG
ATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAA
TGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTA
TTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACA
CATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCC
GGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCA
CTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCA
TGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGG
CCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTC
TTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTG
GAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGG
ACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATT
TTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAAC
CTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCA
ATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCA
CGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGC
TCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAG
GTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTG
GGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCA
ATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACA
GTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATT
ATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTGACATACTAAAAAAAATAAAACCTAGTATTGTATGAAGGATAGC
TATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGATTAGCAAATTAGTAACTTGAAATAATGAAAAGGACGTTTATACC
AAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCTTACCACTGACTGAAGCATGCCTGCAGTCTCCTCCTCTGTTGAA
TGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGAAAACTTTCTTAGCTGTGGAGCAGTGCGCAGTGACCAGTTCTCT
GCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGTTAGTGTTTATACTGAGCTAGTACTGTAACTTGCAAATGAGTGC
AAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTTTGGACTGCTAGTTTTTCTATTTAAATATTTGCCTTCATGTTAG
GAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACCTTCTTAGTCCAGTTTAGTACTTTTTCTTTTCGTGTATTCAAGG
TTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAGCATTTCATATCATAATTAAAATGAATGTTAGGCTTCTTGTGGC
CAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCTATTGTATAAACTATGCAGAGTTAAATATTTGCTTGTAAAATAT
TAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAAAAATATGTTGAGATACTGAAACTAATGTCTGTGTGTTTAAATG
TTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCTGTGTGGTAAATAGTAAATACAATGGCATAAAAGTAACTTTCTC

>In-frame_TP53BP1_ENST00000382044_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8742nt
GTGACGGGAAAGGGGGAGTTCGCGGCCGGTGGCGGCGGTGGCGACAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCA
GAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCTGGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCT
CTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGC
TATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAAC
GAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTT
CCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGG
AAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATA
CTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAG
AGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCA
ACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAA
ATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAG
AACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAA
CAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGC
AGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTA
CTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAG
AGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCT
CAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTC
CTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTT
CAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATA
GTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTC
CAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATG
ATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAG
AAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAG
ATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTG
AAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTC
TTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAA
TACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAG
AGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAG
AAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAA
CAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGC
CCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGA
AGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTG
ATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTA
GCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAG
GGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTT
TGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCA
TGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGC
TCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCA
TTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAG
ATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAG
GAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCA
GTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATG
ATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTTAATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTG
AACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTGCTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATA
AGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCATCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAG
TAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATGTGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATA
CATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGC
TACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTC
AGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAA
AGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGG
GTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAA
ATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTAT
GTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCA
TCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTG
CCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCA
AGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAA
CTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATG
CTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAA
AAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTG
AATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAG
ATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAG
ATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAAC
AACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGAT
TTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGA
CATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAA
GAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCT
ACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTA
CAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTA
ATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATG
TGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAG
AAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAA
CACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGA
ACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGC
TTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAA
ATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAA
AAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTG
TTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTT
TTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACA
ATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGG
AGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAG
TGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAG
TCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTG
AGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGG
CAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGA
TCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACAT
CCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAA
GGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTG
AATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGT
GTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCC
ACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCC
TCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCA
AACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCC
ATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGAT
TGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTG
ACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACA
GAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGC
TTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAAT

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000251076_chr15_51809364_-_11707nt
CAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCT
GGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCT
GAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCT
GTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAAC
AAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACA
AGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAA
GAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAG
AGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTG
TCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCT
GTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAA
GCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCT
GAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGT
GGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACG
AATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGA
CAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTA
GAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCA
CTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGAT
GGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCT
TTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGAT
GAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATC
CTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATT
AGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCA
GTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAG
GGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTT
CCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAA
GTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAA
GAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGA
GTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAA
AAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTA
GTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCA
AAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAA
AGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGG
CACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCT
GAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTA
AGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAAT
GGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAG
GCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTG
GAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATG
GTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAA
AATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTT
TCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAG
ACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTT
AATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTG
CTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCA
TCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATG
TGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAG
AAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAA
CTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCAT
CTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGT
TGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAA
GATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCT
ATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTA
GAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGC
AAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGC
TCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGAT
GGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTA
TCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCAT
GTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCG
ACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAA
GATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGG
AAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAA
GGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGAT
TATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGT
ACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACG
GATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAA
CATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGAT
ACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATAC
TTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGC
CATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAA
TTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGG
AACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAA
AAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAA
CGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAG
CTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGC
CAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACC
CGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGT
TTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACT
GAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTT
TTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCAC
AGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAG
TATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAG
GAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATG
TTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAG
ATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAG
GAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTG
CTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAG
CATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGT
GGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTA
CCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCAC
ATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTA
GCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCT
TATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGG
CCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTT
GCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGA
ATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCT
GAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCT
GCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCT
GATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCAC
CAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCT
GGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAG
AAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGA
AATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTT
AAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCA
GGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCT
TCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCC
AAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCA
CCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATG
ACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTC
TGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTT
CTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCA
TTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGA
AACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGT
AGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCC
TTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCA
TTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTC
TCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTG
GGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAG
AGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATGCTG
ACATACTAAAAAAAATAAAACCTAGTATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGAGAT
TAGCAAATTAGTAACTTGAAATAATGAAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGTTCT
TACCACTGACTGAAGCATGCCTGCAGTCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCTGGA
AAACTTTCTTAGCTGTGGAGCAGTGCGCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCCTGT
TAGTGTTTATACTGAGCTAGTACTGTAACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATTTTT
TGGACTGCTAGTTTTTCTATTTAAATATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACACACC
TTCTTAGTCCAGTTTAGTACTTTTTCTTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATAGAG
CATTTCATATCATAATTAAAATGAATGTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAGCCT
ATTGTATAAACTATGCAGAGTTAAATATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGACCAA
AAATATGTTGAGATACTGAAACTAATGTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATGCCT
GTGTGGTAAATAGTAAATACAATGGCATAAAAGTAACTTTCTCTGAAGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAAAAT
AAATGTTATTTGTTAGAGTTTTTAGTTTGATACTGTTTTTGACCATTGAGATTTTTAATTTGATAAAATGTTTAACTGTTAGAGAATTTG

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000543779_chr15_51809364_-_11633nt
CAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCT
GGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCT
GAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCT
GTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAAC
AAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACA
AGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAA
GAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAG
AGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTG
TCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCT
GTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAA
GCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCT
GAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGT
GGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACG
AATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGA
CAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTA
GAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCA
CTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGAT
GGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCT
TTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGAT
GAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATC
CTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATT
AGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCA
GTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAG
GGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTT
CCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAA
GTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAA
GAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGA
GTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAA
AAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTA
GTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCA
AAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAA
AGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGG
CACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCT
GAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTA
AGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAAT
GGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAG
GCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTG
GAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATG
GTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAA
AATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTT
TCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAG
ACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTT
AATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTG
CTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCA
TCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATG
TGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGCTAAAGCTTCAGAAGGGGCTTCCTCTGAGAGTCTACTTTCAGTCCCTGGACAG
AAGAACGTAGATTCTTCTCCAGAAACCTCTCCTAGTGTGAGCCCCATGCCACATTCTTCATCAATTGCCAATCTTCAAACTGCCAGTAAA
CTTATTCTGAGTTCTAGACTGGTGTATAGCCAACCCCTTGATCTCCCAGAATCAGTTGAAGTAATAAGAGCAACGCCTTCAGCAGGCCAT
CTGAGTTCTTCTTCAATTTATCCAGTGTGCCTTGCACCTTATTTAGTGGTTACAACTTGTTCTGACAATAAAGTACGCTTCTGGAAATGT
TGTATGGAAGCCAACCCAGAGTGTAATAAAAGTGATGAGAAAGAAATTTATCATTGGAAGAGATGGCCTTTGATGAATGATGAAGGAGAA
GATAATAGCAGTACAGTGAGCATTGTGGGAAGACCAGTTGCTGTTAGCTGTTCATACACAGGTCGCCTTGCAGTGGCTTATAAGCAGCCT
ATCCACCATAATGGTTTTGTTTCTAAAGAATTTTCCATGCATGTTTGTATATTTGAATGTGAATCTACAGGAGGATCAGAGTGGGTTTTA
GAACAAACAATTCATCTTGATGATTTGGTTAAGGTTGGGAGTGTACTTGATTCAAGGGTCAGCGTCGACAGTAATCTGTTTGTGTATAGC
AAGTCAGATGCACTCTTGAGCAAGGATAGATATCTTATTCCGAATATCAAACATTTAGTACATTTGGACTGGGTATCAAAAGAAGATGGC
TCCCACATTCTTACAGTGGGAGTCGGTGCGAATATCTTCATGTATGGAAGGCTTTCAGGAATTGTGACTGAGCAAACCAACAGTAAGGAT
GGAGTAGCTGTCATCACTTTACCACTAGGTGGTAGTATCAAGCAAGGAGTTAAGTCAAGATGGGTTCTTCTTAGATCTATAGACTTGGTA
TCTTCTGTTGATGGTACTCCTTCACTGCCTGTTTCTCTCTCTTGGGTAAGAGATGGGATATTGGTGGTAGGAATGGATTGTGAAATGCAT
GTATATGCACAGTGGAAGCATGCTGTCAAATTTGGAGACACTGAAGCTGATAGTTCTAATGCAGAAGAGGCAGCAATGCAAGATCATTCG
ACCTTTAAATCTAATATGCTGGCAAGAAAAAGTGTTGTTGAAGGAACAGCTATTTCTGATGATGTTTTTTGTTCACCAACTGTAATTCAA
GATGGTGGCTTATTTGAGGCTGCACATGTACTTTCCCCTACTCTTCCACAATATCATCCAACTCAGCTGTTAGAATTGATGGATTTAGGG
AAAGTGCGAAGGGCTAAAGCCATTCTCTCTCATTTAGTAAAATGTATTGCAGGTGAAGTAGCAATAGTTAGAGATCCTGATGCTGGAGAA
GGAACTAAGCGACATCTCTCTCGAACTATTAGTGTAAGTGGCAGTACAGCAAAGGAAACAGTCACCGTAGGAAAAGATGGTACTCGAGAT
TATACTGAGATAGATTCTATCCCTCCACTACCACTATATGCATTACTTGCTGCAGATCAAGATACATCCTACAGAATTTCAGAAGAAAGT
ACAAAGATACCACAGAGCTATGAAGATCAGACAGTAAGTCAACCAGAGGATCAGTATTCAGAGCTGTTTCAAATCCAGGATATACCAACG
GATGATATTGATTTAGAGCCTGAAAAGAGAGAAAACAAATCAAAAGTAATAAATCTTTCTCAATATGGACCAGCTTACTTTGGCCAAGAA
CATGCAAGGGTACTTTCAAGTCATCTTATGCACTCAAGTCTACCAGGCCTTACCCGTTTGGAGCAGATGTTCCTTGTAGCTTTGGCTGAT
ACAGTGGCTACTACTAGTACTGAGCTTGATGAAAGCAGAGATAAGAGTTGCTCAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATAC
TTGTTAGCTATGCGCCTACACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGC
CATTTTGCCTGGGCTTTTCATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAA
TTAAGAGCTATGGGCATAGGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGG
AACAATGATGCCTTAGATGCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAA
AAAATGACAACATTTTTCAGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAA
CGCTTTGAACAATCGGCTGCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAG
CTAGCCATGGTTATTGCCCGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGC
CAAAAGGATGGCTCAGGATTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACC
CGAGCCTTGGACACATTACTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGT
TTTTATAACTACCTTCGAACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACT
GAGAAGAACTTTGTTGATAAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTT
TTAGCCTTGGAGGTACTCTCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCAC
AGGATGGATGATGTACCTTCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAG
TATGACTGGAGTCAGCCAATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAG
GAAGACGATGCTGTTGGTTTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATG
TTATTAACACCTCAGGAAGAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAG
ATCCTTATGACTGAATTAAGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAG
GAAATTGCTGCCTTGCATGAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTG
CTGGATCAGGAAGAAATGGTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAG
CATGCAGAAAGACGAAAGTCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGT
GGTGGTTTGGCTTCAGTAAGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTA
CCACTGCCTACCACCCTACCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCAC
ATCCATGATATACTTTATACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTA
GCAGCATCACTTTCTGCATCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGCAGTCAAACAGAAGGAAATCAGTTTACAGGAATG
GCTTATCAAGGACTTCTTTTAAGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAA
TGGCCTGGTGTGAGCTCACTTATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTT
GTTGCTGTTTACTTAAGTTTATTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAAT
CGAATGTGGGCTGCTGTTTTTGGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTT
TCTGAAGACATAGATAAACACCGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTG
CCTGCAGAAAGACCATCTTACAAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTG
TCTGATAGTGGTGTTATATATGATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAG
CACCAAGATCCAAATTCCTATAGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATT
GCTGGACTGGAATTCTCTGAGCTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAA
GAGAAAATGGATCAGTTTGAAGGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTT
CGAAATAAAGCAATGCTAGAACCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTT
GTTAAACAAGAGGTCCTTCAAGAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTAT
CCAGGTGGAAAGGCGAAAGTCATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTG
GCTTCAACACATGATGTTCAAGAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAA
TCCAAAAGTTCAGATGATGTTGATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCAT
CCACCTTCATCTCTGCCATGGCTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGA
ATGACTTCACACCCAGTCCATCAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTT
GTCTGCTTTCGTCAAGCTGGCAATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGT
TTTCTGAGTATCTGGCAAGTTAACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTT
GCATTTATTACCTCTTCAAGTCTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCC
GGAAACAGCCTCATTCATGGTTTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGG
GGTAGGAAAGGACACGTCTGCATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTG
GCCTTGGATCCCTATGAGGAATATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCAT
TCATTTAAAAGTGAACATGCTAAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTC
TTCTCCTGTGGTGCAGATGGCACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGA
TTGGGGTTTTATTTTTATATACATTTCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAA
CAGAGAATCTCTGTGTAGAATTTGAATATGACCCAAGCTGAGTATTATCTAAACAGGTTGGTGGAATGAATGCGCATGTACCTTATTATG
CTGACATACTAAAAAAAATAAAACCTAGTATTGTATGAAGGATAGCTATTCTTTACAGCATTTAGCAAACCTGATTCAGAAAACATTTGA
GATTAGCAAATTAGTAACTTGAAATAATGAAAAGGACGTTTATACCAAATTAAGGAAGAAAATGTTGCTGATTTGGGTTTTTCTTCCTGT
TCTTACCACTGACTGAAGCATGCCTGCAGTCTCCTCCTCTGTTGAATGAAGGATAATCATAAGGTGTTTGTTAGGAGCGCTAGACCACCT
GGAAAACTTTCTTAGCTGTGGAGCAGTGCGCAGTGACCAGTTCTCTGCTGTGAGAGGCCGTTTCCATTCTTTCCTGCTGAATATTTTTCC
TGTTAGTGTTTATACTGAGCTAGTACTGTAACTTGCAAATGAGTGCAAATTTAAATGCAATGTTTTACTCACAATTTGCACATTCACATT
TTTTGGACTGCTAGTTTTTCTATTTAAATATTTGCCTTCATGTTAGGAATGTACTATGTGAACATGACATATTTGTAGTTAACCAAACAC
ACCTTCTTAGTCCAGTTTAGTACTTTTTCTTTTCGTGTATTCAAGGTTAAACACCCAAACATTTAAGGATATGTTGAAACTACACCAATA
GAGCATTTCATATCATAATTAAAATGAATGTTAGGCTTCTTGTGGCCAGTTAATAGTTGATGAGATTGGTGACATTATTTATTGCCACAG
CCTATTGTATAAACTATGCAGAGTTAAATATTTGCTTGTAAAATATTAGCCAATGTTGTCATTATTTTGATGTATTTCCTTGGTTATGAC
CAAAAATATGTTGAGATACTGAAACTAATGTCTGTGTGTTTAAATGTTTACCAGCAAATTGTCTTATCATGTTAATGAGAATGTTCAATG
CCTGTGTGGTAAATAGTAAATACAATGGCATAAAAGTAACTTTCTCTGAAGATGTGATGTTCAGGCTGTGAAATATATATGTAAAAGAAA

>In-frame_TP53BP1_ENST00000450115_chr15_43724392_-_DMXL2_ENST00000449909_chr15_51809364_-_8698nt
CAGCGGCGACCTAGGGATCGATCTGGAGGGACTTGGGGAGCGTGCAGAGACCTCTAGCTCGAGCGCGAGGGACCTCCCGCCGGGATGCCT
GGGGAGCAGATGGACCCTACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCCTGATAATTGAAGATTCTCAGCCT
GAAAGCCAGGTTCTAGAGGATGATTCTGGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCACAAAGAAAATCCT
GTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTGGAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAAAAC
AAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTCCATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACA
AGCAGTGTTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGAGAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAA
GAAGATACTTCAGGCAATACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTTTTGGGGTTCTGGAACTCTCCCAG
AGCCAGGATGTTGAGGAAAATACTGTGCCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGGTTATACCAGGCTG
TCTGATGTGGATGCTAATACTGCAATTAAGCATGAAGAACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATCCCT
GTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAATCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAA
GCATCTGTTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAAAGTGGACTGCAGATTCAGAAGTCACCAGAGCCT
GAGGTTTTGTCAACTCAGGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCTCTACTCCTTCAAGGGAGGAAGGT
GGGTGTTCTTTGGCTTCCACTCCTGCCACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGACAGTCTTTCCACG
AATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTTTCCGATCTACTCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGAAGGGAGA
CAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGAGCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTA
GAAAACCCCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATATCTCAGAGCACACCAGTCTTCCCTCCTGGGTCA
CTTCCTATCCCATCCCAGCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAACAATCAAATGATGGGAAGAAAGAT
GGAGATATGCATAGTTCATCTTTGACAGTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGATCTTGGGCTATCT
TTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAAGTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATTGAT
GAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCCAGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATC
CTGATGAATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACAAAGGGAGATGATACAGACACCAGGGATGACATT
AGTATTTTAGCCACTGGTTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCACTTGTGATTCGGGGAGTCAGGCA
GTTCCGTCACCAGCTACTCGATCTGAGGCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACACCATCCAGAGGAG
GGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGACACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGTGTT
CCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCTTCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAA
GTTGAAACCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAAGAATTGGAACATAAGGAACAGGAAGCTTGGGAA
GAAGCTACTTCAGAGGACTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATGTTTCTTGTGAACCTTTGGAGGGA
GTGGAGAAGTGCTCAGATTCCCAGTCATGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGACACCAAGGAAGAA
AAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGACTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCTTTA
GTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCCCCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCA
AAAATGGCTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAGCCCTCTGCCCATGCCTCACAAAGCTTCTGTGAA
AGTTCTAGTGAAACCCCATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTGGTGCAACCCCACCTCTTATTGGG
CACCTAAAATTGGAGCCCAAGAGACACAGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCATGTCT
GAAAGCATGGTGGAGACCCATGATCCCATACTTGGGAGTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGTCTA
AGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTTGCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAAT
GGATCTACTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTGAGCTGTATCTGTGAAGCCAGGCAAGAGAATGAG
GCTCGAAGTGAGGATCCCCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAGGAGAAGAGGAGAAAGAAAAATTG
GAGGGTGACCATACAATCAGGCAGAGTCAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGCTTCCCAGAAGATG
GTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAATGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAGGAA
AATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGGAATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTT
TCAGCAGCAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGACCAGAACTTTGGAAAGCAAGATGCCACAGTTCAG
ACTGAGAGGGGGAGTGGTGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCCAGAAACTTATTGGAGAAGTGTTT
AATATTGTGAGCCAACAGTCTACTGCTCGACCTGGCTGCATTATTGAACTCGACGCAATAACCAACCAATGTGGCTCAAATACACAGTTG
CTTCATGTGTTTCAAGAAGACTTCATTATAGGATATAAACCACATAAGGAAGATATGGAGAAAAAGGAAACAGAAATATTTTTTCAGCCA
TCACAAGGATACCGCCCACCACCATTTTCAGAAAAGTTCTTTCTAGTAGTAATTGAGAAGGACAGCAATAATAACTCTATTCTGCATATG
TGGCACCTTCATCTTAAATCTGTACAAGCATGTTTAGGAAGAGATACATTAGATGAGTGTGGTTTGAGATACTTGTTAGCTATGCGCCTA
CACACATGCCTTTTGACATCGCTGCCTCCTTTATACCGAGTGCAGCTACTTCATCAAGGTGTCTCTACATGCCATTTTGCCTGGGCTTTT
CATTCTGAGGCTGAAGAAGAACTGATTAATATGATTCCAGCAATTCAGAGAGGGGACCCCCAGTGGTCTGAATTAAGAGCTATGGGCATA
GGATGGTGGGTGAGGAACATTAACACGCTTCGAAGATGCATTGAAAAGGTTGCCAAAGCTTCTTTTCAAAGGAACAATGATGCCTTAGAT
GCTGCACTATTCTACCTTTCAATGAAGAAGAAAGCAGTAGTGTGGGGTCTGTTTAGGTCACAGCATGATGAAAAAATGACAACATTTTTC
AGCCACAACTTTAATGAAGATAGATGGCGAAAAGCTGCTTTGAAAAATGCTTTTTCCTTACTTGGAAAACAACGCTTTGAACAATCGGCT
GCTTTTTTCTTGCTAGCTGGTTCATTGAAAGATGCCATAGAGGTATGTCTTGAAAAAATGGAAGATATTCAGCTAGCCATGGTTATTGCC
CGTTTATATGAATCTGAATTTGAGACTTCATCCACTTATATATCCATCCTAAATCAGAAGATTTTGGGTTGCCAAAAGGATGGCTCAGGA
TTCAGTTGCAAAAGATTACATCCTGATCCTTTCCTGCGTAGTCTTGCCTATTGGGTAATGAAAGATTACACCCGAGCCTTGGACACATTA
CTGGAACAAACACCAAAGGAGGATGATGAACATCAAGTTATCATCAAGTCTTGTAACCCGGTGGCATTTAGTTTTTATAACTACCTTCGA
ACTCATCCTTTGCTCATTCGAAGAAATCTTGCCTCCCCTGAAGGAACTTTGGCAACCTTAGGTCTCAAAACTGAGAAGAACTTTGTTGAT
AAAATTAACCTCATAGAAAGAAAATTATTCTTTACCACTGCAAATGCTCATTTTAAAGTTGGATGCCCTGTTTTAGCCTTGGAGGTACTC
TCCAAAATTCCAAAAGTAACCAAAACATCTGCCTTATCTGCAAAAAAAGATCAGCCTGACTTCATTTCTCACAGGATGGATGATGTACCT
TCACATTCAAAAGCTCTGAGTGATGGCAATGGAAGTTCTGGCATTGAATGGTCAAATGTAACTTCATCACAGTATGACTGGAGTCAGCCA
ATAGTAAAAGTTGATGAGGAACCTCTTAATCTTGATTGGGGTGAAGATCACGACAGTGCCTTAGATGAAGAGGAAGACGATGCTGTTGGT
TTAGTGATGAAAAGTACAGATGCCAGGGAAAAAGATAAACAATCAGATCAGAAGGCCTCAGACCCTAACATGTTATTAACACCTCAGGAA
GAGGATGATCCTGAAGGTGATACTGAAGTTGATGTGATTGCTGAACAACTAAAATTCAGAGCTTGTTTAAAGATCCTTATGACTGAATTA
AGAACATTGGCTACAGGTTATGAAGTAGATGGAGGAAAACTCAGATTTCAACTCTATAACTGGCTTGAAAAGGAAATTGCTGCCTTGCAT
GAGATATGTAATCATGAATCAGTTATTAAAGAGTATTCCAGTAAGACATATTCCAAAGTAGAGAGTGATCTGCTGGATCAGGAAGAAATG
GTAGACAAACCAGATATTGGTTCCTATGAGCGCCATCAAATAGAAAGAAGAAGATTGCAGGCCAAACGAGAGCATGCAGAAAGACGAAAG
TCGTGGTTGCAGAAAAACCAAGATCTCCTGAGAGTATTTCTCAGCTACTGTAGCCTTCATGGGGCCCAAGGTGGTGGTTTGGCTTCAGTA
AGGATGGAACTCAAATTTTTGCTACAAGAATCACAACAGGAAACTACAGTAAAGCAGCTCCAGTCTCCACTACCACTGCCTACCACCCTA
CCTCTGCTTTCAGCAAGTATTGCGTCAACAAAAACAGTCATAGCTAATCCTGTATTGTACTTAAATAATCACATCCATGATATACTTTAT
ACTATTGTTCAGATGAAAACACCACCTCATCCCAGTATTGAAGATGTGAAGGTGCACACACTTCATTCACTAGCAGCATCACTTTCTGCA
TCAATTTACCAAGCATTATGTGACAGTCATAGCTACAGTCAAACAGAAGGAAATCAGTTTACAGGAATGGCTTATCAAGGACTTCTTTTA
AGTGATCGTAGAAGACTAAGGACAGAAAGCATTGAAGAACACGCAACACCAAATTCATCTCCTGCTCAATGGCCTGGTGTGAGCTCACTT
ATTAATCTTTTGAGTTCAGCCCAAGATGAAGACCAGCCAAAACTGAACATTTTGCTATGTGAAGCTGTTGTTGCTGTTTACTTAAGTTTA
TTGATACATGCTCTTGCCACAAATTCCTCCAGTGAATTATTTCGGCTTGCAGCCCACCCATTAAATAATCGAATGTGGGCTGCTGTTTTT
GGAGGCGGTGTAAAACTTGTTGTGAAACCTCGAAGACAATCAGAAAATATTTCAGCACCTCCTGTCCTTTCTGAAGACATAGATAAACAC
CGTAGGAGATTTAACATGAGAATGCTCGTCCCTGGAAGGCCTGTAAAAGATGCTACCCCACCACCGGTGCCTGCAGAAAGACCATCTTAC
AAAGAAAAATTTATTCCTCCCGAACTTAGTATGTGGGATTATTTTGTTGCAAAGCCATTTCTTCCTTTGTCTGATAGTGGTGTTATATAT
GATTCTGATGAAAGCATTCATAGTGATGAAGAAGATGATGCCTTTTTTTCAGATACACAAATACAGGAGCACCAAGATCCAAATTCCTAT
AGCTGGGCTCTTCTACATTTGACAATGGTTAAACTAGCACTTCACAATGTCAAGAATTTCTTTCCTATTGCTGGACTGGAATTCTCTGAG
CTGCCTGTAACATCACCATTAGGTATTGCTGTGATTAAAAACTTGGAGAACTGGGAACAGATCTTGCAAGAGAAAATGGATCAGTTTGAA
GGTCCACCCCCTAACTATATCAACACATATCCAACTGACCTTTCAGTGGGAGCTGGACCAGCTATTCTTCGAAATAAAGCAATGCTAGAA
CCTGAAAATACCCCATTCAAGTCCCGGGATTCTTCTGCATTTCCAGTCAAACGACTTTGGCATTTCCTTGTTAAACAAGAGGTCCTTCAA
GAGACATTTATTAGATATATTTTCACTAAGAAAAGAAAGCAGAGTGAGGTTGAAGCTGATCTGGGCTATCCAGGTGGAAAGGCGAAAGTC
ATCCATAAGGAATCTGATATGATCATGGCATTTTCTGTTAATAAGGCAAATTGTAATGAAATTGTTTTGGCTTCAACACATGATGTTCAA
GAACTTGATGTTACTTCTCTACTGGCCTGTCAGTCATACATATGGATCGGAGAAGAATATGACAGAGAATCCAAAAGTTCAGATGATGTT
GATTATCGTGGTTCCACTACAACTCTTTATCAACCCAGTGCAACATCCTATTCAGCAAGTCAGGTGCATCCACCTTCATCTCTGCCATGG
CTGGGCACTGGACAGACTAGCACTGGAGCTAGTGTGCTTATGAAAAGGAATCTACATAATGTTAAGAGAATGACTTCACACCCAGTCCAT
CAATACTATCTTACAGGTGCTCAGGACGGCAGTGTACGAATGTTTGAATGGACGCGGCCTCAGCAACTTGTCTGCTTTCGTCAAGCTGGC
AATGCAAGAGTTACTAGATTATATTTTAATTCACAAGGCAACAAGTGTGGTGTTGCGGATGGAGAGGGTTTTCTGAGTATCTGGCAAGTT
AACCAAACTGCATCAAATCCTAAACCTTATATGAGTTGGCAGTGCCACAGTAAAGCCACAAGTGACTTTGCATTTATTACCTCTTCAAGT
CTAGTTGCCACATCTGGACACTCCAATGACAATAGAAATGTTTGCCTCTGGGACACATTAATATCACCCGGAAACAGCCTCATTCATGGT
TTCACGTGCCACGATCATGGTGCCACGGTACTGCAGTATGCACCCAAACAGCAACTCCTAATCTCGGGGGGTAGGAAAGGACACGTCTGC
ATTTTTGACATCAGGCAAAGGCAGCTCATTCACACGTTCCAGGCCCATGACTCAGCTATTAAGGCTCTGGCCTTGGATCCCTATGAGGAA
TATTTTACCACAGGTTCAGCAGAAGGTAACATAAAGGTTTGGAGATTGACAGGCCATGGCCTAATTCATTCATTTAAAAGTGAACATGCT
AAGCAGTCCATATTTCGAAACATTGGGGCTGGAGTCATGCAGATTGACATCATCCAGGGCAATCGGCTCTTCTCCTGTGGTGCAGATGGC
ACGCTGAAAACCAGGGTTTTGCCCAATGCTTTTAACATCCCTAACAGAATTCTTGACATTCTATAAAGATTGGGGTTTTATTTTTATATA
CATTTCAGTTAAAAGGCACACTACAGTCATCACTAGGCAATTCTGCTTTCTAAGCAGTTGTATTGAAAACAGAGAATCTCTGTGTAGAAT


Top

FusionGenePPI for TP53BP1_DMXL2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TP53BP1TP53, RPA2, BLM, H2AFX, PAXIP1, CHEK1, DYNLL1, ATM, DCLRE1A, NFKB1, RPA1, E2F1, TFDP1, BRCA1, CHEK2, RAD18, USP28, UBE2I, PIAS4, RNF8, RNF168, MDC1, MCPH1, HDAC4, TP53I3, EP300, SETD8, HIST1H4A, HIST1H3A, ARAP1, NCOA3, SIRT7, COPS5, NEK1, NUP107, CCNT1, ACAA2, LIG4, ACR, PCNT, PSMD8, SDHB, SPAG9, GALNTL5, AAMP, CAPZA1, CAPZB, CDC27, CUX1, ARID3A, FASN, FLNA, XRCC6, KPNA1, KPNB1, KPNA3, MCM6, NUMA1, PCMT1, MAPK1, MAPK3, PSMC5, PTPN9, DPF2, RFC2, SAFB, SRSF1, SMARCD1, TMPO, TP73, TRPS1, DNAJC7, XRCC5, YWHAZ, DEK, HAT1, CDC23, CDC16, MTA2, ANAPC10, GNB2L1, PAICS, MYL12A, NUDC, STRAP, CBX3, CLASP2, RCOR1, SUN2, DHRS7B, CACYBP, ANAPC2, ANAPC4, ANAPC5, ANAPC7, PELO, UGGT1, BEND3, ANAPC1, ZBTB10, ANAPC16, FLCN, VCP, CDK1, CCNB1, PLK1, HIST2H4A, MEOX2, VAC14, UBE2L3, ENO1, SHMT2, MOV10, NXF1, MSL1, EED, SUMO2, KDM1A, THAP10, NUP50, POLR1C, SUB1, SMC6, FOXK1, FOXK2, UBC, TRIM28, PCGF1, DPPA4, NANOG, POU5F1, NFATC2, NUDT16L1, MRPS7, PRPF38A, BUB1, KAT8, LMNADMXL2WDR7, RAB3GAP1, C1QTNF2, ROGDI, ANTXR1, GLUL, RP2, FAF2, TSPYL6, NPY2R, YBEY, WDYHV1, DEF8, MTNR1B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000263801-17281495_152312201973dimethylated histone H4
HgeneTP53BP1chr15:43724392chr15:51809364ENST00000382044-17281495_152312251978dimethylated histone H4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TP53BP1_DMXL2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TP53BP1_DMXL2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource