FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 39032

FusionGeneSummary for TNXB_VIM

check button Fusion gene summary
Fusion gene informationFusion gene name: TNXB_VIM
Fusion gene ID: 39032
HgeneTgene
Gene symbol

TNXB

VIM

Gene ID

7148

7431

Gene nametenascin XBvimentin
SynonymsEDS3|EDSCLL|HXBL|TENX|TN-X|TNX|TNXB1|TNXB2|TNXBS|VUR8|XB|XBS-
Cytomap

6p21.33-p21.32

10p13

Type of geneprotein-codingprotein-coding
Descriptiontenascin-Xgrowth-inhibiting protein 45hexabrachion-like proteintenascin XB1tenascin XB2vimentin
Modification date2018052220180527
UniProtAcc

P22105

P08670

Ensembl transtripts involved in fusion geneENST00000375244, ENST00000451343, 
ENST00000375247, ENST00000479795, 
ENST00000433037, ENST00000549232, 
ENST00000383159, ENST00000489006, 
ENST00000469250, ENST00000440248, 
ENST00000550212, ENST00000548649, 
ENST00000424718, ENST00000475986, 
ENST00000550539, ENST00000471059, 
ENST00000551808, ENST00000548628, 
ENST00000549652, ENST00000553092, 
ENST00000552665, ENST00000465958, 
ENST00000546684, ENST00000464376, 
ENST00000552149, ENST00000551201, 
ENST00000544301, ENST00000224237, 
ENST00000485947, 
Fusion gene scores* DoF score3 X 3 X 3=279 X 6 X 4=216
# samples 38
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(8/216*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TNXB [Title/Abstract] AND VIM [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-AB2T-01ATNXBchr6

32016140

-VIMchr10

17278293

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375244ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
In-frameENST00000375244ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
5CDS-intronENST00000375244ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000451343ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000451343ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000451343ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
In-frameENST00000375247ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
In-frameENST00000375247ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
5CDS-intronENST00000375247ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000479795ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000479795ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000479795ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000433037ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000433037ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000433037ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000549232ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000549232ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000549232ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000383159ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000383159ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000383159ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000489006ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000489006ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000489006ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000469250ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000469250ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000469250ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000440248ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000440248ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000440248ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000550212ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000550212ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000550212ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000548649ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000548649ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000548649ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000424718ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000424718ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000424718ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000475986ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000475986ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000475986ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000550539ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000550539ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000550539ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000471059ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000471059ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000471059ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000551808ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000551808ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000551808ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000548628ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000548628ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000548628ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000549652ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000549652ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000549652ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000553092ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000553092ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000553092ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000552665ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000552665ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000552665ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000465958ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000465958ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000465958ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000546684ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000546684ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000546684ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000464376ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000464376ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000464376ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000552149ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000552149ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000552149ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000551201ENST00000544301TNXBchr6

32016140

-VIMchr10

17278293

+
intron-3CDSENST00000551201ENST00000224237TNXBchr6

32016140

-VIMchr10

17278293

+
intron-intronENST00000551201ENST00000485947TNXBchr6

32016140

-VIMchr10

17278293

+

Top

FusionProtFeatures for TNXB_VIM


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TNXB

P22105

VIM

P08670


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441064_115333464243DomainFibronectin type-III 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441161_124933464243DomainFibronectin type-III 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441263_135233464243DomainFibronectin type-III 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441374_146833464243DomainFibronectin type-III 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441476_157233464243DomainFibronectin type-III 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944156_16833464243DomainEGF-like 1%3B incomplete
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441574_166933464243DomainFibronectin type-III 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441674_176433464243DomainFibronectin type-III 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441778_186833464243DomainFibronectin type-III 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944183_21333464243DomainEGF-like 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441883_197133464243DomainFibronectin type-III 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441989_208933464243DomainFibronectin type-III 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442097_218533464243DomainFibronectin type-III 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944214_24433464243DomainEGF-like 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442196_229633464243DomainFibronectin type-III 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442305_239833464243DomainFibronectin type-III 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442408_250233464243DomainFibronectin type-III 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944245_27533464243DomainEGF-like 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442519_261733464243DomainFibronectin type-III 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442625_272333464243DomainFibronectin type-III 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442733_283833464243DomainFibronectin type-III 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944276_30633464243DomainEGF-like 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442839_293733464243DomainFibronectin type-III 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29442947_304033464243DomainFibronectin type-III 20
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443060_315133464243DomainFibronectin type-III 21
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944307_33733464243DomainEGF-like 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443166_325833464243DomainFibronectin type-III 22
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944338_36833464243DomainEGF-like 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944369_39933464243DomainEGF-like 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944400_43033464243DomainEGF-like 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944431_46133464243DomainEGF-like 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944462_49233464243DomainEGF-like 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944493_52333464243DomainEGF-like 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944524_55433464243DomainEGF-like 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944555_58533464243DomainEGF-like 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944586_61633464243DomainEGF-like 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944617_64733464243DomainEGF-like 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944648_67933464243DomainEGF-like 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944684_71433464243DomainEGF-like 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944715_74633464243DomainEGF-like 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-2944959_105133464243DomainFibronectin type-III 1
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29441666_166833464243MotifCell attachment site

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443262_335333464243DomainFibronectin type-III 23
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443355_344433464243DomainFibronectin type-III 24
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443449_354233464243DomainFibronectin type-III 25
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443551_364533464243DomainFibronectin type-III 26
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443655_375233464243DomainFibronectin type-III 27
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443756_384533464243DomainFibronectin type-III 28
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443846_393233464243DomainFibronectin type-III 29
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29443933_402333464243DomainFibronectin type-III 30
HgeneTNXBchr6:32016140chr10:17278293ENST00000375247-29444019_423433464243DomainFibrinogen C-terminal
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131064_1153-303674DomainFibronectin type-III 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131161_1249-303674DomainFibronectin type-III 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131263_1352-303674DomainFibronectin type-III 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131374_1468-303674DomainFibronectin type-III 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131476_1572-303674DomainFibronectin type-III 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113156_168-303674DomainEGF-like 1%3B incomplete
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131574_1669-303674DomainFibronectin type-III 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131674_1764-303674DomainFibronectin type-III 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131778_1868-303674DomainFibronectin type-III 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113183_213-303674DomainEGF-like 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131883_1971-303674DomainFibronectin type-III 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131989_2089-303674DomainFibronectin type-III 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132097_2185-303674DomainFibronectin type-III 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113214_244-303674DomainEGF-like 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132196_2296-303674DomainFibronectin type-III 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132305_2398-303674DomainFibronectin type-III 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132408_2502-303674DomainFibronectin type-III 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113245_275-303674DomainEGF-like 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132519_2617-303674DomainFibronectin type-III 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132625_2723-303674DomainFibronectin type-III 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132733_2838-303674DomainFibronectin type-III 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113276_306-303674DomainEGF-like 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132839_2937-303674DomainFibronectin type-III 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1132947_3040-303674DomainFibronectin type-III 20
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133060_3151-303674DomainFibronectin type-III 21
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113307_337-303674DomainEGF-like 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133166_3258-303674DomainFibronectin type-III 22
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133262_3353-303674DomainFibronectin type-III 23
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133355_3444-303674DomainFibronectin type-III 24
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113338_368-303674DomainEGF-like 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133449_3542-303674DomainFibronectin type-III 25
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133551_3645-303674DomainFibronectin type-III 26
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133655_3752-303674DomainFibronectin type-III 27
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113369_399-303674DomainEGF-like 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133756_3845-303674DomainFibronectin type-III 28
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133846_3932-303674DomainFibronectin type-III 29
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1133933_4023-303674DomainFibronectin type-III 30
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113400_430-303674DomainEGF-like 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1134019_4234-303674DomainFibrinogen C-terminal
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113431_461-303674DomainEGF-like 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113462_492-303674DomainEGF-like 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113493_523-303674DomainEGF-like 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113524_554-303674DomainEGF-like 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113555_585-303674DomainEGF-like 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113586_616-303674DomainEGF-like 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113617_647-303674DomainEGF-like 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113648_679-303674DomainEGF-like 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113684_714-303674DomainEGF-like 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113715_746-303674DomainEGF-like 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-113959_1051-303674DomainFibronectin type-III 1
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151064_1153-212674DomainFibronectin type-III 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151161_1249-212674DomainFibronectin type-III 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151263_1352-212674DomainFibronectin type-III 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151374_1468-212674DomainFibronectin type-III 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151476_1572-212674DomainFibronectin type-III 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115156_168-212674DomainEGF-like 1%3B incomplete
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151574_1669-212674DomainFibronectin type-III 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151674_1764-212674DomainFibronectin type-III 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151778_1868-212674DomainFibronectin type-III 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115183_213-212674DomainEGF-like 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151883_1971-212674DomainFibronectin type-III 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151989_2089-212674DomainFibronectin type-III 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152097_2185-212674DomainFibronectin type-III 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115214_244-212674DomainEGF-like 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152196_2296-212674DomainFibronectin type-III 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152305_2398-212674DomainFibronectin type-III 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152408_2502-212674DomainFibronectin type-III 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115245_275-212674DomainEGF-like 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152519_2617-212674DomainFibronectin type-III 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152625_2723-212674DomainFibronectin type-III 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152733_2838-212674DomainFibronectin type-III 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115276_306-212674DomainEGF-like 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152839_2937-212674DomainFibronectin type-III 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1152947_3040-212674DomainFibronectin type-III 20
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153060_3151-212674DomainFibronectin type-III 21
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115307_337-212674DomainEGF-like 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153166_3258-212674DomainFibronectin type-III 22
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153262_3353-212674DomainFibronectin type-III 23
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153355_3444-212674DomainFibronectin type-III 24
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115338_368-212674DomainEGF-like 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153449_3542-212674DomainFibronectin type-III 25
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153551_3645-212674DomainFibronectin type-III 26
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153655_3752-212674DomainFibronectin type-III 27
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115369_399-212674DomainEGF-like 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153756_3845-212674DomainFibronectin type-III 28
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153846_3932-212674DomainFibronectin type-III 29
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1153933_4023-212674DomainFibronectin type-III 30
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115400_430-212674DomainEGF-like 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1154019_4234-212674DomainFibrinogen C-terminal
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115431_461-212674DomainEGF-like 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115462_492-212674DomainEGF-like 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115493_523-212674DomainEGF-like 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115524_554-212674DomainEGF-like 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115555_585-212674DomainEGF-like 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115586_616-212674DomainEGF-like 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115617_647-212674DomainEGF-like 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115648_679-212674DomainEGF-like 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115684_714-212674DomainEGF-like 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115715_746-212674DomainEGF-like 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-115959_1051-212674DomainFibronectin type-III 1
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151064_1153-212674DomainFibronectin type-III 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151161_1249-212674DomainFibronectin type-III 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151263_1352-212674DomainFibronectin type-III 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151374_1468-212674DomainFibronectin type-III 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151476_1572-212674DomainFibronectin type-III 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115156_168-212674DomainEGF-like 1%3B incomplete
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151574_1669-212674DomainFibronectin type-III 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151674_1764-212674DomainFibronectin type-III 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151778_1868-212674DomainFibronectin type-III 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115183_213-212674DomainEGF-like 2
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151883_1971-212674DomainFibronectin type-III 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151989_2089-212674DomainFibronectin type-III 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152097_2185-212674DomainFibronectin type-III 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115214_244-212674DomainEGF-like 3
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152196_2296-212674DomainFibronectin type-III 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152305_2398-212674DomainFibronectin type-III 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152408_2502-212674DomainFibronectin type-III 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115245_275-212674DomainEGF-like 4
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152519_2617-212674DomainFibronectin type-III 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152625_2723-212674DomainFibronectin type-III 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152733_2838-212674DomainFibronectin type-III 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115276_306-212674DomainEGF-like 5
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152839_2937-212674DomainFibronectin type-III 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1152947_3040-212674DomainFibronectin type-III 20
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153060_3151-212674DomainFibronectin type-III 21
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115307_337-212674DomainEGF-like 6
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153166_3258-212674DomainFibronectin type-III 22
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153262_3353-212674DomainFibronectin type-III 23
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153355_3444-212674DomainFibronectin type-III 24
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115338_368-212674DomainEGF-like 7
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153449_3542-212674DomainFibronectin type-III 25
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153551_3645-212674DomainFibronectin type-III 26
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153655_3752-212674DomainFibronectin type-III 27
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115369_399-212674DomainEGF-like 8
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153756_3845-212674DomainFibronectin type-III 28
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153846_3932-212674DomainFibronectin type-III 29
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1153933_4023-212674DomainFibronectin type-III 30
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115400_430-212674DomainEGF-like 9
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1154019_4234-212674DomainFibrinogen C-terminal
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115431_461-212674DomainEGF-like 10
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115462_492-212674DomainEGF-like 11
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115493_523-212674DomainEGF-like 12
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115524_554-212674DomainEGF-like 13
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115555_585-212674DomainEGF-like 14
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115586_616-212674DomainEGF-like 15
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115617_647-212674DomainEGF-like 16
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115648_679-212674DomainEGF-like 17
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115684_714-212674DomainEGF-like 18
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115715_746-212674DomainEGF-like 19
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-115959_1051-212674DomainFibronectin type-III 1
HgeneTNXBchr6:32016140chr10:17278293ENST00000451343-1131666_1668-303674MotifCell attachment site
HgeneTNXBchr6:32016140chr10:17278293ENST00000546684-1151666_1668-212674MotifCell attachment site
HgeneTNXBchr6:32016140chr10:17278293ENST00000550539-1151666_1668-212674MotifCell attachment site
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69154_245424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69303_407424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+6996_131424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710154_245424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710303_407424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+71096_131424467Coiled coilOntology_term=ECO:0000269
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69103_411424467DomainIF rod
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710103_411424467DomainIF rod
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69326_329424467Motif[IL]-x-C-x-x-[DE] motif
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710326_329424467Motif[IL]-x-C-x-x-[DE] motif
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69132_153424467RegionNote=Linker 1
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69246_268424467RegionNote=Linker 12
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69269_407424467RegionNote=Coil 2
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+692_95424467RegionNote=Head
TgeneVIMchr6:32016140chr10:17278293ENST00000224237+69408_466424467RegionNote=Tail
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710132_153424467RegionNote=Linker 1
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710246_268424467RegionNote=Linker 12
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710269_407424467RegionNote=Coil 2
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+7102_95424467RegionNote=Head
TgeneVIMchr6:32016140chr10:17278293ENST00000544301+710408_466424467RegionNote=Tail


Top

FusionGeneSequence for TNXB_VIM


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_3391aa
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPG
TEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGY
TGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVC
VCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGR
CEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGL
APGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAY
FQLRMRVPEGPGAHEEVLPGDVRQALVPPPPPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPHLGNLWVTDP
TPDSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQ
EDVDETPSPTELGTEAPESPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQFDSFIVQYKDKDGQPQVVPVAADQREVTVY
NLEPERKYKMNMYGLHDGQRMGPLSVVIVTAPLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKD
KDGPQVVPVEGHERSVTVTPLDAGRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVAITAGREETETETTAPTPPAPEPHLGELTVE
EATSHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVV
GVTAAEEETPSPTEPSMEAPEPAEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQFDHFLVQFKNGDGQPKAVRVPGHEDGVTIS
GLEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSMEAPEPPEEPLLGELTVTGSSPDSLSLS
WTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGLEPGRKYKMHLYGLHEGRRLGPVSAVGVTED
EAETTQAVPTMTPEPPIKPRLGELTMTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQVMRVRGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRN
GDGQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSL
SWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIK
PRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTEEET
PSPTEPSTEAPEAPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEG
QRVGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQPQAVPVSGDLRAVAVSGLDPARKYKFLL

>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_3391aa
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPG
TEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGY
TGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVC
VCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGR
CEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGL
APGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAY
FQLRMRVPEGPGAHEEVLPGDVRQALVPPPPPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPHLGNLWVTDP
TPDSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQ
EDVDETPSPTELGTEAPESPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQFDSFIVQYKDKDGQPQVVPVAADQREVTVY
NLEPERKYKMNMYGLHDGQRMGPLSVVIVTAPLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKD
KDGPQVVPVEGHERSVTVTPLDAGRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVAITAGREETETETTAPTPPAPEPHLGELTVE
EATSHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVV
GVTAAEEETPSPTEPSMEAPEPAEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQFDHFLVQFKNGDGQPKAVRVPGHEDGVTIS
GLEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSMEAPEPPEEPLLGELTVTGSSPDSLSLS
WTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGLEPGRKYKMHLYGLHEGRRLGPVSAVGVTED
EAETTQAVPTMTPEPPIKPRLGELTMTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQVMRVRGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRN
GDGQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSL
SWTIPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIK
PRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTEEET
PSPTEPSTEAPEAPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEG
QRVGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQPQAVPVSGDLRAVAVSGLDPARKYKFLL

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_3389aa
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPG
TEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGY
TGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVC
VCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGR
CEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGL
APGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAY
FQLRMRVPEGPGAHEEVLPGDVRQALVPPPPPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPHLGNLWVTDP
TPDSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQ
EDVDETPSPTELGTEAPESPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQFDSFIVQYKDKDGQPQVVPVAADQREVTVY
NLEPERKYKMNMYGLHDGQRMGPLSVVIVTAPLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKD
KDGPQVVPVEGHERSVTVTPLDAGRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVAITAGREETETETTAPTPPAPEPHLGELTVE
EATSHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVV
GVTAAEEETPSPTEPSMEAPEPAEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQFDHFLVQFKNGDGQPKAVRVPGHEDGVTIS
GLEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSMEAPEPPEEPLLGELTVTGSSPDSLSLS
WTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGLEPGRKYKMHLYGLHEGRRLGPVSAVGVTED
EAETTQAVPTMTPEPPIKPRLGELTMTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQVMRVRGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSLSW
TIPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTEEETPS
PTEPSTEAPEAPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQPQAVPVSGDLRAVAVSGLDPARKYKFLLFG

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_3389aa
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPG
TEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGRCVCDPGY
TGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVC
VCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGR
CEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQFIPTTEGASPPFTARVPSSASAYDQRGL
APGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAY
FQLRMRVPEGPGAHEEVLPGDVRQALVPPPPPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHGPLVAEAKILPQSDPSPGTPPHLGNLWVTDP
TPDSLHLSWTVPEGQFDTFMVQYRDRDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQ
EDVDETPSPTELGTEAPESPEEPLLGELTVTGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQFDSFIVQYKDKDGQPQVVPVAADQREVTVY
NLEPERKYKMNMYGLHDGQRMGPLSVVIVTAPLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKD
KDGPQVVPVEGHERSVTVTPLDAGRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVAITAGREETETETTAPTPPAPEPHLGELTVE
EATSHTLHLSWMVTEGEFDSFEIQYTDRDGQLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGVTISGLEPDHKYKMNLYGFHGGQRMGPVSVV
GVTAAEEETPSPTEPSMEAPEPAEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQFDHFLVQFKNGDGQPKAVRVPGHEDGVTIS
GLEPDHKYKMNLYGFHGGQRVGPVSAVGLTAPGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTEPSMEAPEPPEEPLLGELTVTGSSPDSLSLS
WTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGLEPGRKYKMHLYGLHEGRRLGPVSAVGVTED
EAETTQAVPTMTPEPPIKPRLGELTMTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQVMRVRGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGD
GQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSLSW
TIPQGRFDSFTVQYKDRDGRPQVVRVRGEESEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIKPR
LGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAIGVTEEETPS
PTEPSTEAPEAPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEGQR
VGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQGQPQAVPVSGDLRAVAVSGLDPARKYKFLLFG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_10173nt
ATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGCAGGCCCCTTCTCTTCACGGTCC
AATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGGAAGCCCCTCTTCTCAGCTTTAC
GAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCACTGGCTGTGGCTGTCCCCCAGGC
ACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTTGGTGAAGGGGCTCAAGGAACAG
TGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTGCAGTCTCCATGGTGTGTTTGAT
CTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGCTGAGATCCCTCCCTCTTCCCCA
CCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGTGTGCTTTCCCGGCTACACTGGC
CCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTGTGTGTGCCGGGCAGGCTTCTCA
GGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCGCTGCGTGTGTGACCCAGGCTAC
ACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGGGCGCTGCGTGTGTAACCCCGGC
TACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGACGGGCGCTGCGTGTGTGACCCC
GGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGTGGACGGCCGCTGCGTGTGCTGG
CCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTGCGAGGACGGCGAATGCATTTGC
GACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCGCTGCGAGGACGGCCGCTGCGTG
TGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGGGCGCTGCGAGAACGGCGTGTGT
GTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCGGGGCCGCTGTGAGAGTGGCCGC
TGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGGGCGCGGGCGCTGCGTGGATGGC
CGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCGTGGGCACGGCCTTTGCGAGGAT
GGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTGCCGAGGCCGCGGCCAGTGCCTA
GATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGACTGCAGCCAGCACGGCGTGTGC
CAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTCCAACTGCCACGGGAGGGGCCGC
TGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCCGGCTGACTGCCGGGGACGTGGG
CGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCCTCCAGCCAGCGCCTGCCCTGGA
GGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGACTGTGCCATCCAGACATGCCCA
GGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGAAGACTGCGGAGAAGAGGTGCCA
ACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCCTGGCCCCGTGGATGCCTATGAA
ATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTCAGCCTATGACCAGAGAGGACTG
GCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTCCAAGACCATCACCACCATGATC
GATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCCCCAGGCTGAGGTGGACCGATTT
GTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGACGCTGCTGACTGACCTGATGCCA
GGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAGGGCCAACACAGGGTCCTCACCC
TTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGCTCCTCTCCTGCAGCAGCGCCCC
CAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGCCCAGCCTGACACCTTTGCCTAC
TTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCGCCAGGCTCTGGTGCCTCCACCC
CCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCATCATCTACCAAGGCATTATGGAC
AAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAGGACCTCCGACTCCTTGCTCCTG
CGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAAGGA
CCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTTTGTTGGCAAGAAGAGGCATGGT
CCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGGAAACCTGTGGGTGACAGACCCT
ACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTACAGGGACAGGGATGGACGGCCC
CAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTACAGATTCACTCTGTTTGGAATT
GCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCCCCCCCGCCCTGAGTTCCTGGAG
CAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGTGGCCCAGGGCCCCTTCGACTCA
TTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGAGGTTACTGTCCCCGGCCTGGAT
CCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGTGGTGGCCAAGACTGCTCCTCAG
GAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCCGCTCCTGGGGGAGCTGACAGTG
ACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCACCGTGCAGTACAAGGACAGGGAT
GGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGGGCACAAGTACAAGATGCACCTG
TACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGAAGAGACCCCTCCAGCCACTGAG
TCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGACCAGCGAGAGGTCACAGTCTAC
AACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCCCCTGTCTGTGGTCATCGTGACG
GCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCTGACAGTGACGGATATAACCCCT
GACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGACAGGGACGGGCAGCCCCAGGTG
GTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTTCCTGCTCTTTGGGATCCAGGAT
GGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGCCCCACCCCGCCTTGGGGAGCTG
TGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTCTTTTGTGGTCCAGTTCAAGGAC
AAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGCCGGCCGCAAGTACAGATTCCTC
CTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAGTGCTATGGATGATACTGGAACA
AAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGGCCTCTCCTGGACAGTCCCTGAG
GGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAGGGCAGCCTCAGGGAGGTCAGC
GTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGTGGGCCCCATCTCGGCCGTCGCC
ATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCACCTCGGGGAGTTGACAGTGGAG
GAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAATCCAGTACACAGATAGAGACGGG
CAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCACAGATACCTGGTGACCCTGTAT
GGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAAGCCTTCAGAACCTCCCACCGCA
ACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACAGTTCCC
GAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGTGCCAGGGCACGAGGAAGGGGTC
ACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCATGGGCCCTGTGTCTGTCGTC
GGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGCTGAGGAGCCGCTCCTGGGGGAG
CTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAG
GACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAGTACAAG
ATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCCCGAAGAGGAGTCCCCTGATGCT
CCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACACGAGGATGGGGTCACCATCTCG
GGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCGTGTCTGCTGTTGGTTTAACT
GCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAAGCCTCGCCTGGAGGAGCTGACC
GTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAAGAATGGG
GATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCCAGACAACAAGTACAAGATGAAC
CTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAA
CCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCC
TGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAG
GAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCACGAGGGGCGGCGCGTGGGCCCG
GTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGGCACAGAGGCCCCAGGGCCCCCC
GAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGACCGTCCCCCAGGGCCGCTTTGAC
TCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAGCAAGGTCACTGTGAGGGGCCTG
GAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTCTGCCGTGGGCGTCACAGAGGAT
GAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCATGACAGATGCCACC
CCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAG
GCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCAC
GGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCCCACGGAACTCAGCACTGAGGCC
CCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAG
GGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAGGGGCGAGGAGAGCGAGGTCACC
GTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGTGGGCCCGGTGTCCACCGTGGGT
GTGACAGCTCCAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCCTCGCCTCGGGGAGCTG
ACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAAT
GGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCACAAGTACAAGATG
AACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGAAACTCCCGCCCCCACA
GAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTC
TCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTCAGGGGC
GAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGC
CCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAG
CCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGGCCAGTTTGACCACTTC
CTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCA
GACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGTGACGGAGGAAGAGACC
CCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGACAGGATCCTCCCCTGAC
TCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCAGCCCCAGGTGGTG
CGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTACGGCCTCCACGAGGGG
CAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCTGGGGGAGCTGGCGGTG
GCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACAGTACAGGGACGCGCAG
GGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAAGTACAAGTTCCTGCTC
TTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACTCCCTCTGGTTGATACC
CACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTCTCAGCATCACGATGACCTTGAA

>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_10173nt
ATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGCAGGCCCCTTCTCTTCACGGTCC
AATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGGAAGCCCCTCTTCTCAGCTTTAC
GAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCACTGGCTGTGGCTGTCCCCCAGGC
ACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTTGGTGAAGGGGCTCAAGGAACAG
TGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTGCAGTCTCCATGGTGTGTTTGAT
CTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGCTGAGATCCCTCCCTCTTCCCCA
CCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGTGTGCTTTCCCGGCTACACTGGC
CCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTGTGTGTGCCGGGCAGGCTTCTCA
GGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCGCTGCGTGTGTGACCCAGGCTAC
ACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGGGCGCTGCGTGTGTAACCCCGGC
TACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGACGGGCGCTGCGTGTGTGACCCC
GGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGTGGACGGCCGCTGCGTGTGCTGG
CCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTGCGAGGACGGCGAATGCATTTGC
GACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCGCTGCGAGGACGGCCGCTGCGTG
TGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGGGCGCTGCGAGAACGGCGTGTGT
GTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCGGGGCCGCTGTGAGAGTGGCCGC
TGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGGGCGCGGGCGCTGCGTGGATGGC
CGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCGTGGGCACGGCCTTTGCGAGGAT
GGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTGCCGAGGCCGCGGCCAGTGCCTA
GATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGACTGCAGCCAGCACGGCGTGTGC
CAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTCCAACTGCCACGGGAGGGGCCGC
TGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCCGGCTGACTGCCGGGGACGTGGG
CGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCCTCCAGCCAGCGCCTGCCCTGGA
GGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGACTGTGCCATCCAGACATGCCCA
GGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGAAGACTGCGGAGAAGAGGTGCCA
ACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCCTGGCCCCGTGGATGCCTATGAA
ATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTCAGCCTATGACCAGAGAGGACTG
GCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTCCAAGACCATCACCACCATGATC
GATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCCCCAGGCTGAGGTGGACCGATTT
GTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGACGCTGCTGACTGACCTGATGCCA
GGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAGGGCCAACACAGGGTCCTCACCC
TTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGCTCCTCTCCTGCAGCAGCGCCCC
CAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGCCCAGCCTGACACCTTTGCCTAC
TTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCGCCAGGCTCTGGTGCCTCCACCC
CCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCATCATCTACCAAGGCATTATGGAC
AAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAGGACCTCCGACTCCTTGCTCCTG
CGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAAGGA
CCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTTTGTTGGCAAGAAGAGGCATGGT
CCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGGAAACCTGTGGGTGACAGACCCT
ACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTACAGGGACAGGGATGGACGGCCC
CAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTACAGATTCACTCTGTTTGGAATT
GCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCCCCCCCGCCCTGAGTTCCTGGAG
CAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGTGGCCCAGGGCCCCTTCGACTCA
TTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGAGGTTACTGTCCCCGGCCTGGAT
CCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGTGGTGGCCAAGACTGCTCCTCAG
GAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCCGCTCCTGGGGGAGCTGACAGTG
ACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCACCGTGCAGTACAAGGACAGGGAT
GGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGGGCACAAGTACAAGATGCACCTG
TACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGAAGAGACCCCTCCAGCCACTGAG
TCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGACCAGCGAGAGGTCACAGTCTAC
AACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCCCCTGTCTGTGGTCATCGTGACG
GCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCTGACAGTGACGGATATAACCCCT
GACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGACAGGGACGGGCAGCCCCAGGTG
GTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTTCCTGCTCTTTGGGATCCAGGAT
GGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGCCCCACCCCGCCTTGGGGAGCTG
TGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTCTTTTGTGGTCCAGTTCAAGGAC
AAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGCCGGCCGCAAGTACAGATTCCTC
CTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAGTGCTATGGATGATACTGGAACA
AAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGGCCTCTCCTGGACAGTCCCTGAG
GGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAGGGCAGCCTCAGGGAGGTCAGC
GTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGTGGGCCCCATCTCGGCCGTCGCC
ATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCACCTCGGGGAGTTGACAGTGGAG
GAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAATCCAGTACACAGATAGAGACGGG
CAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCACAGATACCTGGTGACCCTGTAT
GGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAAGCCTTCAGAACCTCCCACCGCA
ACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACAGTTCCC
GAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGTGCCAGGGCACGAGGAAGGGGTC
ACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCATGGGCCCTGTGTCTGTCGTC
GGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGCTGAGGAGCCGCTCCTGGGGGAG
CTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAG
GACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAGTACAAG
ATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCCCGAAGAGGAGTCCCCTGATGCT
CCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACACGAGGATGGGGTCACCATCTCG
GGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCGTGTCTGCTGTTGGTTTAACT
GCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAAGCCTCGCCTGGAGGAGCTGACC
GTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAAGAATGGG
GATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCCAGACAACAAGTACAAGATGAAC
CTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAA
CCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCC
TGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAG
GAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCACGAGGGGCGGCGCGTGGGCCCG
GTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGGCACAGAGGCCCCAGGGCCCCCC
GAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGACCGTCCCCCAGGGCCGCTTTGAC
TCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAGCAAGGTCACTGTGAGGGGCCTG
GAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTCTGCCGTGGGCGTCACAGAGGAT
GAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCATGACAGATGCCACC
CCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAG
GCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCAC
GGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCCCACGGAACTCAGCACTGAGGCC
CCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAG
GGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAGGGGCGAGGAGAGCGAGGTCACC
GTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGTGGGCCCGGTGTCCACCGTGGGT
GTGACAGCTCCAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCCTCGCCTCGGGGAGCTG
ACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAAT
GGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCACAAGTACAAGATG
AACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGAAACTCCCGCCCCCACA
GAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTC
TCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTCAGGGGC
GAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGC
CCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAG
CCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGGCCAGTTTGACCACTTC
CTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCA
GACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGTGACGGAGGAAGAGACC
CCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGACAGGATCCTCCCCTGAC
TCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCAGCCCCAGGTGGTG
CGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTACGGCCTCCACGAGGGG
CAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCTGGGGGAGCTGGCGGTG
GCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACAGTACAGGGACGCGCAG
GGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAAGTACAAGTTCCTGCTC
TTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACTCCCTCTGGTTGATACC
CACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTCTCAGCATCACGATGACCTTGAA

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_10167nt
ATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGCAGGCCCCTTCTCTTCACGGTCC
AATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGGAAGCCCCTCTTCTCAGCTTTAC
GAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCACTGGCTGTGGCTGTCCCCCAGGC
ACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTTGGTGAAGGGGCTCAAGGAACAG
TGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTGCAGTCTCCATGGTGTGTTTGAT
CTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGCTGAGATCCCTCCCTCTTCCCCA
CCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGTGTGCTTTCCCGGCTACACTGGC
CCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTGTGTGTGCCGGGCAGGCTTCTCA
GGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCGCTGCGTGTGTGACCCAGGCTAC
ACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGGGCGCTGCGTGTGTAACCCCGGC
TACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGACGGGCGCTGCGTGTGTGACCCC
GGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGTGGACGGCCGCTGCGTGTGCTGG
CCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTGCGAGGACGGCGAATGCATTTGC
GACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCGCTGCGAGGACGGCCGCTGCGTG
TGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGGGCGCTGCGAGAACGGCGTGTGT
GTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCGGGGCCGCTGTGAGAGTGGCCGC
TGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGGGCGCGGGCGCTGCGTGGATGGC
CGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCGTGGGCACGGCCTTTGCGAGGAT
GGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTGCCGAGGCCGCGGCCAGTGCCTA
GATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGACTGCAGCCAGCACGGCGTGTGC
CAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTCCAACTGCCACGGGAGGGGCCGC
TGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCCGGCTGACTGCCGGGGACGTGGG
CGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCCTCCAGCCAGCGCCTGCCCTGGA
GGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGACTGTGCCATCCAGACATGCCCA
GGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGAAGACTGCGGAGAAGAGGTGCCA
ACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCCTGGCCCCGTGGATGCCTATGAA
ATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTCAGCCTATGACCAGAGAGGACTG
GCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTCCAAGACCATCACCACCATGATC
GATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCCCCAGGCTGAGGTGGACCGATTT
GTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGACGCTGCTGACTGACCTGATGCCA
GGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAGGGCCAACACAGGGTCCTCACCC
TTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGCTCCTCTCCTGCAGCAGCGCCCC
CAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGCCCAGCCTGACACCTTTGCCTAC
TTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCGCCAGGCTCTGGTGCCTCCACCC
CCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCATCATCTACCAAGGCATTATGGAC
AAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAGGACCTCCGACTCCTTGCTCCTG
CGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAAGGA
CCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTTTGTTGGCAAGAAGAGGCATGGT
CCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGGAAACCTGTGGGTGACAGACCCT
ACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTACAGGGACAGGGATGGACGGCCC
CAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTACAGATTCACTCTGTTTGGAATT
GCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCCCCCCCGCCCTGAGTTCCTGGAG
CAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGTGGCCCAGGGCCCCTTCGACTCA
TTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGAGGTTACTGTCCCCGGCCTGGAT
CCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGTGGTGGCCAAGACTGCTCCTCAG
GAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCCGCTCCTGGGGGAGCTGACAGTG
ACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCACCGTGCAGTACAAGGACAGGGAT
GGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGGGCACAAGTACAAGATGCACCTG
TACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGAAGAGACCCCTCCAGCCACTGAG
TCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGACCAGCGAGAGGTCACAGTCTAC
AACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCCCCTGTCTGTGGTCATCGTGACG
GCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCTGACAGTGACGGATATAACCCCT
GACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGACAGGGACGGGCAGCCCCAGGTG
GTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTTCCTGCTCTTTGGGATCCAGGAT
GGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGCCCCACCCCGCCTTGGGGAGCTG
TGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTCTTTTGTGGTCCAGTTCAAGGAC
AAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGCCGGCCGCAAGTACAGATTCCTC
CTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAGTGCTATGGATGATACTGGAACA
AAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGGCCTCTCCTGGACAGTCCCTGAG
GGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAGGGCAGCCTCAGGGAGGTCAGC
GTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGTGGGCCCCATCTCGGCCGTCGCC
ATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCACCTCGGGGAGTTGACAGTGGAG
GAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAATCCAGTACACAGATAGAGACGGG
CAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCACAGATACCTGGTGACCCTGTAT
GGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAAGCCTTCAGAACCTCCCACCGCA
ACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACAGTTCCC
GAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGTGCCAGGGCACGAGGAAGGGGTC
ACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCATGGGCCCTGTGTCTGTCGTC
GGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGCTGAGGAGCCGCTCCTGGGGGAG
CTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAG
GACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAGTACAAG
ATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCCCGAAGAGGAGTCCCCTGATGCT
CCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACACGAGGATGGGGTCACCATCTCG
GGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCGTGTCTGCTGTTGGTTTAACT
GCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAAGCCTCGCCTGGAGGAGCTGACC
GTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAAGAATGGG
GATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCCAGACAACAAGTACAAGATGAAC
CTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAA
CCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCC
TGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAG
GAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCACGAGGGGCGGCGCGTGGGCCCG
GTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGGCACAGAGGCCCCAGGGCCCCCC
GAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGACCGTCCCCCAGGGCCGCTTTGAC
TCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAGCAAGGTCACTGTGAGGGGCCTG
GAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTCTGCCGTGGGCGTCACAGAGGAT
GAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCATGACAGATGCCACC
CCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAG
GCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCAC
GGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCCCACGGAACTCAGCACTGAGGCC
CCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAG
GGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAGGGGCGAGGAGAGCGAGGTCACC
GTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGTGGGCCCGGTGTCCACCGTGGGT
GTGACAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCCTCGCCTCGGGGAGCTGACCGTG
ACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGAT
GGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTG
TACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGAAACTCCCGCCCCCACAGAACCC
AGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGG
ACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAG
AGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTG
TCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGC
CTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTC
CAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCAT
AAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGTGACGGAGGAAGAGACCCCCAGC
CCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGACAGGATCCTCCCCTGACTCGCTG
AGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCAGCCCCAGGTGGTGCGTGTC
AGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTACGGCCTCCACGAGGGGCAGCGC
GTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCTGGGGGAGCTGGCGGTGGCGGCC
GTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACAGTACAGGGACGCGCAGGGGCAG
CCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAAGTACAAGTTCCTGCTCTTTGGA
CTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACTCCCTCTGGTTGATACCCACTCA

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_10167nt
ATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGCAGGCCCCTTCTCTTCACGGTCC
AATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGGAAGCCCCTCTTCTCAGCTTTAC
GAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCACTGGCTGTGGCTGTCCCCCAGGC
ACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTTGGTGAAGGGGCTCAAGGAACAG
TGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTGCAGTCTCCATGGTGTGTTTGAT
CTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGCTGAGATCCCTCCCTCTTCCCCA
CCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGTGTGCTTTCCCGGCTACACTGGC
CCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTGTGTGTGCCGGGCAGGCTTCTCA
GGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCGCTGCGTGTGTGACCCAGGCTAC
ACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGGGCGCTGCGTGTGTAACCCCGGC
TACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGACGGGCGCTGCGTGTGTGACCCC
GGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGTGGACGGCCGCTGCGTGTGCTGG
CCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTGCGAGGACGGCGAATGCATTTGC
GACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCGCTGCGAGGACGGCCGCTGCGTG
TGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGGGCGCTGCGAGAACGGCGTGTGT
GTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCGGGGCCGCTGTGAGAGTGGCCGC
TGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGGGCGCGGGCGCTGCGTGGATGGC
CGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCGTGGGCACGGCCTTTGCGAGGAT
GGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTGCCGAGGCCGCGGCCAGTGCCTA
GATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGACTGCAGCCAGCACGGCGTGTGC
CAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTCCAACTGCCACGGGAGGGGCCGC
TGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCCGGCTGACTGCCGGGGACGTGGG
CGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCCTCCAGCCAGCGCCTGCCCTGGA
GGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGACTGTGCCATCCAGACATGCCCA
GGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGAAGACTGCGGAGAAGAGGTGCCA
ACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCCTGGCCCCGTGGATGCCTATGAA
ATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTCAGCCTATGACCAGAGAGGACTG
GCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTCCAAGACCATCACCACCATGATC
GATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCCCCAGGCTGAGGTGGACCGATTT
GTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGACGCTGCTGACTGACCTGATGCCA
GGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAGGGCCAACACAGGGTCCTCACCC
TTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGCTCCTCTCCTGCAGCAGCGCCCC
CAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGCCCAGCCTGACACCTTTGCCTAC
TTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCGCCAGGCTCTGGTGCCTCCACCC
CCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCATCATCTACCAAGGCATTATGGAC
AAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAGGACCTCCGACTCCTTGCTCCTG
CGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAAGGA
CCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTTTGTTGGCAAGAAGAGGCATGGT
CCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGGAAACCTGTGGGTGACAGACCCT
ACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTACAGGGACAGGGATGGACGGCCC
CAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTACAGATTCACTCTGTTTGGAATT
GCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCCCCCCCGCCCTGAGTTCCTGGAG
CAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGTGGCCCAGGGCCCCTTCGACTCA
TTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGAGGTTACTGTCCCCGGCCTGGAT
CCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGTGGTGGCCAAGACTGCTCCTCAG
GAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCCGCTCCTGGGGGAGCTGACAGTG
ACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCACCGTGCAGTACAAGGACAGGGAT
GGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGGGCACAAGTACAAGATGCACCTG
TACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGAAGAGACCCCTCCAGCCACTGAG
TCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGACCAGCGAGAGGTCACAGTCTAC
AACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCCCCTGTCTGTGGTCATCGTGACG
GCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCTGACAGTGACGGATATAACCCCT
GACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGACAGGGACGGGCAGCCCCAGGTG
GTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTTCCTGCTCTTTGGGATCCAGGAT
GGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGCCCCACCCCGCCTTGGGGAGCTG
TGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTCTTTTGTGGTCCAGTTCAAGGAC
AAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGCCGGCCGCAAGTACAGATTCCTC
CTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAGTGCTATGGATGATACTGGAACA
AAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGGCCTCTCCTGGACAGTCCCTGAG
GGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGAGGGCAGCCTCAGGGAGGTCAGC
GTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGTGGGCCCCATCTCGGCCGTCGCC
ATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCACCTCGGGGAGTTGACAGTGGAG
GAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAATCCAGTACACAGATAGAGACGGG
CAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCACAGATACCTGGTGACCCTGTAT
GGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAAGCCTTCAGAACCTCCCACCGCA
ACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACAGTTCCC
GAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGTGCCAGGGCACGAGGAAGGGGTC
ACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCATGGGCCCTGTGTCTGTCGTC
GGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGCTGAGGAGCCGCTCCTGGGGGAG
CTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAG
GACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAGTACAAG
ATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCCCGAAGAGGAGTCCCCTGATGCT
CCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTCCTGGACAGTCCCCGAGGGCCAG
TTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACACGAGGATGGGGTCACCATCTCG
GGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCGTGTCTGCTGTTGGTTTAACT
GCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAAGCCTCGCCTGGAGGAGCTGACC
GTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAAGAATGGG
GATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCCAGACAACAAGTACAAGATGAAC
CTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAA
CCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCC
TGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAG
GAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCACGAGGGGCGGCGCGTGGGCCCG
GTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGGCACAGAGGCCCCAGGGCCCCCC
GAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGACCGTCCCCCAGGGCCGCTTTGAC
TCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAGCAAGGTCACTGTGAGGGGCCTG
GAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTCTGCCGTGGGCGTCACAGAGGAT
GAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCATGACAGATGCCACC
CCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAG
GCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCAC
GGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCCCACGGAACTCAGCACTGAGGCC
CCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAG
GGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAGGGGCGAGGAGAGCGAGGTCACC
GTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGTGGGCCCGGTGTCCACCGTGGGT
GTGACAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCCTCGCCTCGGGGAGCTGACCGTG
ACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGAT
GGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTG
TACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGAAACTCCCGCCCCCACAGAACCC
AGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGG
ACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAG
AGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTG
TCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGC
CTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTC
CAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCAT
AAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGTGACGGAGGAAGAGACCCCCAGC
CCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGACAGGATCCTCCCCTGACTCGCTG
AGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCAGCCCCAGGTGGTGCGTGTC
AGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTACGGCCTCCACGAGGGGCAGCGC
GTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCTGGGGGAGCTGGCGGTGGCGGCC
GTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACAGTACAGGGACGCGCAGGGGCAG
CCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAAGTACAAGTTCCTGCTCTTTGGA
CTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACTCCCTCTGGTTGATACCCACTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_10689nt
TCCTCCCCTTCTCCTCCCCTGCTCGCTGCAGACTCCCTCCTCACTGTCGCTGCCGAGATCCACAGTCGGTTGTGGCTCAGCCCCTGTTGC
AGGGGACAAGTGAGGGAGACTTCCCTGTCCTGCCCTGAGACGCCGCCCTCCCGGGGTTGGGGACAGAGCAGGTGCAGAGGCACTGCAGCT
GCTCGGTTGCCCAGCCTCCTGAATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGC
AGGCCCCTTCTCTTCACGGTCCAATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGG
AAGCCCCTCTTCTCAGCTTTACGAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCAC
TGGCTGTGGCTGTCCCCCAGGCACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTT
GGTGAAGGGGCTCAAGGAACAGTGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTG
CAGTCTCCATGGTGTGTTTGATCTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGC
TGAGATCCCTCCCTCTTCCCCACCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGT
GTGCTTTCCCGGCTACACTGGCCCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTG
TGTGTGCCGGGCAGGCTTCTCAGGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCG
CTGCGTGTGTGACCCAGGCTACACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGG
GCGCTGCGTGTGTAACCCCGGCTACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGA
CGGGCGCTGCGTGTGTGACCCCGGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGT
GGACGGCCGCTGCGTGTGCTGGCCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTG
CGAGGACGGCGAATGCATTTGCGACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCG
CTGCGAGGACGGCCGCTGCGTGTGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGG
GCGCTGCGAGAACGGCGTGTGTGTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCG
GGGCCGCTGTGAGAGTGGCCGCTGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGG
GCGCGGGCGCTGCGTGGATGGCCGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCG
TGGGCACGGCCTTTGCGAGGATGGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTG
CCGAGGCCGCGGCCAGTGCCTAGATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGA
CTGCAGCCAGCACGGCGTGTGCCAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTC
CAACTGCCACGGGAGGGGCCGCTGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCC
GGCTGACTGCCGGGGACGTGGGCGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCC
TCCAGCCAGCGCCTGCCCTGGAGGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGA
CTGTGCCATCCAGACATGCCCAGGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGA
AGACTGCGGAGAAGAGGTGCCAACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCC
TGGCCCCGTGGATGCCTATGAAATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTC
AGCCTATGACCAGAGAGGACTGGCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTC
CAAGACCATCACCACCATGATCGATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCC
CCAGGCTGAGGTGGACCGATTTGTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGAC
GCTGCTGACTGACCTGATGCCAGGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAG
GGCCAACACAGGGTCCTCACCCTTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGC
TCCTCTCCTGCAGCAGCGCCCCCAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGC
CCAGCCTGACACCTTTGCCTACTTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCG
CCAGGCTCTGGTGCCTCCACCCCCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCAT
CATCTACCAAGGCATTATGGACAAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAG
GACCTCCGACTCCTTGCTCCTGCGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCC
CCAGGTGGTGCCCGTGGAAGGACCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTT
TGTTGGCAAGAAGAGGCATGGTCCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGG
AAACCTGTGGGTGACAGACCCTACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTA
CAGGGACAGGGATGGACGGCCCCAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTA
CAGATTCACTCTGTTTGGAATTGCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCC
CCCCCGCCCTGAGTTCCTGGAGCAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGT
GGCCCAGGGCCCCTTCGACTCATTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGA
GGTTACTGTCCCCGGCCTGGATCCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGT
GGTGGCCAAGACTGCTCCTCAGGAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCC
GCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCAC
CGTGCAGTACAAGGACAGGGATGGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGG
GCACAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGA
AGAGACCCCTCCAGCCACTGAGTCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGA
CCAGCGAGAGGTCACAGTCTACAACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCC
CCTGTCTGTGGTCATCGTGACGGCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCT
GACAGTGACGGATATAACCCCTGACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGA
CAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTT
CCTGCTCTTTGGGATCCAGGATGGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGC
CCCACCCCGCCTTGGGGAGCTGTGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTC
TTTTGTGGTCCAGTTCAAGGACAAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGC
CGGCCGCAAGTACAGATTCCTCCTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAG
TGCTATGGATGATACTGGAACAAAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGG
CCTCTCCTGGACAGTCCCTGAGGGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGA
GGGCAGCCTCAGGGAGGTCAGCGTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGT
GGGCCCCATCTCGGCCGTCGCCATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCA
CCTCGGGGAGTTGACAGTGGAGGAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAAT
CCAGTACACAGATAGAGACGGGCAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCA
CAGATACCTGGTGACCCTGTATGGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAA
GCCTTCAGAACCTCCCACCGCAACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCT
CAGCCTGTCCTGGACAGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGT
GCCAGGGCACGAGGAAGGGGTCACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCG
CATGGGCCCTGTGTCTGTCGTCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGC
TGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGA
CTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCT
GGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCC
CGAAGAGGAGTCCCCTGATGCTCCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACA
CGAGGATGGGGTCACCATCTCGGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCC
CGTGTCTGCTGTTGGTTTAACTGCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAA
GCCTCGCCTGGAGGAGCTGACCGTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTT
CCTGGTCCAGTACAAGAATGGGGATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCC
AGACAACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGA
AGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTC
CCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCA
GGTGGTGCGTGTTGGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCA
CGAGGGGCGGCGCGTGGGCCCGGTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGG
CACAGAGGCCCCAGGGCCCCCCGAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGAC
CGTCCCCCAGGGCCGCTTTGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAG
CAAGGTCACTGTGAGGGGCCTGGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTC
TGCCGTGGGCGTCACAGAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGA
GCTGACCATGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAG
GAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAA
GATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCC
CACGGAACTCAGCACTGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAG
CCTCTCCTGGACCATCCCCCAGGGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAG
GGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGT
GGGCCCGGTGTCCACCGTGGGTGTGACAGCTCCAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAA
CAAGCCTCGCCTCGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCA
CTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGA
GCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGA
GGAAGAAACTCCCGCCCCCACAGAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATC
CTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCC
CCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCT
CCACGAGGGGCAGCGCGTGGGCCCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCAT
GACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCC
CGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGT
CACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCAT
TGGGGTGACGGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGAC
AGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAG
GGACGGGCAGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCA
TCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCC
CCGCCTGGGGGAGCTGGCGGTGGCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCT
GGTACAGTACAGGGACGCGCAGGGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGC
CCGCAAGTACAAGTTCCTGCTCTTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGA
TTCACTCCCTCTGGTTGATACCCACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTC
TCAGCATCACGATGACCTTGAATAAAAATTGCACACACTCAGTGCAGCAATATATTACCAGCAAGAATAAAAAAGAAATCCATATCTTAA
AGAAACAGCTTTCAAGTGCCTTTCTGCAGTTTTTCAGGAGCGCAAGATAGATTTGGAATAGGAATAAGCTCTAGTTCTTAACAACCGACA
CTCCTACAAGATTTAGAAAAAAGTTTACAACATAATCTAGTTTACAGAAAAATCTTGTGCTAGAATACTTTTTAAAAGGTATTTTGAATA

>In-frame_TNXB_ENST00000375244_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_10697nt
TCCTCCCCTTCTCCTCCCCTGCTCGCTGCAGACTCCCTCCTCACTGTCGCTGCCGAGATCCACAGTCGGTTGTGGCTCAGCCCCTGTTGC
AGGGGACAAGTGAGGGAGACTTCCCTGTCCTGCCCTGAGACGCCGCCCTCCCGGGGTTGGGGACAGAGCAGGTGCAGAGGCACTGCAGCT
GCTCGGTTGCCCAGCCTCCTGAATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGC
AGGCCCCTTCTCTTCACGGTCCAATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGG
AAGCCCCTCTTCTCAGCTTTACGAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCAC
TGGCTGTGGCTGTCCCCCAGGCACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTT
GGTGAAGGGGCTCAAGGAACAGTGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTG
CAGTCTCCATGGTGTGTTTGATCTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGC
TGAGATCCCTCCCTCTTCCCCACCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGT
GTGCTTTCCCGGCTACACTGGCCCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTG
TGTGTGCCGGGCAGGCTTCTCAGGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCG
CTGCGTGTGTGACCCAGGCTACACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGG
GCGCTGCGTGTGTAACCCCGGCTACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGA
CGGGCGCTGCGTGTGTGACCCCGGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGT
GGACGGCCGCTGCGTGTGCTGGCCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTG
CGAGGACGGCGAATGCATTTGCGACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCG
CTGCGAGGACGGCCGCTGCGTGTGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGG
GCGCTGCGAGAACGGCGTGTGTGTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCG
GGGCCGCTGTGAGAGTGGCCGCTGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGG
GCGCGGGCGCTGCGTGGATGGCCGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCG
TGGGCACGGCCTTTGCGAGGATGGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTG
CCGAGGCCGCGGCCAGTGCCTAGATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGA
CTGCAGCCAGCACGGCGTGTGCCAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTC
CAACTGCCACGGGAGGGGCCGCTGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCC
GGCTGACTGCCGGGGACGTGGGCGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCC
TCCAGCCAGCGCCTGCCCTGGAGGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGA
CTGTGCCATCCAGACATGCCCAGGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGA
AGACTGCGGAGAAGAGGTGCCAACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCC
TGGCCCCGTGGATGCCTATGAAATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTC
AGCCTATGACCAGAGAGGACTGGCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTC
CAAGACCATCACCACCATGATCGATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCC
CCAGGCTGAGGTGGACCGATTTGTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGAC
GCTGCTGACTGACCTGATGCCAGGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAG
GGCCAACACAGGGTCCTCACCCTTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGC
TCCTCTCCTGCAGCAGCGCCCCCAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGC
CCAGCCTGACACCTTTGCCTACTTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCG
CCAGGCTCTGGTGCCTCCACCCCCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCAT
CATCTACCAAGGCATTATGGACAAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAG
GACCTCCGACTCCTTGCTCCTGCGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCC
CCAGGTGGTGCCCGTGGAAGGACCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTT
TGTTGGCAAGAAGAGGCATGGTCCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGG
AAACCTGTGGGTGACAGACCCTACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTA
CAGGGACAGGGATGGACGGCCCCAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTA
CAGATTCACTCTGTTTGGAATTGCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCC
CCCCCGCCCTGAGTTCCTGGAGCAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGT
GGCCCAGGGCCCCTTCGACTCATTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGA
GGTTACTGTCCCCGGCCTGGATCCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGT
GGTGGCCAAGACTGCTCCTCAGGAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCC
GCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCAC
CGTGCAGTACAAGGACAGGGATGGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGG
GCACAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGA
AGAGACCCCTCCAGCCACTGAGTCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGA
CCAGCGAGAGGTCACAGTCTACAACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCC
CCTGTCTGTGGTCATCGTGACGGCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCT
GACAGTGACGGATATAACCCCTGACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGA
CAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTT
CCTGCTCTTTGGGATCCAGGATGGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGC
CCCACCCCGCCTTGGGGAGCTGTGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTC
TTTTGTGGTCCAGTTCAAGGACAAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGC
CGGCCGCAAGTACAGATTCCTCCTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAG
TGCTATGGATGATACTGGAACAAAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGG
CCTCTCCTGGACAGTCCCTGAGGGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGA
GGGCAGCCTCAGGGAGGTCAGCGTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGT
GGGCCCCATCTCGGCCGTCGCCATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCA
CCTCGGGGAGTTGACAGTGGAGGAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAAT
CCAGTACACAGATAGAGACGGGCAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCA
CAGATACCTGGTGACCCTGTATGGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAA
GCCTTCAGAACCTCCCACCGCAACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCT
CAGCCTGTCCTGGACAGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGT
GCCAGGGCACGAGGAAGGGGTCACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCG
CATGGGCCCTGTGTCTGTCGTCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGC
TGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGA
CTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCT
GGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCC
CGAAGAGGAGTCCCCTGATGCTCCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACA
CGAGGATGGGGTCACCATCTCGGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCC
CGTGTCTGCTGTTGGTTTAACTGCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAA
GCCTCGCCTGGAGGAGCTGACCGTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTT
CCTGGTCCAGTACAAGAATGGGGATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCC
AGACAACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGA
AGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTC
CCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCA
GGTGGTGCGTGTTGGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCA
CGAGGGGCGGCGCGTGGGCCCGGTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGG
CACAGAGGCCCCAGGGCCCCCCGAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGAC
CGTCCCCCAGGGCCGCTTTGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAG
CAAGGTCACTGTGAGGGGCCTGGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTC
TGCCGTGGGCGTCACAGAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGA
GCTGACCATGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAG
GAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAA
GATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCC
CACGGAACTCAGCACTGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAG
CCTCTCCTGGACCATCCCCCAGGGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAG
GGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGT
GGGCCCGGTGTCCACCGTGGGTGTGACAGCTCCAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAA
CAAGCCTCGCCTCGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCA
CTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGA
GCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGA
GGAAGAAACTCCCGCCCCCACAGAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATC
CTCCCCTGACTCGCTGAGCCTCTCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCC
CCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCT
CCACGAGGGGCAGCGCGTGGGCCCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCAT
GACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCC
CGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGT
CACCATCTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCAT
TGGGGTGACGGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGAC
AGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAG
GGACGGGCAGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCA
TCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCC
CCGCCTGGGGGAGCTGGCGGTGGCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCT
GGTACAGTACAGGGACGCGCAGGGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGC
CCGCAAGTACAAGTTCCTGCTCTTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGA
TTCACTCCCTCTGGTTGATACCCACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTC
TCAGCATCACGATGACCTTGAATAAAAATTGCACACACTCAGTGCAGCAATATATTACCAGCAAGAATAAAAAAGAAATCCATATCTTAA
AGAAACAGCTTTCAAGTGCCTTTCTGCAGTTTTTCAGGAGCGCAAGATAGATTTGGAATAGGAATAAGCTCTAGTTCTTAACAACCGACA
CTCCTACAAGATTTAGAAAAAAGTTTACAACATAATCTAGTTTACAGAAAAATCTTGTGCTAGAATACTTTTTAAAAGGTATTTTGAATA

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000544301_chr10_17278293_+_10683nt
TCCTCCCCTTCTCCTCCCCTGCTCGCTGCAGACTCCCTCCTCACTGTCGCTGCCGAGATCCACAGTCGGTTGTGGCTCAGCCCCTGTTGC
AGGGGACAAGTGAGGGAGACTTCCCTGTCCTGCCCTGAGACGCCGCCCTCCCGGGGTTGGGGACAGAGCAGGTGCAGAGGCACTGCAGCT
GCTCGGTTGCCCAGCCTCCTGAATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGC
AGGCCCCTTCTCTTCACGGTCCAATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGG
AAGCCCCTCTTCTCAGCTTTACGAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCAC
TGGCTGTGGCTGTCCCCCAGGCACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTT
GGTGAAGGGGCTCAAGGAACAGTGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTG
CAGTCTCCATGGTGTGTTTGATCTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGC
TGAGATCCCTCCCTCTTCCCCACCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGT
GTGCTTTCCCGGCTACACTGGCCCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTG
TGTGTGCCGGGCAGGCTTCTCAGGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCG
CTGCGTGTGTGACCCAGGCTACACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGG
GCGCTGCGTGTGTAACCCCGGCTACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGA
CGGGCGCTGCGTGTGTGACCCCGGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGT
GGACGGCCGCTGCGTGTGCTGGCCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTG
CGAGGACGGCGAATGCATTTGCGACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCG
CTGCGAGGACGGCCGCTGCGTGTGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGG
GCGCTGCGAGAACGGCGTGTGTGTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCG
GGGCCGCTGTGAGAGTGGCCGCTGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGG
GCGCGGGCGCTGCGTGGATGGCCGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCG
TGGGCACGGCCTTTGCGAGGATGGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTG
CCGAGGCCGCGGCCAGTGCCTAGATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGA
CTGCAGCCAGCACGGCGTGTGCCAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTC
CAACTGCCACGGGAGGGGCCGCTGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCC
GGCTGACTGCCGGGGACGTGGGCGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCC
TCCAGCCAGCGCCTGCCCTGGAGGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGA
CTGTGCCATCCAGACATGCCCAGGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGA
AGACTGCGGAGAAGAGGTGCCAACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCC
TGGCCCCGTGGATGCCTATGAAATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTC
AGCCTATGACCAGAGAGGACTGGCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTC
CAAGACCATCACCACCATGATCGATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCC
CCAGGCTGAGGTGGACCGATTTGTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGAC
GCTGCTGACTGACCTGATGCCAGGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAG
GGCCAACACAGGGTCCTCACCCTTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGC
TCCTCTCCTGCAGCAGCGCCCCCAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGC
CCAGCCTGACACCTTTGCCTACTTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCG
CCAGGCTCTGGTGCCTCCACCCCCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCAT
CATCTACCAAGGCATTATGGACAAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAG
GACCTCCGACTCCTTGCTCCTGCGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCC
CCAGGTGGTGCCCGTGGAAGGACCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTT
TGTTGGCAAGAAGAGGCATGGTCCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGG
AAACCTGTGGGTGACAGACCCTACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTA
CAGGGACAGGGATGGACGGCCCCAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTA
CAGATTCACTCTGTTTGGAATTGCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCC
CCCCCGCCCTGAGTTCCTGGAGCAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGT
GGCCCAGGGCCCCTTCGACTCATTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGA
GGTTACTGTCCCCGGCCTGGATCCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGT
GGTGGCCAAGACTGCTCCTCAGGAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCC
GCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCAC
CGTGCAGTACAAGGACAGGGATGGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGG
GCACAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGA
AGAGACCCCTCCAGCCACTGAGTCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGA
CCAGCGAGAGGTCACAGTCTACAACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCC
CCTGTCTGTGGTCATCGTGACGGCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCT
GACAGTGACGGATATAACCCCTGACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGA
CAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTT
CCTGCTCTTTGGGATCCAGGATGGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGC
CCCACCCCGCCTTGGGGAGCTGTGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTC
TTTTGTGGTCCAGTTCAAGGACAAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGC
CGGCCGCAAGTACAGATTCCTCCTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAG
TGCTATGGATGATACTGGAACAAAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGG
CCTCTCCTGGACAGTCCCTGAGGGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGA
GGGCAGCCTCAGGGAGGTCAGCGTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGT
GGGCCCCATCTCGGCCGTCGCCATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCA
CCTCGGGGAGTTGACAGTGGAGGAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAAT
CCAGTACACAGATAGAGACGGGCAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCA
CAGATACCTGGTGACCCTGTATGGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAA
GCCTTCAGAACCTCCCACCGCAACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCT
CAGCCTGTCCTGGACAGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGT
GCCAGGGCACGAGGAAGGGGTCACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCG
CATGGGCCCTGTGTCTGTCGTCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGC
TGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGA
CTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCT
GGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCC
CGAAGAGGAGTCCCCTGATGCTCCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACA
CGAGGATGGGGTCACCATCTCGGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCC
CGTGTCTGCTGTTGGTTTAACTGCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAA
GCCTCGCCTGGAGGAGCTGACCGTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTT
CCTGGTCCAGTACAAGAATGGGGATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCC
AGACAACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGA
AGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTC
CCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCA
GGTGGTGCGTGTTGGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCA
CGAGGGGCGGCGCGTGGGCCCGGTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGG
CACAGAGGCCCCAGGGCCCCCCGAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGAC
CGTCCCCCAGGGCCGCTTTGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAG
CAAGGTCACTGTGAGGGGCCTGGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTC
TGCCGTGGGCGTCACAGAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGA
GCTGACCATGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAG
GAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAA
GATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCC
CACGGAACTCAGCACTGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAG
CCTCTCCTGGACCATCCCCCAGGGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAG
GGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGT
GGGCCCGGTGTCCACCGTGGGTGTGACAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCC
TCGCCTCGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCT
GGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGA
CCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGA
AACTCCCGCCCCCACAGAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCC
TGACTCGCTGAGCCTCTCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGT
GGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGA
GGGGCAGCGCGTGGGCCCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCC
TGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGG
CCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCAT
CTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGT
GACGGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGAC
AGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGG
GCAGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTA
CGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCT
GGGGGAGCTGGCGGTGGCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACA
GTACAGGGACGCGCAGGGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAA
GTACAAGTTCCTGCTCTTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACT
CCCTCTGGTTGATACCCACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTCTCAGCA
TCACGATGACCTTGAATAAAAATTGCACACACTCAGTGCAGCAATATATTACCAGCAAGAATAAAAAAGAAATCCATATCTTAAAGAAAC
AGCTTTCAAGTGCCTTTCTGCAGTTTTTCAGGAGCGCAAGATAGATTTGGAATAGGAATAAGCTCTAGTTCTTAACAACCGACACTCCTA
CAAGATTTAGAAAAAAGTTTACAACATAATCTAGTTTACAGAAAAATCTTGTGCTAGAATACTTTTTAAAAGGTATTTTGAATACCATTA

>In-frame_TNXB_ENST00000375247_chr6_32016140_-_VIM_ENST00000224237_chr10_17278293_+_10691nt
TCCTCCCCTTCTCCTCCCCTGCTCGCTGCAGACTCCCTCCTCACTGTCGCTGCCGAGATCCACAGTCGGTTGTGGCTCAGCCCCTGTTGC
AGGGGACAAGTGAGGGAGACTTCCCTGTCCTGCCCTGAGACGCCGCCCTCCCGGGGTTGGGGACAGAGCAGGTGCAGAGGCACTGCAGCT
GCTCGGTTGCCCAGCCTCCTGAATGATGCCAGCCCAGTATGCTCTAACCTCCAGCCTGGTTCTCCTGGTGCTGCTGAGCACAGCCAGAGC
AGGCCCCTTCTCTTCACGGTCCAATGTGACACTGCCAGCCCCCCGGCCCCCTCCCCAGCCAGGGGGCCACACAGTGGGGGCTGGAGTGGG
AAGCCCCTCTTCTCAGCTTTACGAGCACACAGTGGAAGGAGGGGAGAAGCAGGTGGTATTCACCCACCGCATTAACCTGCCCCCTTCCAC
TGGCTGTGGCTGTCCCCCAGGCACCGAGCCCCCAGTCCTTGCTTCAGAGGTACAGGCCCTGAGGGTCCGTCTAGAGATCCTGGAGGAGTT
GGTGAAGGGGCTCAAGGAACAGTGCACTGGGGGATGTTGTCCTGCCTCTGCCCAAGCTGGCACAGGTCAGACAGATGTGCGGACCCTCTG
CAGTCTCCATGGTGTGTTTGATCTGAGCCGCTGCACCTGTTCCTGTGAGCCAGGCTGGGGTGGGCCCACCTGCTCAGACCCCACAGATGC
TGAGATCCCTCCCTCTTCCCCACCCTCAGCCTCGGGGTCCTGCCCAGATGACTGCAATGATCAGGGTCGCTGTGTCCGTGGTCGTTGCGT
GTGCTTTCCCGGCTACACTGGCCCCAGCTGTGGCTGGCCATCCTGTCCCGGGGACTGCCAAGGCCGTGGGCGCTGCGTGCAGGGCGTGTG
TGTGTGCCGGGCAGGCTTCTCAGGCCCCGACTGCAGCCAGCGCTCCTGCCCTCGAGGTTGCAGCCAGAGGGGACGCTGTGAGGGTGGGCG
CTGCGTGTGTGACCCAGGCTACACTGGTGACGACTGTGGCATGAGGAGCTGCCCTCGCGGTTGCAGTCAGAGGGGGCGCTGTGAGAATGG
GCGCTGCGTGTGTAACCCCGGCTACACTGGCGAGGACTGTGGGGTGAGGAGCTGCCCTCGGGGCTGCAGCCAGCGGGGACGCTGCAAGGA
CGGGCGCTGCGTGTGTGACCCCGGCTACACTGGCGAGGACTGTGGTACGCGGAGCTGCCCCTGGGACTGTGGCGAGGGCGGGCGCTGCGT
GGACGGCCGCTGCGTGTGCTGGCCCGGGTACACAGGCGAGGACTGCAGCACGCGGACATGTCCGAGGGACTGCCGGGGCCGCGGGCGCTG
CGAGGACGGCGAATGCATTTGCGACACGGGCTACAGCGGGGACGACTGCGGCGTGCGCAGCTGCCCTGGCGACTGCAACCAAAGGGGCCG
CTGCGAGGACGGCCGCTGCGTGTGCTGGCCGGGGTACACTGGAACCGATTGCGGCTCGCGCGCCTGCCCACGCGACTGTAGAGGTCGCGG
GCGCTGCGAGAACGGCGTGTGTGTTTGCAATGCGGGCTACAGCGGCGAGGACTGCGGTGTGCGCAGCTGTCCTGGGGACTGTCGTGGCCG
GGGCCGCTGTGAGAGTGGCCGCTGCATGTGTTGGCCGGGGTACACAGGCCGGGACTGCGGCACGCGCGCCTGTCCTGGCGACTGTCGCGG
GCGCGGGCGCTGCGTGGATGGCCGCTGCGTGTGCAACCCGGGCTTCACCGGTGAGGACTGTGGGAGCCGTCGCTGTCCCGGGGACTGCCG
TGGGCACGGCCTTTGCGAGGATGGCGTGTGCGTGTGTGACGCAGGCTACTCAGGGGAAGACTGCAGCACGCGCAGCTGCCCCGGGGGCTG
CCGAGGCCGCGGCCAGTGCCTAGATGGGCGGTGTGTGTGCGAGGACGGCTACTCTGGCGAGGATTGCGGTGTGAGGCAGTGCCCGAATGA
CTGCAGCCAGCACGGCGTGTGCCAGGACGGTGTGTGCATCTGTTGGGAAGGCTACGTGAGTGAGGACTGCAGCATCCGCACCTGCCCCTC
CAACTGCCACGGGAGGGGCCGCTGTGAGGAAGGGCGCTGCCTGTGCGACCCAGGCTACACCGGCCCTACCTGTGCCACCCGCATGTGCCC
GGCTGACTGCCGGGGACGTGGGCGGTGTGTGCAAGGAGTGTGCCTGTGCCACGTGGGCTATGGCGGTGAGGACTGCGGGCAGGAAGAGCC
TCCAGCCAGCGCCTGCCCTGGAGGCTGCGGGCCCCGGGAACTGTGCCGGGCAGGCCAGTGTGTGTGTGTAGAGGGCTTCCGAGGCCCTGA
CTGTGCCATCCAGACATGCCCAGGGGACTGCCGTGGCCGAGGAGAGTGTCACGATGGCAGCTGTGTCTGCAAAGATGGGTATGCTGGCGA
AGACTGCGGAGAAGAGGTGCCAACCATTGAGGGCATGAGGATGCATCTCTTGGAGGAGACAACAGTTCGGACAGAGTGGACCCCGGCTCC
TGGCCCCGTGGATGCCTATGAAATTCAGTTCATCCCCACGACAGAGGGGGCGAGCCCCCCATTCACAGCACGGGTTCCAAGCTCTGCCTC
AGCCTATGACCAGAGAGGACTGGCCCCTGGACAGGAGTACCAGGTCACTGTCCGAGCCCTTCGAGGGACCAGCTGGGGCCTTCCTGCCTC
CAAGACCATCACCACCATGATCGATGGGCCCCAGGACCTCCGAGTGGTGGCTGTGACACCGACAACACTGGAGCTTGGCTGGCTGCGTCC
CCAGGCTGAGGTGGACCGATTTGTGGTGTCCTACGTCAGTGCCGGCAACCAGAGGGTGAGGCTGGAAGTGCCCCCTGAAGCAGACGGGAC
GCTGCTGACTGACCTGATGCCAGGCGTAGAATATGTGGTGACTGTCACAGCGGAGCGGGGCCGGGCAGTCAGCTACCCAGCTTCTGTCAG
GGCCAACACAGGGTCCTCACCCTTGGGCCTCTTGGGGACTACCGATGAGCCTCCTCCCTCAGGCCCCTCGACGACGCAAGGGGCCCAGGC
TCCTCTCCTGCAGCAGCGCCCCCAGGAGCTGGGAGAGTTGAGGGTGCTGGGCAGAGATGAGACAGGGCGCCTCCGTGTGGTCTGGACCGC
CCAGCCTGACACCTTTGCCTACTTCCAACTGCGCATGCGGGTGCCCGAGGGGCCGGGGGCACATGAGGAAGTGCTGCCAGGGGACGTCCG
CCAGGCTCTGGTGCCTCCACCCCCTCCTGGAACCCCGTATGAGCTGTCACTTCATGGGGTCCCTCCTGGGGGCAAGCCCTCTGACCCCAT
CATCTACCAAGGCATTATGGACAAGGATGAGGAGAAGCCTGGGAAGTCCTCAGGCCCACCACGCCTGGGTGAGCTGACGGTGACAGACAG
GACCTCCGACTCCTTGCTCCTGCGCTGGACGGTCCCCGAGGGCGAGTTTGACTCCTTCGTGATCCAGTACAAAGACAGGGACGGGCAGCC
CCAGGTGGTGCCCGTGGAAGGACCCCAGCGCTCGGCCGTCATCACCTCCCTGGATCCTGGCCGCAAGTACAAATTTGTCCTGTATGGGTT
TGTTGGCAAGAAGAGGCATGGTCCGCTGGTGGCTGAAGCCAAGATCTTGCCTCAGAGTGACCCAAGTCCAGGGACTCCACCCCACCTGGG
AAACCTGTGGGTGACAGACCCTACCCCAGATTCACTGCACCTCTCCTGGACTGTCCCTGAGGGCCAGTTTGACACCTTCATGGTCCAGTA
CAGGGACAGGGATGGACGGCCCCAGGTGGTACCTGTGGAAGGGCCCGAGCGTTCATTTGTTGTCTCCTCACTGGACCCTGACCACAAGTA
CAGATTCACTCTGTTTGGAATTGCGAACAAGAAGCGGTATGGCCCCCTCACGGCCGATGGCACCACTGCTCCAGAGAGGAAAGAGGAGCC
CCCCCGCCCTGAGTTCCTGGAGCAGCCCCTCCTGGGGGAACTGACAGTGACCGGCGTGACCCCAGACTCCTTGCGTCTCTCATGGACAGT
GGCCCAGGGCCCCTTCGACTCATTCATGGTCCAGTACAAGGATGCACAGGGGCAGCCCCAGGCAGTGCCTGTTGCGGGGGATGAGAATGA
GGTTACTGTCCCCGGCCTGGATCCCGACCGGAAGTATAAGATGAACCTCTACGGGCTTCGTGGCAGGCAGCGTGTGGGGCCCGAGTCTGT
GGTGGCCAAGACTGCTCCTCAGGAGGATGTGGACGAGACCCCCAGCCCCACAGAACTGGGCACGGAGGCCCCGGAGTCCCCCGAGGAGCC
GCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGATTCGCTGAGCCTCTTCTGGACCGTCCCCCAGGGCAGCTTCGACTCTTTCAC
CGTGCAGTACAAGGACAGGGATGGGCGGCCCCGGGCGGTGCGTGTTGGGGGCAAGGAGAGTGAGGTCACCGTGGGAGGCCTAGAGCCCGG
GCACAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCAGCGCGTGGGCCCGGTGTCCGCCGTGGGCGTGACAGCCCCACAACAAGA
AGAGACCCCTCCAGCCACTGAGTCCCCGCTGGAGCCACGCCTAGGAGAGCTGACAGTGACAGATGTGACCCCCAACTCTGTGGGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACTCCTTCATAGTCCAGTACAAGGACAAGGACGGGCAGCCCCAGGTGGTGCCGGTGGCGGCAGA
CCAGCGAGAGGTCACAGTCTACAACCTGGAGCCTGAGAGAAAATATAAGATGAACATGTATGGACTACATGATGGGCAACGCATGGGCCC
CCTGTCTGTGGTCATCGTGACGGCTCCCCTCCCACCAGCCCCAGCCACAGAGGCCTCCAAGCCTCCCCTGGAGCCACGCCTAGGGGAGCT
GACAGTGACGGATATAACCCCTGACTCTGTGGGCCTCTCATGGACAGTCCCTGAGGGTGAATTCGACTCCTTTGTGGTTCAGTACAAGGA
CAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGCTGCAGATCAGCGGGAGGTCACTATCCCTGACCTGGAACCCTCCCGCAAGTACAAGTT
CCTGCTCTTTGGGATCCAGGATGGGAAACGACGCAGCCCAGTCTCTGTGGAGGCAAAGACGGTTGCCCGAGGTGACGCCAGCCCAGGGGC
CCCACCCCGCCTTGGGGAGCTGTGGGTGACAGACCCCACCCCAGACTCACTGCGCCTCTCCTGGACGGTTCCTGAGGGCCAGTTCGACTC
TTTTGTGGTCCAGTTCAAGGACAAAGACGGGCCCCAGGTGGTGCCCGTGGAGGGCCATGAGCGCTCTGTCACTGTCACCCCTCTGGATGC
CGGCCGCAAGTACAGATTCCTCCTCTATGGCCTCCTGGGCAAGAAGCGCCATGGCCCTCTCACTGCCGACGGCACCACGGAAGCCCGGAG
TGCTATGGATGATACTGGAACAAAGCGTCCCCCAAAACCCCGTCTGGGGGAGGAGCTGCAGGTGACCACCGTGACCCAGAACTCCGTGGG
CCTCTCCTGGACAGTCCCTGAGGGCCAGTTTGACTCCTTTGTGGTCCAGTACAAAGACAGGGACGGGCAGCCCCAGGTGGTGCCCGTGGA
GGGCAGCCTCAGGGAGGTCAGCGTGCCGGGCCTGGACCCTGCCCACAGGTACAAGCTGCTGCTCTACGGGCTGCACCACGGCAAGCGTGT
GGGCCCCATCTCGGCCGTCGCCATTACTGCCGGCAGGGAAGAAACGGAAACTGAGACCACGGCCCCGACCCCTCCAGCGCCTGAGCCCCA
CCTCGGGGAGTTGACAGTGGAGGAGGCCACGTCACACACCCTGCATCTCTCCTGGATGGTGACTGAGGGAGAATTTGACTCCTTCGAAAT
CCAGTACACAGATAGAGACGGGCAACTCCAAATGGTCCGCATAGGAGGTGACCGGAATGACATCACCCTCTCTGGCCTGGAATCCGACCA
CAGATACCTGGTGACCCTGTATGGTTTCAGTGATGGGAAGCATGTAGGTCCTGTCCATGTCGAGGCCCTGACAGTCCCGGAGGAGGAGAA
GCCTTCAGAACCTCCCACCGCAACCCCCGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCT
CAGCCTGTCCTGGACAGTTCCCGAGGGACAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGAGATGGGCAGCCCAAGGCAGTGAGGGT
GCCAGGGCACGAGGAAGGGGTCACCATCTCGGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCG
CATGGGCCCTGTGTCTGTCGTCGGGGTGACAGCTGCAGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCGC
TGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGA
CTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGGTGCGTGTTGGGGGCGAGGAGAGTGAAGTCACCGTGGGGGGCCT
GGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCGTGGGCCCAGTGTCTGCTGTGGGCGTCACGGCCCC
CGAAGAGGAGTCCCCTGATGCTCCTCTTGCAAAGCTGCGCCTAGGGCAGATGACAGTGAGAGACATCACCTCCGACTCCCTCAGCCTCTC
CTGGACAGTCCCCGAGGGCCAGTTTGACCATTTCTTGGTCCAGTTTAAGAATGGGGACGGGCAGCCCAAGGCGGTGCGGGTGCCGGGACA
CGAGGATGGGGTCACCATCTCGGGCCTGGAGCCAGACCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCC
CGTGTCTGCTGTTGGTTTAACTGCCCCAGGAAAGGATGAAGAAATGGCCCCAGCCTCGACAGAACCTCCCACCCCTGAACCCCCCATCAA
GCCTCGCCTGGAGGAGCTGACCGTGACAGATGCGACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGACAGTTTGACCACTT
CCTGGTCCAGTACAAGAATGGGGATGGGCAGCCCAAGGCAACACGGGTGCCAGGACATGAGGACAGGGTCACCATCTCCGGCCTGGAGCC
AGACAACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGTGTGGGCCCCGTGTCTGCCATCGGGGTGACAGCTGCAGAGGA
AGAGACCCCCAGCCCCACAGAACCCAGCATGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTAACAGTGACAGGATCCTC
CCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCA
GGTGGTGCGTGTTGGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCTGGGCGCAAATACAAGATGCACCTGTATGGCCTCCA
CGAGGGGCGGCGCGTGGGCCCGGTGTCCACCGTGGGCGTGACTGCCCCACAAGAGGATGTGGACGAGACCCCCAGCCCTACAGAACCAGG
CACAGAGGCCCCAGGGCCCCCCGAGGAGCCTCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAGCCTTTCCTGGAC
CGTCCCCCAGGGCCGCTTTGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGCGGTGCGTGTTGGGGGCCAGGAGAG
CAAGGTCACTGTGAGGGGCCTGGAGCCTGGGCGCAAGTACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGCCTGGGCCCGGTGTC
TGCCGTGGGCGTCACAGAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCCTGAGCCCCCCATCAAGCCTCGCCTGGGGGA
GCTGACCATGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGACGGTTCCCGAGGGCCAGTTTGACCACTTCCTGGTCCAGTACAG
GAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGACCATAAATACAA
GATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACGGCTGCAGAGGAAGAGACCCCCAGCCC
CACGGAACTCAGCACTGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCCTGACTCGCTGAG
CCTCTCCTGGACCATCCCCCAGGGCCACTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGTGATGCGTGTCAG
GGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCACCTGTACGGCCTCCACGAGGGGCGGCGTGT
GGGCCCGGTGTCCACCGTGGGTGTGACAGAGGATGAAGCAGAGACCACCCAAGCAGTGCCCACCACAACCCCTGAGCCCCCCAACAAGCC
TCGCCTCGGGGAGCTGACCGTGACAGATGCCACCCCTGACTCCCTCAGCCTGTCCTGGATGGTCCCCGAGGGCCAGTTTGACCACTTCCT
GGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGTGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCATCTCAGGCCTGGAGCCAGA
CCACAAGTACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTGGGCCCCATCTCTGTCATTGGGGTGACAGCTGCAGAGGAAGA
AACTCCCGCCCCCACAGAACCCAGCACGGAGGCCCCGGAGCCCCCTGAGGAGCCGCTCCTGGGGGAGCTGACAGTGACAGGATCCTCCCC
TGACTCGCTGAGCCTCTCCTGGACCATCCCCCAGGGCCGCTTCGACTCCTTCACTGTGCAGTACAAGGACAGGGACGGGCGGCCCCAGGT
GGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGTGCAAATACAAGATGCACCTGTACGGCCTCCACGA
GGGGCAGCGCGTGGGCCCAGTGTCCGCTGTGGGTGTGACAGCTCCAAAGGATGAAGCCGAGACCACCCAAGCAGTGCCTACCATGACCCC
TGAGCCCCCCATCAAGCCTCGCCTGGGGGAGCTGACCGTGACAGATGCCACCCCCGACTCCCTCAGCCTGTCCTGGATGGTTCCCGAGGG
CCAGTTTGACCACTTCCTGGTCCAGTACAGGAATGGGGATGGGCAGCCCAAGGCGGTGCGGGTGCCGGGGCACGAGGACGGGGTCACCAT
CTCAGGCCTGGAGCCAGACCATAAATACAAGATGAACCTGTACGGCTTCCACGGTGGCCAGCGCGTAGGCCCTGTGTCTGCCATTGGGGT
GACGGAGGAAGAGACCCCCAGCCCCACAGAACCCAGCACTGAGGCCCCGGAGGCCCCTGAGGAGCCGCTCCTGGGGGAGTTGACAGTGAC
AGGATCCTCCCCTGACTCGCTGAGCCTCTCCTGGACCGTCCCCCAGGGCCGCTTCGACTCCTTCACCGTGCAGTACAAGGACAGGGACGG
GCAGCCCCAGGTGGTGCGTGTCAGGGGCGAGGAGAGCGAGGTCACCGTGGGGGGCCTGGAGCCCGGGCGCAAATACAAGATGCATCTGTA
CGGCCTCCACGAGGGGCAGCGCGTGGGCCCAGTGTCCACCGTGGGCATCACGGCGCCCCTGCCCACACCACTGCCGGTGGAGCCCCGCCT
GGGGGAGCTGGCGGTGGCGGCCGTGACCTCGGACTCAGTGGGCCTCTCATGGACGGTGGCCCAGGGCCCCTTTGACTCCTTCCTGGTACA
GTACAGGGACGCGCAGGGGCAGCCCCAGGCAGTGCCTGTGAGCGGAGACCTCCGAGCGGTCGCCGTCTCGGGGCTGGACCCGGCCCGCAA
GTACAAGTTCCTGCTCTTTGGACTCCAGAATGGGAAACGCCACGGCCCAGTCCCTGTGGAGGCCAGGACCGAAACTAATCTGGATTCACT
CCCTCTGGTTGATACCCACTCAAAAAGGACACTTCTGATTAAGACGGTTGAAACTAGAGATGGACAGGTTATCAACGAAACTTCTCAGCA
TCACGATGACCTTGAATAAAAATTGCACACACTCAGTGCAGCAATATATTACCAGCAAGAATAAAAAAGAAATCCATATCTTAAAGAAAC
AGCTTTCAAGTGCCTTTCTGCAGTTTTTCAGGAGCGCAAGATAGATTTGGAATAGGAATAAGCTCTAGTTCTTAACAACCGACACTCCTA
CAAGATTTAGAAAAAAGTTTACAACATAATCTAGTTTACAGAAAAATCTTGTGCTAGAATACTTTTTAAAAGGTATTTTGAATACCATTA


Top

FusionGenePPI for TNXB_VIM


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TNXBBANP, FIGNL1VIMALS2CR11, KAT7, TCHP, ABLIM1, NIF3L1, NOC4L, FAM107A, KRT20, GFAP, KIAA0408, APIP, TUBGCP4, PDLIM1, PSMA1, GOPC, RIBC2, DCTN1, RAB8B, BRD1, DPPA4, IVNS1ABP, SH3YL1, SLC27A6, YAE1D1, FABP4, HABP4, TRIOBP, LOR, MAFG, DIS3L2, NFATC2, PSME1, SDCCAG3, STX1A, SYN1, TNFRSF14, TRIM28, VIM, XRCC4, SRRT, BHLHE40, CASP8, CREB1, HMG20B, KIF15, MAN2A2, MRPL44, CRCT1, SERBP1, RABAC1, RAD51, SIRT6, SUMO3, SUMO2, TTR, LRIF1, FUBP1, PUF60, SLC25A6, ATN1, YWHAZ, OSBP2, BFSP1, TXN, PKN1, PKP1, DSP, MEN1, CDH5, MICAL1, UPP1, UPP2, PLEC, NME2, ACTA1, SPTAN1, LMNB1, PPL, MGMT, SRRM2, HDAC1, TOX4, CBL, RYK, CD4, TJP1, YWHAQ, SPG20, YWHAG, GSK3B, UROD, FAM118B, CDKN1A, TNNT1, ANKRD35, APLP1, KARS, DGCR14, CRMP1, SH3GL1, PRPH, NR1H2, ANXA7, TSC22D1, GADD45A, TRIM16, ARRB1, ARRB2, SP1, NOD2, ISG15, FBXO25, CUL3, CDK2, CUL1, COPS5, CHD3, NEFL, SH3GL3, UTP14A, SETDB1, PSMD7, ZHX1, PPHLN1, PIAS4, HAP1, RBM48, ING5, ARMCX2, MYOC, LRRK2, AKT1, AKT2, RAD23B, RAD23A, APP, THOC3, THOC5, URGCP, PSMA2, PDIA3, RRP9, THOC2, YEATS4, THOC7, PSMB5, PSMA8, VPS33A, RCC2, UBR4, ZYX, PSMB2, NUDT21, CCT6A, TSGA10, EIF4A3, MAGOH, HNF1A, SMURF1, VCP, FN1, VCAM1, HTRA2, ATF2, ITGA4, SVIL, CAPN1, PAN2, BAG3, PINK1, TXN2, POLR1C, GRB2, RPA1, TAB2, CASP3, CASP7, FBXO6, PARK2, EEF1D, FOXK1, COPS8, SERPINH1, ASB2, ASB9, ASB15, ASB16, STAU1, SPRTN, TRIM68, PLA2G2A, TP53, PA2G4, CHFR, PNMA5, CWF19L2, TXLNB, ALK, RNF2, ABCE1, PRMT8, LGALS3, HSPB1, NTRK1, BASP1, SCARNA22, PSMC5, CNTRL, XPO1, AHSA1, DDOST, NMT1, RPL12, RPS7, UBTF, NES, MTA1, FLOT1, PSIP1, NELFCD, NAT10, NUP133, XPNPEP3, C14orf169, SYNC, TRIM15, GAN, TRIM29, MCM2, MCM5, SNW1, CDC5L, ITGB3, PLA2G4A, RC3H1, CDC73, AHR, HYPK, USP14, PPM1B, STYXL1, NEFM, DES, INA, RSPRY1, UBR1, EPPK1, IDE, GXYLT1, ZYG11B, PRMT1, GLB1, CTSA, HSPA5, DFNB31, UBE2N, TCTEX1D2, DYNLT1, CYLD, SMARCB1, MCPH1, HEY1, TWIST1, TES, MTF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TNXB_VIM


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneVIMP08670DB11638ArtenimolVimentinsmall moleculeapproved|investigational

Top

RelatedDiseases for TNXB_VIM


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTNXBC0036341Schizophrenia3PSYGENET
HgeneTNXBC1848029Ehlers-Danlos syndrome caused by tenascin-X deficiency2CTD_human;ORPHANET;UNIPROT
HgeneTNXBC4014831VESICOURETERAL REFLUX 81UNIPROT
TgeneVIMC1458155Mammary Neoplasms3CTD_human
TgeneVIMC0023890Liver Cirrhosis2CTD_human
TgeneVIMC0029408Degenerative polyarthritis2CTD_human
TgeneVIMC0033578Prostatic Neoplasms2CTD_human
TgeneVIMC0007140Carcinosarcoma1CTD_human
TgeneVIMC0007621Neoplastic Cell Transformation1CTD_human
TgeneVIMC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneVIMC0027627Neoplasm Metastasis1CTD_human
TgeneVIMC0027720Nephrosis1CTD_human
TgeneVIMC0031149Peritoneal Neoplasms1CTD_human
TgeneVIMC0035126Reperfusion Injury1CTD_human
TgeneVIMC0035309Retinal Diseases1CTD_human
TgeneVIMC0039101synovial sarcoma1CTD_human
TgeneVIMC0043094Weight Gain1CTD_human
TgeneVIMC0085084Motor Neuron Disease1CTD_human
TgeneVIMC0086543Cataract1CTD_human
TgeneVIMC0345967Malignant mesothelioma1CTD_human
TgeneVIMC0524851Neurodegenerative Disorders1CTD_human
TgeneVIMC0948089Acute Coronary Syndrome1CTD_human
TgeneVIMC1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human
TgeneVIMC3805411CATARACT 301UNIPROT
TgeneVIMC4277682Chemical and Drug Induced Liver Injury1CTD_human