FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38913

FusionGeneSummary for TNKS_ASAH1

check button Fusion gene summary
Fusion gene informationFusion gene name: TNKS_ASAH1
Fusion gene ID: 38913
HgeneTgene
Gene symbol

TNKS

ASAH1

Gene ID

8658

427

Gene nametankyraseN-acylsphingosine amidohydrolase 1
SynonymsARTD5|PARP-5a|PARP5A|PARPL|TIN1|TINF1|TNKS1|pART5AC|ACDase|ASAH|PHP|PHP32|SMAPME
Cytomap

8p23.1

8p22

Type of geneprotein-codingprotein-coding
Descriptiontankyrase-1ADP-ribosyltransferase diphtheria toxin-like 5TANK1TNKS-1TRF1-interacting ankyrin-related ADP-ribose polymerase 1poly [ADP-ribose] polymerase 5Atankyrase Itankyrase, TRF1-interacting ankyrin-related ADP-ribose polymeraseacid ceramidaseN-acylsphingosine amidohydrolase (acid ceramidase) 1acid CDaseacylsphingosine deacylaseputative 32 kDa heart protein
Modification date2018052320180529
UniProtAcc

O95271

Q13510

Ensembl transtripts involved in fusion geneENST00000520408, ENST00000310430, 
ENST00000518281, ENST00000522110, 
ENST00000518027, 
ENST00000262097, 
ENST00000381733, ENST00000417108, 
ENST00000520781, ENST00000314146, 
ENST00000520051, 
Fusion gene scores* DoF score6 X 5 X 6=1806 X 6 X 5=180
# samples 67
** MAII scorelog2(6/180*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/180*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TNKS [Title/Abstract] AND ASAH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTNKS

GO:0000209

protein polyubiquitination

19759537|21478859

HgeneTNKS

GO:0006471

protein ADP-ribosylation

9822378|15133513|21270334

HgeneTNKS

GO:0018105

peptidyl-serine phosphorylation

17026964

HgeneTNKS

GO:0018107

peptidyl-threonine phosphorylation

17026964

HgeneTNKS

GO:0032212

positive regulation of telomere maintenance via telomerase

12782650|18221737

HgeneTNKS

GO:0045944

positive regulation of transcription by RNA polymerase II

19245366

HgeneTNKS

GO:0051973

positive regulation of telomerase activity

12782650

HgeneTNKS

GO:0070212

protein poly-ADP-ribosylation

9822378|16076287

HgeneTNKS

GO:0070213

protein auto-ADP-ribosylation

9822378|15133513|19759537|21478859

HgeneTNKS

GO:1904355

positive regulation of telomere capping

21531765

HgeneTNKS

GO:1904743

negative regulation of telomeric DNA binding

9822378


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A27N-01ATNKSchr8

9473187

+ASAH1chr8

17922040

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000520408ENST00000262097TNKSchr8

9473187

+ASAH1chr8

17922040

-
In-frameENST00000520408ENST00000381733TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000520408ENST00000417108TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000520408ENST00000520781TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000520408ENST00000314146TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000520408ENST00000520051TNKSchr8

9473187

+ASAH1chr8

17922040

-
In-frameENST00000310430ENST00000262097TNKSchr8

9473187

+ASAH1chr8

17922040

-
In-frameENST00000310430ENST00000381733TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000310430ENST00000417108TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000310430ENST00000520781TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000310430ENST00000314146TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000310430ENST00000520051TNKSchr8

9473187

+ASAH1chr8

17922040

-
In-frameENST00000518281ENST00000262097TNKSchr8

9473187

+ASAH1chr8

17922040

-
In-frameENST00000518281ENST00000381733TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000518281ENST00000417108TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000518281ENST00000520781TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000518281ENST00000314146TNKSchr8

9473187

+ASAH1chr8

17922040

-
5CDS-intronENST00000518281ENST00000520051TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-3CDSENST00000522110ENST00000262097TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-3CDSENST00000522110ENST00000381733TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-intronENST00000522110ENST00000417108TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-intronENST00000522110ENST00000520781TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-intronENST00000522110ENST00000314146TNKSchr8

9473187

+ASAH1chr8

17922040

-
intron-intronENST00000522110ENST00000520051TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-3CDSENST00000518027ENST00000262097TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-3CDSENST00000518027ENST00000381733TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-intronENST00000518027ENST00000417108TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-intronENST00000518027ENST00000520781TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-intronENST00000518027ENST00000314146TNKSchr8

9473187

+ASAH1chr8

17922040

-
3UTR-intronENST00000518027ENST00000520051TNKSchr8

9473187

+ASAH1chr8

17922040

-

Top

FusionProtFeatures for TNKS_ASAH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TNKS

O95271

ASAH1

Q13510

Poly-ADP-ribosyltransferase involved in variousprocesses such as Wnt signaling pathway, telomere length andvesicle trafficking. Acts as an activator of the Wnt signalingpathway by mediating poly-ADP-ribosylation (PARsylation) of AXIN1and AXIN2, 2 key components of the beta-catenin destructioncomplex: poly-ADP-ribosylated target proteins are recognized byRNF146, which mediates their ubiquitination and subsequentdegradation. Also mediates PARsylation of BLZF1 and CASC3,followed by recruitment of RNF146 and subsequent ubiquitination.Mediates PARsylation of TERF1, thereby contributing to theregulation of telomere length. Involved in centrosome maturationduring prometaphase by mediating PARsylation of HEPACAM2/MIKI. Mayalso regulate vesicle trafficking and modulate the subcellulardistribution of SLC2A4/GLUT4-vesicles. May be involved in spindlepole assembly through PARsylation of NUMA1. Stimulates 26Sproteasome activity. {ECO:0000269|PubMed:10988299,ECO:0000269|PubMed:11739745, ECO:0000269|PubMed:16076287,ECO:0000269|PubMed:19759537, ECO:0000269|PubMed:21478859,ECO:0000269|PubMed:22864114, ECO:0000269|PubMed:23622245}. Hydrolyzes the sphingolipid ceramide into sphingosineand free fatty acid. {ECO:0000269|PubMed:7744740}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327109_1613311328Compositional biasSer-rich
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+32720_833311328Compositional biasPro-rich
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+3279_143311328Compositional biasPoly-His
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327181_2093311328RepeatANK 1
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327215_2443311328RepeatANK 2
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327248_2773311328RepeatANK 3
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327281_3103311328RepeatANK 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+3271030_10893311328DomainSAM
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+3271112_13173311328DomainPARP catalytic
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327335_3643311328RepeatANK 5
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327368_3973311328RepeatANK 6
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327401_4303311328RepeatANK 7
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327434_4633311328RepeatANK 8
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327521_5533311328RepeatANK 9
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327557_5863311328RepeatANK 10
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327590_6193311328RepeatANK 11
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327621_6473311328RepeatANK 12
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327649_6793311328RepeatANK 13
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327683_7123311328RepeatANK 14
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327716_7453311328RepeatANK 15
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327749_7783311328RepeatANK 16
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327782_8103311328RepeatANK 17
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327836_8653311328RepeatANK 18
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327869_8983311328RepeatANK 19
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327902_9313311328RepeatANK 20
HgeneTNKSchr8:9473187chr8:17922040ENST00000310430+327935_9643311328RepeatANK 21


Top

FusionGeneSequence for TNKS_ASAH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_600aa
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCC
STTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLC
QGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEIISFNIFTELFTICTSIVAEDKKGHLI
HGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDV
MWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTP

>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_600aa
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCC
STTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLC
QGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEIISFNIFTELFTICTSIVAEDKKGHLI
HGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDV
MWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTP

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_600aa
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCC
STTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLC
QGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEIISFNIFTELFTICTSIVAEDKKGHLI
HGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDV
MWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTP

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_600aa
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCC
STTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLC
QGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEIISFNIFTELFTICTSIVAEDKKGHLI
HGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDV
MWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTP

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_363aa
MGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAK
AVLTGEIISFNIFTELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTG
FKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLD
VTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCI

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_363aa
MGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNTTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAK
AVLTGEIISFNIFTELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGTVGMLTG
FKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLD
VTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_1800nt
ATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCCCAGGGGCTTCAGCGCCGCCGCCGCCA
CCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCGGCCTGGCCCCCTTCGCCTCCCCGCGG
CACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGGACCCGGTTGACGGTACCAGCTGTTGC
AGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCATCTGCCGCTGGGGTCGCTCCCAACCCA
GCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCTCTCCATCCTCCCCTGGATCGAGCTTG
GCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGACCTGGGACAGGGGTCCCAGCAGTGAGC
GGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGGTGGACGCGGCAAACGTAAATGCAAAG
GACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCT
AATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGC
CAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTG
CTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTT
ACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATA
CATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACA
GTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCA
GGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTC
ATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTG
GCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAA
CTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCT
GCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAG
CTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGA

>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_1800nt
ATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCCCAGGGGCTTCAGCGCCGCCGCCGCCA
CCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCGGCCTGGCCCCCTTCGCCTCCCCGCGG
CACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGGACCCGGTTGACGGTACCAGCTGTTGC
AGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCATCTGCCGCTGGGGTCGCTCCCAACCCA
GCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCTCTCCATCCTCCCCTGGATCGAGCTTG
GCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGACCTGGGACAGGGGTCCCAGCAGTGAGC
GGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGGTGGACGCGGCAAACGTAAATGCAAAG
GACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCT
AATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGC
CAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTG
CTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTT
ACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATA
CATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACA
GTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCA
GGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTC
ATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTG
GCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAA
CTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCT
GCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAG
CTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGA

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_1800nt
ATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCCCAGGGGCTTCAGCGCCGCCGCCGCCA
CCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCGGCCTGGCCCCCTTCGCCTCCCCGCGG
CACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGGACCCGGTTGACGGTACCAGCTGTTGC
AGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCATCTGCCGCTGGGGTCGCTCCCAACCCA
GCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCTCTCCATCCTCCCCTGGATCGAGCTTG
GCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGACCTGGGACAGGGGTCCCAGCAGTGAGC
GGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGGTGGACGCGGCAAACGTAAATGCAAAG
GACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCT
AATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGC
CAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTG
CTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTT
ACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATA
CATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACA
GTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCA
GGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTC
ATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTG
GCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAA
CTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCT
GCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAG
CTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGA

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_1800nt
ATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCCCAGGGGCTTCAGCGCCGCCGCCGCCA
CCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCGGCCTGGCCCCCTTCGCCTCCCCGCGG
CACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGGACCCGGTTGACGGTACCAGCTGTTGC
AGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCATCTGCCGCTGGGGTCGCTCCCAACCCA
GCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCTCTCCATCCTCCCCTGGATCGAGCTTG
GCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGACCTGGGACAGGGGTCCCAGCAGTGAGC
GGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGGTGGACGCGGCAAACGTAAATGCAAAG
GACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCT
AATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGC
CAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTG
CTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTT
ACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATA
CATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACA
GTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCA
GGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTC
ATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTG
GCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAA
CTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCT
GCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAG
CTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGA

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_1089nt
ATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTG
TTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTG
TGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAA
GCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGT
CATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAA
CCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGA
TTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAG
AAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACC
AAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGAT
GTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGC
AGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTC
CTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATA

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_1089nt
ATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTG
TTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTG
TGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAA
GCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGT
CATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAA
CCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGA
TTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAG
AAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACC
AAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGAT
GTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGC
AGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTC
CTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_2935nt
AGTGACAGTGCTAGGGGAGTCCGAAGATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCC
CAGGGGCTTCAGCGCCGCCGCCGCCACCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCG
GCCTGGCCCCCTTCGCCTCCCCGCGGCACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGG
ACCCGGTTGACGGTACCAGCTGTTGCAGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCAT
CTGCCGCTGGGGTCGCTCCCAACCCAGCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCT
CTCCATCCTCCCCTGGATCGAGCTTGGCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGAC
CTGGGACAGGGGTCCCAGCAGTGAGCGGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGG
TGGACGCGGCAAACGTAAATGCAAAGGACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTG
TAGAACACTTACTACAGATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATG
CTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTA
AAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGG
CAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAG
CAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCA
TAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATG
TGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAG
AATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGA
ATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACA
GAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCT
TCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCC
TGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACT
GCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAA
CACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATG
ACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCAC
TGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCG
TGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTAT
GTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAA
TTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGC
ACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCC
CAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAAT
AGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTT
AAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCT
TTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTG

>In-frame_TNKS_ENST00000520408_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_2934nt
AGTGACAGTGCTAGGGGAGTCCGAAGATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCC
CAGGGGCTTCAGCGCCGCCGCCGCCACCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCG
GCCTGGCCCCCTTCGCCTCCCCGCGGCACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGG
ACCCGGTTGACGGTACCAGCTGTTGCAGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCAT
CTGCCGCTGGGGTCGCTCCCAACCCAGCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCT
CTCCATCCTCCCCTGGATCGAGCTTGGCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGAC
CTGGGACAGGGGTCCCAGCAGTGAGCGGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGG
TGGACGCGGCAAACGTAAATGCAAAGGACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTG
TAGAACACTTACTACAGATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATG
CTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTA
AAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGG
CAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAG
CAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCA
TAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATG
TGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAG
AATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGA
ATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACA
GAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCT
TCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCC
TGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACT
GCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAA
CACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATG
ACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCAC
TGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCG
TGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTAT
GTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAA
TTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGC
ACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCC
CAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAAT
AGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTT
AAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCT
TTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTG

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_2935nt
AGTGACAGTGCTAGGGGAGTCCGAAGATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCC
CAGGGGCTTCAGCGCCGCCGCCGCCACCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCG
GCCTGGCCCCCTTCGCCTCCCCGCGGCACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGG
ACCCGGTTGACGGTACCAGCTGTTGCAGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCAT
CTGCCGCTGGGGTCGCTCCCAACCCAGCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCT
CTCCATCCTCCCCTGGATCGAGCTTGGCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGAC
CTGGGACAGGGGTCCCAGCAGTGAGCGGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGG
TGGACGCGGCAAACGTAAATGCAAAGGACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTG
TAGAACACTTACTACAGATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATG
CTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTA
AAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGG
CAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAG
CAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCA
TAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATG
TGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAG
AATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGA
ATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACA
GAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCT
TCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCC
TGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACT
GCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAA
CACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATG
ACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCAC
TGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCG
TGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTAT
GTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAA
TTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGC
ACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCC
CAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAAT
AGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTT
AAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCT
TTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTG

>In-frame_TNKS_ENST00000310430_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_2934nt
AGTGACAGTGCTAGGGGAGTCCGAAGATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCCGCCC
CAGGGGCTTCAGCGCCGCCGCCGCCACCTCCTCCCCCACTCAGCCCTGGCCTGGCCCCGGGGACCACCCCAGCCTCTCCCACGGCCAGCG
GCCTGGCCCCCTTCGCCTCCCCGCGGCACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCCCCGG
ACCCGGTTGACGGTACCAGCTGTTGCAGTACCACCAGCACAATCTGTACCGTCGCCGCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCAT
CTGCCGCTGGGGTCGCTCCCAACCCAGCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCTTCCT
CTCCATCCTCCCCTGGATCGAGCTTGGCGGAGAGCCCCGAGGCGGCCGGAGTTAGCAGCACAGCACCACTGGGGCCTGGGGCAGCAGGAC
CTGGGACAGGGGTCCCAGCAGTGAGCGGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGGCTGG
TGGACGCGGCAAACGTAAATGCAAAGGACATGGCCGGCCGGAAGTCTTCTCCCCTGCACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTG
TAGAACACTTACTACAGATGGGTGCTAATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATG
CTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTA
AAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGG
CAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAG
CAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCA
TAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATG
TGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAG
AATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGA
ATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACA
GAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCT
TCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCC
TGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACT
GCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAA
CACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATG
ACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCAC
TGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCG
TGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTAT
GTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAA
TTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGC
ACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCC
CAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAAT
AGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTT
AAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCT
TTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTG

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000262097_chr8_17922040_-_2629nt
AATACCGTTGATAAACTGCTATGTGTGCCTGGATTGCCTTTGTCTTGACAAATTGTGTGAGACAAGTGAATCTCTCCATTATCTTTTTAT
TTTCTTTTGACACGGAGTCTCGCTCTGTTGCCCAGGCTGGAGTATAGGGGCGCGATCTCGGCTCATTGCAAGCTCCGCCTCCCGGGTTCA
CGCCATTCTCCTGCCTCAGCCTCCGGAGTAGCTGGGACTACAGGCGCCCGCCACCACGCAGGGCTAATTTTTTGTATATTTAGTAGAGAC
GGGTTTCACCATGTTAGCTAGGATGGTCTCGATTTCCTGACCTCGTGATCCGCCTGCTTCGGCCTCCCTAAATTACAGGTGTGAGCCACC
GCGCCCGGCGGATAATTTTTTAAGAGGAACAAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCTAATGTCCACG
CTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTG
ATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGC
ACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGA
TTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAA
ACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGG
ATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCA
GTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAG
GGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCT
ACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTA
AGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGT
GTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTAT
ACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCT
GGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTC
GCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTT
TCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGT
GGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGG
GACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTA
ACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACAT
TCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAG
CAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTG
CATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAG
CATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTG
TATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCA
TTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTC

>In-frame_TNKS_ENST00000518281_chr8_9473187_+_ASAH1_ENST00000381733_chr8_17922040_-_2628nt
AATACCGTTGATAAACTGCTATGTGTGCCTGGATTGCCTTTGTCTTGACAAATTGTGTGAGACAAGTGAATCTCTCCATTATCTTTTTAT
TTTCTTTTGACACGGAGTCTCGCTCTGTTGCCCAGGCTGGAGTATAGGGGCGCGATCTCGGCTCATTGCAAGCTCCGCCTCCCGGGTTCA
CGCCATTCTCCTGCCTCAGCCTCCGGAGTAGCTGGGACTACAGGCGCCCGCCACCACGCAGGGCTAATTTTTTGTATATTTAGTAGAGAC
GGGTTTCACCATGTTAGCTAGGATGGTCTCGATTTCCTGACCTCGTGATCCGCCTGCTTCGGCCTCCCTAAATTACAGGTGTGAGCCACC
GCGCCCGGCGGATAATTTTTTAAGAGGAACAAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCTAATGTCCACG
CTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGCCATGCTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTG
ATCCAAATGCCAGGGATAACTGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTGCTGCTGCAGC
ACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGACCTGGCAGATCCTTCAGCAAAAGCTGTCCTTACAGGAGAGA
TTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAA
ACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGG
ATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCA
GTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAG
GGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCT
ACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTA
AGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGT
GTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTAT
ACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCT
GGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTC
GCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTT
TCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGT
GGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGG
GACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTA
ACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACAT
TCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAG
CAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTG
CATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAG
CATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTG
TATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCA
TTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTC


Top

FusionGenePPI for TNKS_ASAH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TNKSFNBP1, POT1, TERF1, TNKS1BP1, NUMA1, MCL1, TNKS, LNPEP, BABAM1, FANCD2, TERF2, DISC1, SH3BP5, TNIK, GMDS, BLZF1, APC, SH3BP2, TINF2, RNF146, RAPGEF2, RTN2, CEP170, EPN3, SLC35A5, RNF166, PTEN, AXIN1, XPO1, KIF20A, FAM117B, SSSCA1, HIF1AN, SH3BP5L, LRP1, CELF5, MAPK8IP3, KLRG2, TMEM44, CHD1L, AP2M1, TRIM25, HEY1ASAH1SETDB1, TSC22D1, PSMA3, FBXO6, CAMK1D, SRPK1, GSG1, PNKD, AAGAB, AAMP, NEFH, CAMK2B, HSF2, HSPB2, HERC2, CYP1A2, GLT1D1, ZIC1, ZSCAN12, FTH1, NONO, TBC1D22B, SLCO6A1, AIRE, HTATIP2, RNF6, TRMT2A, ZNF684, ZNF556, HMP19, LYPD1, NCDN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TNKS_ASAH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TNKS_ASAH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneASAH1C0268255Farber Lipogranulomatosis8CTD_human;ORPHANET;UNIPROT
TgeneASAH1C0023794Lipoidosis2CTD_human
TgeneASAH1C1834569Jankovic Rivera syndrome2ORPHANET;UNIPROT
TgeneASAH1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneASAH1C0036341Schizophrenia1PSYGENET
TgeneASAH1C0221765Chronic schizophrenia1PSYGENET