FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38875

FusionGeneSummary for TNFSF13B_RAB20

check button Fusion gene summary
Fusion gene informationFusion gene name: TNFSF13B_RAB20
Fusion gene ID: 38875
HgeneTgene
Gene symbol

TNFSF13B

RAB20

Gene ID

10673

55647

Gene nameTNF superfamily member 13bRAB20, member RAS oncogene family
SynonymsBAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF20|TNLG7A|ZTNF4-
Cytomap

13q33.3

13q34

Type of geneprotein-codingprotein-coding
Descriptiontumor necrosis factor ligand superfamily member 13BApoL related ligand TALL-1B-cell-activating factorB-lymphocyte stimulatorDelta4 BAFFTNF and ApoL-related leukocyte expressed ligand 1TNF homolog that activates apoptosisdelta BAFFdendritic cell-deras-related protein Rab-20
Modification date2018052020180523
UniProtAcc

Q9Y275

Q9NX57

Ensembl transtripts involved in fusion geneENST00000430559, ENST00000375887, 
ENST00000542136, ENST00000479435, 
ENST00000267328, 
Fusion gene scores* DoF score1 X 1 X 1=13 X 1 X 3=9
# samples 13
** MAII scorelog2(1/1*10)=3.32192809488736log2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TNFSF13B [Title/Abstract] AND RAB20 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-DM-A1D7-01ATNFSF13Bchr13

108922772

+RAB20chr13

111176544

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000430559ENST00000267328TNFSF13Bchr13

108922772

+RAB20chr13

111176544

-
In-frameENST00000375887ENST00000267328TNFSF13Bchr13

108922772

+RAB20chr13

111176544

-
In-frameENST00000542136ENST00000267328TNFSF13Bchr13

108922772

+RAB20chr13

111176544

-
3UTR-3CDSENST00000479435ENST00000267328TNFSF13Bchr13

108922772

+RAB20chr13

111176544

-

Top

FusionProtFeatures for TNFSF13B_RAB20


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TNFSF13B

Q9Y275

RAB20

Q9NX57

Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA.TNFSF13/APRIL binds to the same 2 receptors. Together, they form a2 ligands -2 receptors pathway involved in the stimulation ofB- and T-cell function and the regulation of humoral immunity. Athird B-cell specific BAFF-receptor (BAFFR/BR3) promotes thesurvival of mature B-cells and the B-cell response.{ECO:0000269|PubMed:10973284}. Isoform 2 seems to inhibit isoform 1 secretion andbioactivity. {ECO:0000250}. Isoform 3: Acts as a transcription factor for its ownparent gene, in association with NF-kappa-B p50 subunit, at leastin autoimmune and proliferative B-cell diseases. The presence ofDelta4BAFF is essential for soluble BAFF release by IFNG/IFN-gamma-stimulated monocytes and for B-cell survival. It candirectly or indirectly regulate the differential expression of alarge number of genes involved in the innate immune response andthe regulation of apoptosis. {ECO:0000269|PubMed:10973284}. Plays a role in apical endocytosis/recycling. Plays arole in the maturation and acidification of phagosomes that engulfpathogens, such as S.aureus and M.tuberculosis. Plays a role inthe fusion of phagosomes with lysosomes.{ECO:0000269|PubMed:21255211}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000375887+261_46141286Topological domainCytoplasmic
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000430559+251_46141267Topological domainCytoplasmic
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000542136+241_46141165Topological domainCytoplasmic
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000375887+2647_67141286TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000430559+2547_67141267TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000542136+2447_67141165TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneRAB20chr13:108922772chr13:111176544ENST00000267328-02113_11657235Nucleotide bindingGTP
TgeneRAB20chr13:108922772chr13:111176544ENST00000267328-0255_5957235Nucleotide bindingGTP

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000375887+2668_285141286Topological domainExtracellular
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000430559+2568_285141267Topological domainExtracellular
HgeneTNFSF13Bchr13:108922772chr13:111176544ENST00000542136+2468_285141165Topological domainExtracellular
TgeneRAB20chr13:108922772chr13:111176544ENST00000267328-0233_4157235MotifEffector region
TgeneRAB20chr13:108922772chr13:111176544ENST00000267328-0212_1957235Nucleotide bindingGTP


Top

FusionGeneSequence for TNFSF13B_RAB20


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TNFSF13B_ENST00000430559_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_319aa
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLRAELQGHHAEK
LPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETGREQFHGLGSMYCRGAAAIILTTDVNHRQSLVELEDRFL
GLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALTKKILKYKMLDEQDVPAAEQMCFETSAKT

>In-frame_TNFSF13B_ENST00000375887_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_319aa
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLRAELQGHHAEK
LPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETGREQFHGLGSMYCRGAAAIILTTDVNHRQSLVELEDRFL
GLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALTKKILKYKMLDEQDVPAAEQMCFETSAKT

>In-frame_TNFSF13B_ENST00000542136_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_319aa
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLRAELQGHHAEK
LPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETGREQFHGLGSMYCRGAAAIILTTDVNHRQSLVELEDRFL
GLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALTKKILKYKMLDEQDVPAAEQMCFETSAKT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TNFSF13B_ENST00000430559_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_957nt
ATGGATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATC
CTCCCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGC
CTCACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAG
CTGCCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCA
GGAGAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGC
TCCATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTG
GGCCTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAG
GAGAAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCC
CTTTATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACC
GGCTACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACA

>In-frame_TNFSF13B_ENST00000375887_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_957nt
ATGGATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATC
CTCCCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGC
CTCACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAG
CTGCCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCA
GGAGAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGC
TCCATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTG
GGCCTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAG
GAGAAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCC
CTTTATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACC
GGCTACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACA

>In-frame_TNFSF13B_ENST00000542136_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_957nt
ATGGATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATC
CTCCCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGC
CTCACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAG
CTGCCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCA
GGAGAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGC
TCCATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTG
GGCCTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAG
GAGAAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCC
CTTTATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACC
GGCTACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TNFSF13B_ENST00000430559_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_1819nt
GAAATTCTTACAAAAACTGAAAGTGAAATGAGGAAGACAGATTGAGCAATCCAATCGGAGGGTAAATGCCAGCAAACCTACTGTACAGTA
GGGGTAGAGATGCAGAAAGGCAGAAAGGAGAAAATTCAGGATAACTCTCCTGAGGGGTGAGCCAAGCCCTGCCATGTAGTGCACGCAGGA
CATCAACAAACACAGATAACAGGAAATGATCCATTCCCTGTGGTCACTTATTCTAAAGGCCCCAACCTTCAAAGTTCAAGTAGTGATATG
GATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATCCTC
CCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGCCTC
ACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAGCTG
CCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCAGGA
GAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGCTCC
ATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTGGGC
CTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAGGAG
AAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCCCTT
TATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACCGGC
TACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACAGTG
GATATATCCAGTCATAAGCCACCCAAGAGGACCAGATCTGGGTGTTGTGCCTGACTTTCGAGGGCCTCCTGGACTCAGACTGTGCATGTT
GGGAAGGGGTCTGACCAGGCAAGCTGTGATCTGAAAGGAGCAAGGAACAGCAAGGAATTATTTTCCAGAATGACACCCGCAGCAGAATGT
TGGAGTGGAAATGATGGCTGGCTATGAAGAGGAGGTCAACGTGTGTGGTCTCCTCAGTCTCTGTCAGAGGGGTGGGGAGGTGGGAAACAG
GAATCCTCTGCAAAGCCCAATCTGCAGAGTCGAGACCCCTGGTGCTCTCTGCCCCGCTGCCTGGCACTGGTCCTTTGCAGCCAGCCACCA
ACGGCCCCCTTGCCCTTGCAGAGGCAGAAGCCTGCGTCTGCACCTGCACCTCTGACCGTTTCAGCACCCTGGGTTGTTACCACGTCCTAC
AACTCTGACATTTCTTGTTCTCAAGCGTTTCTCTTCACTGTGAGTTGTCTTTGGTCCTCCCACTTGGTACTTGTATCTTGATGCTTTATA
ATCCTGACTCTCGACGTGTTCATTTATACAAAATCAGGAATAACTTTGTTTTTATACTGATTGCAGCAATGTTGGCTACATGTATTATTA

>In-frame_TNFSF13B_ENST00000375887_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_1730nt
AGGGGTAGAGATGCAGAAAGGCAGAAAGGAGAAAATTCAGGATAACTCTCCTGAGGGGTGAGCCAAGCCCTGCCATGTAGTGCACGCAGG
ACATCAACAAACACAGATAACAGGAAATGATCCATTCCCTGTGGTCACTTATTCTAAAGGCCCCAACCTTCAAAGTTCAAGTAGTGATAT
GGATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATCCT
CCCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGCCT
CACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAGCT
GCCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCAGG
AGAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGCTC
CATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTGGG
CCTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAGGA
GAAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCCCT
TTATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACCGG
CTACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACAGT
GGATATATCCAGTCATAAGCCACCCAAGAGGACCAGATCTGGGTGTTGTGCCTGACTTTCGAGGGCCTCCTGGACTCAGACTGTGCATGT
TGGGAAGGGGTCTGACCAGGCAAGCTGTGATCTGAAAGGAGCAAGGAACAGCAAGGAATTATTTTCCAGAATGACACCCGCAGCAGAATG
TTGGAGTGGAAATGATGGCTGGCTATGAAGAGGAGGTCAACGTGTGTGGTCTCCTCAGTCTCTGTCAGAGGGGTGGGGAGGTGGGAAACA
GGAATCCTCTGCAAAGCCCAATCTGCAGAGTCGAGACCCCTGGTGCTCTCTGCCCCGCTGCCTGGCACTGGTCCTTTGCAGCCAGCCACC
AACGGCCCCCTTGCCCTTGCAGAGGCAGAAGCCTGCGTCTGCACCTGCACCTCTGACCGTTTCAGCACCCTGGGTTGTTACCACGTCCTA
CAACTCTGACATTTCTTGTTCTCAAGCGTTTCTCTTCACTGTGAGTTGTCTTTGGTCCTCCCACTTGGTACTTGTATCTTGATGCTTTAT
AATCCTGACTCTCGACGTGTTCATTTATACAAAATCAGGAATAACTTTGTTTTTATACTGATTGCAGCAATGTTGGCTACATGTATTATT

>In-frame_TNFSF13B_ENST00000542136_chr13_108922772_+_RAB20_ENST00000267328_chr13_111176544_-_1552nt
ATGGATGACTCCACAGAAAGGGAGCAGTCACGCCTTACTTCTTGCCTTAAGAAAAGAGAAGAAATGAAACTGAAGGAGTGTGTTTCCATC
CTCCCACGGAAGGAAAGCCCCTCTGTCCGATCCTCCAAAGACGGAAAGCTGCTGGCTGCAACCTTGCTGCTGGCACTGCTGTCTTGCTGC
CTCACGGTGGTGTCTTTCTACCAGGTGGCCGCCCTGCAAGGGGACCTGGCCAGCCTCCGGGCAGAGCTGCAGGGCCACCACGCGGAGAAG
CTGCCAGCAGGAGCAGGAGCCCCCAAGGCCGGCCTGGAGGAAGCTCCAGCTGTCACCGCGGGACTGAAAATCTTTGAACCACCAGCTCCA
GGAGAAGGCAACTCCAGTCAGAACAGCAGAAATAAGCGTGCCGTTCAGGGTCCAGAAGAAACAGGGCGGGAGCAGTTCCACGGCCTGGGC
TCCATGTACTGCCGGGGGGCGGCCGCCATCATCCTCACCTATGATGTGAATCACCGGCAGAGCCTGGTGGAGCTGGAGGACCGGTTCCTG
GGCCTGACAGACACAGCCAGCAAAGACTGCCTCTTTGCCATCGTGGGGAACAAAGTGGACCTCACTGAGGAGGGGGCCTTGGCGGGCCAG
GAGAAGGAAGAGTGCAGTCCCAATATGGACGCTGGGGACCGTGTCTCCCCAAGGGCACCTAAGCAGGTGCAGCTGGAGGATGCGGTGGCC
CTTTATAAAAAGATCCTCAAGTACAAGATGCTGGATGAGCAGGATGTGCCGGCCGCTGAGCAAATGTGCTTTGAGACCAGCGCCAAGACC
GGCTACAATGTGGACCTCCTGTTTGAGACCCTCTTTGACCTGGTGGTGCCAATGATCTTACAGCAGAGAGCTGAGAGGCCGTCACACACA
GTGGATATATCCAGTCATAAGCCACCCAAGAGGACCAGATCTGGGTGTTGTGCCTGACTTTCGAGGGCCTCCTGGACTCAGACTGTGCAT
GTTGGGAAGGGGTCTGACCAGGCAAGCTGTGATCTGAAAGGAGCAAGGAACAGCAAGGAATTATTTTCCAGAATGACACCCGCAGCAGAA
TGTTGGAGTGGAAATGATGGCTGGCTATGAAGAGGAGGTCAACGTGTGTGGTCTCCTCAGTCTCTGTCAGAGGGGTGGGGAGGTGGGAAA
CAGGAATCCTCTGCAAAGCCCAATCTGCAGAGTCGAGACCCCTGGTGCTCTCTGCCCCGCTGCCTGGCACTGGTCCTTTGCAGCCAGCCA
CCAACGGCCCCCTTGCCCTTGCAGAGGCAGAAGCCTGCGTCTGCACCTGCACCTCTGACCGTTTCAGCACCCTGGGTTGTTACCACGTCC
TACAACTCTGACATTTCTTGTTCTCAAGCGTTTCTCTTCACTGTGAGTTGTCTTTGGTCCTCCCACTTGGTACTTGTATCTTGATGCTTT
ATAATCCTGACTCTCGACGTGTTCATTTATACAAAATCAGGAATAACTTTGTTTTTATACTGATTGCAGCAATGTTGGCTACATGTATTA


Top

FusionGenePPI for TNFSF13B_RAB20


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TNFSF13BTNFRSF17, TNFRSF13C, TNFSF13B, TNFSF13, TNFRSF13B, APP, TNFSF12, CAND2, IPO7, PDSS1, MON2, FANCD2, RANBP6, MFAP3, FAM160B1, IMPAD1, HOOK2, TTC17, HOOK1, BRAT1, NUP85, LRIG3, IPO8, XPO4, MAP3K6, MAP3K5, MAP3K15, IPO11, TMEM131, HEATR1, TNPO2, NF1, IPO9, ITGB1, ITGA7, NCAPG, FAM118A, SAAL1, BTAF1, HOOK3, AKTIP, FAM160A2, PIGQ, TMEM39A, ARSK, CHST12, VTI1B, HLA-DPB1, ITGAV, PXYLP1, DYMRAB20NXF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TNFSF13B_RAB20


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneTNFSF13BQ9Y275DB08879BelimumabTumor necrosis factor ligand superfamily member 13Bbiotechapproved
HgeneTNFSF13BQ9Y275DB04272Citric AcidTumor necrosis factor ligand superfamily member 13Bsmall moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for TNFSF13B_RAB20


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTNFSF13BC0525045Mood Disorders1PSYGENET