FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38871

FusionGeneSummary for TNFSF10_NCEH1

check button Fusion gene summary
Fusion gene informationFusion gene name: TNFSF10_NCEH1
Fusion gene ID: 38871
HgeneTgene
Gene symbol

TNFSF10

NCEH1

Gene ID

8743

57552

Gene nameTNF superfamily member 10neutral cholesterol ester hydrolase 1
SynonymsAPO2L|Apo-2L|CD253|TL2|TNLG6A|TRAILAADACL1|NCEH
Cytomap

3q26.31

3q26.31

Type of geneprotein-codingprotein-coding
Descriptiontumor necrosis factor ligand superfamily member 10Apo-2 ligandTNF-related apoptosis inducing ligand TRAILchemokine tumor necrosis factor ligand superfamily member 10tumor necrosis factor (ligand) family, member 10tumor necrosis factor (ligand) superfneutral cholesterol ester hydrolase 1arylacetamide deacetylase-like 1
Modification date2018052220180523
UniProtAcc

P50591

Q6PIU2

Ensembl transtripts involved in fusion geneENST00000241261, ENST00000420541, 
ENST00000475381, ENST00000273512, 
ENST00000538775, ENST00000543711, 
Fusion gene scores* DoF score6 X 5 X 3=909 X 6 X 6=324
# samples 612
** MAII scorelog2(6/90*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/324*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TNFSF10 [Title/Abstract] AND NCEH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTNFSF10

GO:0043065

positive regulation of apoptotic process

21525171

HgeneTNFSF10

GO:0043280

positive regulation of cysteine-type endopeptidase activity involved in apoptotic process

21459798|21525171|22266862

HgeneTNFSF10

GO:0090200

positive regulation of release of cytochrome c from mitochondria

22266862

HgeneTNFSF10

GO:2001238

positive regulation of extrinsic apoptotic signaling pathway

20097879|21525171|22266862


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-KP-A3W1-01ATNFSF10chr3

172241043

-NCEH1chr3

172365904

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000241261ENST00000475381TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
In-frameENST00000241261ENST00000273512TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
In-frameENST00000241261ENST00000538775TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
5CDS-intronENST00000241261ENST00000543711TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
In-frameENST00000420541ENST00000475381TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
In-frameENST00000420541ENST00000273512TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
In-frameENST00000420541ENST00000538775TNFSF10chr3

172241043

-NCEH1chr3

172365904

-
5CDS-intronENST00000420541ENST00000543711TNFSF10chr3

172241043

-NCEH1chr3

172365904

-

Top

FusionProtFeatures for TNFSF10_NCEH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TNFSF10

P50591

NCEH1

Q6PIU2

Cytokine that binds to TNFRSF10A/TRAILR1,TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 andpossibly also to TNFRSF11B/OPG (PubMed:26457518, PubMed:10549288).Induces apoptosis. Its activity may be modulated by binding to thedecoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 andTNFRSF11B/OPG that cannot induce apoptosis.{ECO:0000269|PubMed:10549288, ECO:0000269|PubMed:26457518}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000241261-151_1744282Topological domainCytoplasmic
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000420541-131_1744102Topological domainCytoplasmic
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000241261-1518_3844282TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000420541-1318_3844102TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneNCEH1chr3:172241043chr3:172365904ENST00000475381-05113_11546409MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
TgeneNCEH1chr3:172241043chr3:172365904ENST00000543711-04113_115-135276MotifInvolved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole
TgeneNCEH1chr3:172241043chr3:172365904ENST00000543711-041_4-135276Topological domainCytoplasmic
TgeneNCEH1chr3:172241043chr3:172365904ENST00000543711-0426_408-135276Topological domainLumenal
TgeneNCEH1chr3:172241043chr3:172365904ENST00000543711-045_25-135276TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000241261-1539_28144282Topological domainExtracellular
HgeneTNFSF10chr3:172241043chr3:172365904ENST00000420541-1339_28144102Topological domainExtracellular
TgeneNCEH1chr3:172241043chr3:172365904ENST00000475381-051_446409Topological domainCytoplasmic
TgeneNCEH1chr3:172241043chr3:172365904ENST00000475381-0526_40846409Topological domainLumenal
TgeneNCEH1chr3:172241043chr3:172365904ENST00000475381-055_2546409TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for TNFSF10_NCEH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_407aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASAKIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEVLQKTMVDP
GRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQAMIVNNHT
SLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMTAKRLE

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_407aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASAKIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEVLQKTMVDP
GRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQAMIVNNHT
SLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMTAKRLE

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_415aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASASASWSPSDEIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEV
LQKTMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQ
AMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDG

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_407aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASAKIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEVLQKTMVDP
GRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQAMIVNNHT
SLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMTAKRLE

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_407aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASAKIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEVLQKTMVDP
GRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQAMIVNNHT
SLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMTAKRLE

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_415aa
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEV
RVFEGPPKPEEPLKRSVVTIHGGGWALASASASWSPSDEIRTTDELCTAMAEELNAVIVSIEYRLVPKVTFPEQIHDVVRATKTFLKPEV
LQKTMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALITPVLQALDFNTPSTQQNVNTPILPRTVMVKTWVDYFKGNTDFVQ
AMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_1221nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAG
GTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCCA
GGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAAT
AAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATC
CTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACT
TCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCT
GTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCA
GTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAG
AGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTG

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_1221nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAG
GTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCCA
GGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAAT
AAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATC
CTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACT
TCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCT
GTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCA
GTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAG
AGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTG

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_1245nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AGTGCGTCCTGGTCACCTTCAGATGAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCC
ATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTC
TTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTT
ACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTAT
CAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAG
GCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCA
TCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCC
GCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGC
ATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACT

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_1221nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAG
GTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCCA
GGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAAT
AAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATC
CTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACT
TCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCT
GTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCA
GTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAG
AGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTG

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_1221nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAG
GTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCCA
GGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAAT
AAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATC
CTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACT
TCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCT
GTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCA
GTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAG
AGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTG

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_1245nt
ATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTGT
GTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACTG
AATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGTC
AGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCA
AGTGCGTCCTGGTCACCTTCAGATGAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCC
ATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTC
TTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTT
ACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTAT
CAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAG
GCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCA
TCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCC
GCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGC
ATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_4570nt
ACAGAACCCAGAAAAACAACTCATTCGCTTTCATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTG
GCTGACTTACAGCAGTCAGACTCTGACAGGATCATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATC
GTGATCTTCACAGTGCTCCTGCAGTCTCTCTGTGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCAC
TACCTGGGACTGAGCCATCACCTGCTGGCACTGAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAG
GTGACCGACACAGACTTTGATGGTGTGGAAGTCAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTAT
ATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCAAAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTC
ATTGTTTCCATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAG
CCAGAAGTCTTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGA
CAACAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACA
CCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGAC
TTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTC
TTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGAT
GCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGA
GACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATG
ATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTACATCAAGTGGCTAGATCAAAACCTGTAAAGGAGC
AAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGACATGCACTTTTTAGTTGACTAATTCTTCCTCCCAT
TCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATAACCTAATTTTTAAAAATGAATTTGACTAACTTAA
GTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTATCTTAGCCAACTATACTGATACCTACAGCTACAGA
AAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGA
GTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGAGCAGTATTAAATGCGTGCACTTTC
AGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTTTCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAA
GAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCTATCTGTAAGTCCAGTTGGATTACAGGAATACTTG
AAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTATATATCATTAGGTTTTTGTTGTGTTTTTGGTTATG
CTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGTAAACTTTTCATTATAGAGCAAGTAAAAACAGACA
AATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGCAGTGTGAATATACTTGGCATAGTCAAAAAAGAAA
ATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTATTATTGAAAACTCAATTTTTTCACTTATATGGCTT
TAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTTAATGTTAATATACATAGCTAGACTTAAGGTTTTT
CAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTAAAACCTTCCCTACAGTTATAACCA
CGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCATAAATATTTTCGTGTTTATATGCATATACAAGTTA
AAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCAAGGCACACACTGCTCATCTCCGCT
TTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCACCTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCC
AGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTGCCAGTGGGAACATCTTTGACACAACAAGACACTC
CAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCATGCTACTTTTAGGGGCTGCGGAGAG
CAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTTCACTCCTGGGAAGATGGGGTATTTCCCACTTCCA
GCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGTAGCATTTTATGTACAAAACAGAAGTCAATGCAAC
AGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAATGTACTTAGGCAAGCCACTTCCCATCTCTGGGCC
TCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCTTCCACTTATAATACCAACTGTCTTGTCAGACTGG
CAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTTATACACAGACACCTGCATCATCGAAGGTCTTTTT
TTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTCATATAATACTATTCTTTTTGACACCATTTGAAGG
AACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAAATGTATAGGCAGGGTTCCTTCAATTGGCATTTTC
CCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATCTCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAA
GGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTTTAGTTTGTATTCTTATAAAAAATGTTTACACTCT
GCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAAAATGATAATCTTTTTGTAAAATTGTCTGTGAAAT
ATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATTAATGTTTTATTGATTTGTGAAGAATTTAAGACTA
TTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTTGCTTATTTCCCACTACGAAGGGGAAGGTAGATTT
TATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCATCTATCTATTCTGAATCATGTTTGG
AAATAAAATTGCTCCATCTGGGAATGTGCTTTCATTTTCCCGTCTCATTTTCTGTTTCCCATTTGAAAACAGTGTTCTCTTCTCTTCTTT
CTGTATGCCAAATTGCCAGCCACAATTCTTTCCCAATCTTCTGCCCAGTGGAGTACTCCAGCTGTCTTTCCTTTAGAGAGGTGGTTCAGT
GGCCTCCTTGATGACATTTGTTTCATGTCTGGATACAGTATGTGTTGCCCTCCTTTGGACTGGCTAGAATATTCATAAAAGCCAGGCAGG
CCCTGGGACTATTTTGGGACCTTCAATACACATGTTAGGAAAAGGATGATCATAATGCCAAGAGTTTGAGCTGAATTGTTTCAGCCAAAG

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_4174nt
ACAGAACCCAGAAAAACAACTCATTCGCTTTCATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTG
GCTGACTTACAGCAGTCAGACTCTGACAGGATCATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATC
GTGATCTTCACAGTGCTCCTGCAGTCTCTCTGTGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCAC
TACCTGGGACTGAGCCATCACCTGCTGGCACTGAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAG
GTGACCGACACAGACTTTGATGGTGTGGAAGTCAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTAT
ATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCAAAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTC
ATTGTTTCCATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAG
CCAGAAGTCTTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGA
CAACAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACA
CCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGAC
TTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTC
TTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGAT
GCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGA
GACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATG
ATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTACATCAAGTGGCTAGATCAAAACCTGTAAAGGAGC
AAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGACATGCACTTTTTAGTTGACTAATTCTTCCTCCCAT
TCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATAACCTAATTTTTAAAAATGAATTTGACTAACTTAA
GTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTATCTTAGCCAACTATACTGATACCTACAGCTACAGA
AAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGA
GTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGAGCAGTATTAAATGCGTGCACTTTC
AGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTTTCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAA
GAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCTATCTGTAAGTCCAGTTGGATTACAGGAATACTTG
AAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTATATATCATTAGGTTTTTGTTGTGTTTTTGGTTATG
CTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGTAAACTTTTCATTATAGAGCAAGTAAAAACAGACA
AATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGCAGTGTGAATATACTTGGCATAGTCAAAAAAGAAA
ATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTATTATTGAAAACTCAATTTTTTCACTTATATGGCTT
TAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTTAATGTTAATATACATAGCTAGACTTAAGGTTTTT
CAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTAAAACCTTCCCTACAGTTATAACCA
CGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCATAAATATTTTCGTGTTTATATGCATATACAAGTTA
AAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCAAGGCACACACTGCTCATCTCCGCT
TTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCACCTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCC
AGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTGCCAGTGGGAACATCTTTGACACAACAAGACACTC
CAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCATGCTACTTTTAGGGGCTGCGGAGAG
CAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTTCACTCCTGGGAAGATGGGGTATTTCCCACTTCCA
GCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGTAGCATTTTATGTACAAAACAGAAGTCAATGCAAC
AGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAATGTACTTAGGCAAGCCACTTCCCATCTCTGGGCC
TCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCTTCCACTTATAATACCAACTGTCTTGTCAGACTGG
CAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTTATACACAGACACCTGCATCATCGAAGGTCTTTTT
TTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTCATATAATACTATTCTTTTTGACACCATTTGAAGG
AACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAAATGTATAGGCAGGGTTCCTTCAATTGGCATTTTC
CCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATCTCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAA
GGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTTTAGTTTGTATTCTTATAAAAAATGTTTACACTCT
GCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAAAATGATAATCTTTTTGTAAAATTGTCTGTGAAAT
ATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATTAATGTTTTATTGATTTGTGAAGAATTTAAGACTA
TTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTTGCTTATTTCCCACTACGAAGGGGAAGGTAGATTT
TATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCATCTATCTATTCTGAATCATGTTTGG

>In-frame_TNFSF10_ENST00000241261_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_4198nt
ACAGAACCCAGAAAAACAACTCATTCGCTTTCATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTG
GCTGACTTACAGCAGTCAGACTCTGACAGGATCATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATC
GTGATCTTCACAGTGCTCCTGCAGTCTCTCTGTGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCAC
TACCTGGGACTGAGCCATCACCTGCTGGCACTGAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAG
GTGACCGACACAGACTTTGATGGTGTGGAAGTCAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTAT
ATCCACGGAGGAGGCTGGGCCTTGGCAAGTGCAAGTGCGTCCTGGTCACCTTCAGATGAAATCAGGTATTATGATGAGCTGTGTACAGCA
ATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTA
CGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGT
GGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTT
CTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTG
GACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGG
GCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTC
CAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTG
ACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTT
GAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTACATCAAGTGG
CTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGACATGCACTTTT
TAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATAACCTAATTTT
TAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTATCTTAGCCAAC
TATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCA
GTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGA
GCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTTTCCTATGGGA
ATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCTATCTGTAAGT
CCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTATATATCATTAG
GTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGTAAACTTTTCA
TTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGCAGTGTGAATA
TACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTATTATTGAAAAC
TCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTTAATGTTAATA
TACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTA
AAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCATAAATATTTTC
GTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCA
AGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCACCTGGTGTTGC
CTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTGCCAGTGGGAA
CATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCAT
GCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTTCACTCCTGGG
AAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGTAGCATTTTAT
GTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAATGTACTTAGG
CAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCTTCCACTTATA
ATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTTATACACAGAC
ACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTCATATAATACT
ATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAAATGTATAGGC
AGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATCTCTAAAAGGC
TCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTTTAGTTTGTAT
TCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAAAATGATAATC
TTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATTAATGTTTTAT
TGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTTGCTTATTTCC
CACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCAT

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000475381_chr3_172365904_-_4538nt
ATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTGGCTGACTTACAGCAGTCAGACTCTGACAGGAT
CATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTG
TGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACT
GAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGT
CAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGC
AAAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAA
GGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCC
AGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAA
TAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAAT
CCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACAC
TTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCC
TGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGC
AGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGA
GAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGT
GGGAATCCGGACTAGGAATAGTTACATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGAC
CTCCTACACCTGCTTTGGAAAGACATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTAT
TCCATAACTGAAGTCTTTATGATAACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTG
GGCCAATCTCTCTGTTCTTGTTATCTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGG
TCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACT
CCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGT
CTTTTGTGAATGGATGGTTTTGTTTCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTA
GAATGTTCATTTTATGAGATCGCTATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATG
AAGTCGCATGCACTGGATATCTATATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGG
AGCAAACTTATTTAGATTTAGAGTAAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATA
CTTCTGACATAAAGTACCAAGAGCAGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAA
ATACCTTTAGAAGGTCTAGTCTATTATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGT
ATTGTTTATTTTTTTAAGTTATTTAATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACA
ATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTA
TTAATACTACTATAACATAGGCATAAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAA
AGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTC
TGAGTGAAGGGCGTACACTGGCACCTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCT
TAACTTCATGTAAAGTCTTCACTGCCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTG
CCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCAC
CACGGAGAGAAAGTAGAACCATTTCACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACT
TATTGATGTATTGTATGAGCCAGTAGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAA
TAACCATTGAAGCTAACTTGCTAATGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTG
AATTATGTGATCCTTGAGGTCTCTTCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGT
TTTTTTGGTAGGTCATAGTTCCTTATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCT
TATTCTGTGATAACTATCCTCCTCATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTC
TGTCTCGAAGAAAAAGAAAATAAAATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATT
GCAGACAGCAAATGATTCCGGATCTCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAA
TGTACTTGAGTTTCATTGTTCTTTTAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGC
TTTCTTTTCCTATTTTATGAAAAAAATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAA
GTGCTGTATAGTGAAGTATAAATTAATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATG
CATGACCTTTTAACCTTTGACTTTGCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTAT
AAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCATCTATCTATTCTGAATCATGTTTGGAAATAAAATTGCTCCATCTGGGAATGTGCTTT
CATTTTCCCGTCTCATTTTCTGTTTCCCATTTGAAAACAGTGTTCTCTTCTCTTCTTTCTGTATGCCAAATTGCCAGCCACAATTCTTTC
CCAATCTTCTGCCCAGTGGAGTACTCCAGCTGTCTTTCCTTTAGAGAGGTGGTTCAGTGGCCTCCTTGATGACATTTGTTTCATGTCTGG
ATACAGTATGTGTTGCCCTCCTTTGGACTGGCTAGAATATTCATAAAAGCCAGGCAGGCCCTGGGACTATTTTGGGACCTTCAATACACA
TGTTAGGAAAAGGATGATCATAATGCCAAGAGTTTGAGCTGAATTGTTTCAGCCAAAGCATCACTATCACTGAAGGCAGGTTCTCAAACT

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000273512_chr3_172365904_-_4142nt
ATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTGGCTGACTTACAGCAGTCAGACTCTGACAGGAT
CATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTG
TGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACT
GAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGT
CAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGC
AAAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTCCATTGAATACAGGCTAGTTCCAAA
GGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTTGATCC
AGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTTTACTCAAGATGCCAGCCTAAAAAA
TAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACCCCAAT
CCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCAGGCAATGATCGTTAACAATCACAC
TTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTACAAGCC
TGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTCCGCCCCACTCATTGCAGACCAGGC
AGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGTTTGGA
GAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCACTAGCTGGCCCACCAACTTCTCAGT
GGGAATCCGGACTAGGAATAGTTACATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTCCAGAAGCCTCGAGCCCCTCTTGAC
CTCCTACACCTGCTTTGGAAAGACATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCTACTTGCGAGTTATGGAATTTCTAT
TCCATAACTGAAGTCTTTATGATAACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAACATGTAAATTTGGTTCCCAGAGTG
GGCCAATCTCTCTGTTCTTGTTATCTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGACTAGGAACTGGAAATAACTTTGGG
TCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTTTAATAAGTTAAAAAAACGAGGACT
CCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGTACTGGGGACCAAGTACCCTCTGGT
CTTTTGTGAATGGATGGTTTTGTTTCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGTTTCTCAAAGGACTTTCTTCCTCTA
GAATGTTCATTTTATGAGATCGCTATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTACTTTCTACCACTATTAGAAAATATG
AAGTCGCATGCACTGGATATCTATATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCCCTTCTCCTTGGGGAGATATTTGGG
AGCAAACTTATTTAGATTTAGAGTAAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAACAACCTAGTGTTTCACATAAAAATA
CTTCTGACATAAAGTACCAAGAGCAGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTTAATATTAGTTCAAAATTGTTAAAA
ATACCTTTAGAAGGTCTAGTCTATTATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGGAGCTATTTTGCTACAATATAATGT
ATTGTTTATTTTTTTAAGTTATTTAATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGATGTCCATAATAAATATTAAAAACA
ATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAATTTTGTGGAAATGATATAACAGCTA
TTAATACTACTATAACATAGGCATAAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATTAGAAACTATGACTGCGCCTAGTAA
AGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGGTCAGAGGAACACAAGCTCATGTTC
TGAGTGAAGGGCGTACACTGGCACCTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGTCTGGAAGTTTCAACAGCCCAAGCT
TAACTTCATGTAAAGTCTTCACTGCCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTGATTTGAGTTGAGGATCTCTGCCTG
CCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCAGAGCTGAGTAATGATACAGGGCAC
CACGGAGAGAAAGTAGAACCATTTCACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAAATAACAAATGAAAAGTTGCATACT
TATTGATGTATTGTATGAGCCAGTAGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTATGTGTGCCTGTGTGTGTATAAAAA
TAACCATTGAAGCTAACTTGCTAATGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTTCCTCCCTCTAAAATCAAAGAGCTG
AATTATGTGATCCTTGAGGTCTCTTCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTATATTGGCCTCTCCTTATGTGGTGGT
TTTTTTGGTAGGTCATAGTTCCTTATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAAAAAAAAAAATGGGATTTTAGTTCT
TATTCTGTGATAACTATCCTCCTCATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATATTTGGACCTTATTTTGAGGTTGTC
TGTCTCGAAGAAAAAGAAAATAAAATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAATTGTGAGCCAAAGCCTATAGTAATT
GCAGACAGCAAATGATTCCGGATCTCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAAGAGGTCAACCACTGTTTCTGATAA
TGTACTTGAGTTTCATTGTTCTTTTAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTGATTTTTTTTTTTTAGTACTGTGGC
TTTCTTTTCCTATTTTATGAAAAAAATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACATTAATATATAAAGAAAAACCTTGAA
GTGCTGTATAGTGAAGTATAAATTAATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAATTATCTTGGTGGATCTATTTTATG
CATGACCTTTTAACCTTTGACTTTGCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATGATTTTAATAGCAAATATATTTTAT
AAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCATCTATCTATTCTGAATCATGTTTGGAAATAAAATTGCTCCATCTGGGAATGTGCTTT

>In-frame_TNFSF10_ENST00000420541_chr3_172241043_-_NCEH1_ENST00000538775_chr3_172365904_-_4166nt
ATTTCCTCACTGACTATAAAAGAATAGAGAAGGAAGGGCTTCAGTGACCGGCTGCCTGGCTGACTTACAGCAGTCAGACTCTGACAGGAT
CATGGCTATGATGGAGGTCCAGGGGGGACCCAGCCTGGGACAGACCTGCGTGCTGATCGTGATCTTCACAGTGCTCCTGCAGTCTCTCTG
TGTGGCTGTAACTTACGTGTACTTTACCAACGAGCTGAAGCAGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTGGCACT
GAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTGAAGGTGACCGACACAGACTTTGATGGTGTGGAAGT
CAGAGTGTTTGAAGGCCCTCCGAAGCCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCAAGTGC
AAGTGCGTCCTGGTCACCTTCAGATGAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCTGTCATTGTTTC
CATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCATGATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGT
CTTACAGAAGTATATGGTTGATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTTGGACAACAGTT
TACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATTTATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTA
TCAGCAAAATGTGAACACCCCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTATGACTTTGTGCA
GGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCTGCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGC
ATCCTTCACAAAGAACTACAAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTGGATGCCCGCTC
CGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACCTACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGG
CATCATGTATGCCAAGCGTTTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGTATGATTTTCAC
TAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTACATCAAGTGGCTAGATCAAAACCTGTAAAGGAGCAAAACTTC
CAGAAGCCTCGAGCCCCTCTTGACCTCCTACACCTGCTTTGGAAAGACATGCACTTTTTAGTTGACTAATTCTTCCTCCCATTCCCCTCT
ACTTGCGAGTTATGGAATTTCTATTCCATAACTGAAGTCTTTATGATAACCTAATTTTTAAAAATGAATTTGACTAACTTAAGTGCAAAA
CATGTAAATTTGGTTCCCAGAGTGGGCCAATCTCTCTGTTCTTGTTATCTTAGCCAACTATACTGATACCTACAGCTACAGAAAGCAGGA
CTAGGAACTGGAAATAACTTTGGGTCCTGCCTTCATTAGGACGTTCTTTTTAGAAGCAGTTCTTCCAGCTCTGGATCATAGAGTGACCTT
TAATAAGTTAAAAAAACGAGGACTCCTTAATTCTGCTAGAGTTAACCTTGAGTTCAGAGCAGTATTAAATGCGTGCACTTTCAGGTCAGT
ACTGGGGACCAAGTACCCTCTGGTCTTTTGTGAATGGATGGTTTTGTTTCCTATGGGAATTTTGGCAAAGGTTTTCTGGAAAGAACAAGT
TTCTCAAAGGACTTTCTTCCTCTAGAATGTTCATTTTATGAGATCGCTATCTGTAAGTCCAGTTGGATTACAGGAATACTTGAAAGTTAC
TTTCTACCACTATTAGAAAATATGAAGTCGCATGCACTGGATATCTATATATCATTAGGTTTTTGTTGTGTTTTTGGTTATGCTGTCCCC
CTTCTCCTTGGGGAGATATTTGGGAGCAAACTTATTTAGATTTAGAGTAAACTTTTCATTATAGAGCAAGTAAAAACAGACAAATGAAAC
AACCTAGTGTTTCACATAAAAATACTTCTGACATAAAGTACCAAGAGCAGTGTGAATATACTTGGCATAGTCAAAAAAGAAAATACATTT
AATATTAGTTCAAAATTGTTAAAAATACCTTTAGAAGGTCTAGTCTATTATTGAAAACTCAATTTTTTCACTTATATGGCTTTAAAATGG
AGCTATTTTGCTACAATATAATGTATTGTTTATTTTTTTAAGTTATTTAATGTTAATATACATAGCTAGACTTAAGGTTTTTCAGAAAGA
TGTCCATAATAAATATTAAAAACAATGGTATTTTTTAAAAAACTGCCTTAGGGTTTTAAAACCTTCCCTACAGTTATAACCACGTGTAAT
TTTGTGGAAATGATATAACAGCTATTAATACTACTATAACATAGGCATAAATATTTTCGTGTTTATATGCATATACAAGTTAAAATAATT
AGAAACTATGACTGCGCCTAGTAAAGTCATCTAGGTTTATAGTTCAGTAGCTTAGGCAAGGCACACACTGCTCATCTCCGCTTTTTAGGG
TCAGAGGAACACAAGCTCATGTTCTGAGTGAAGGGCGTACACTGGCACCTGGTGTTGCCTAGATCCCCCATCTCCTCCTTCCAGCCAGGT
CTGGAAGTTTCAACAGCCCAAGCTTAACTTCATGTAAAGTCTTCACTGCCAGTGGGAACATCTTTGACACAACAAGACACTCCAATTGTG
ATTTGAGTTGAGGATCTCTGCCTGCCTTCCTGCCGTCCTTCCTTCTTCCCCGATCCATGCTACTTTTAGGGGCTGCGGAGAGCAGCAGCA
GAGCTGAGTAATGATACAGGGCACCACGGAGAGAAAGTAGAACCATTTCACTCCTGGGAAGATGGGGTATTTCCCACTTCCAGCAACGAA
ATAACAAATGAAAAGTTGCATACTTATTGATGTATTGTATGAGCCAGTAGCATTTTATGTACAAAACAGAAGTCAATGCAACAGTATGTA
TGTGTGCCTGTGTGTGTATAAAAATAACCATTGAAGCTAACTTGCTAATGTACTTAGGCAAGCCACTTCCCATCTCTGGGCCTCGTCTTT
CCTCCCTCTAAAATCAAAGAGCTGAATTATGTGATCCTTGAGGTCTCTTCCACTTATAATACCAACTGTCTTGTCAGACTGGCAAATTAT
ATTGGCCTCTCCTTATGTGGTGGTTTTTTTGGTAGGTCATAGTTCCTTATACACAGACACCTGCATCATCGAAGGTCTTTTTTTCCTAAA
AAAAAAAAATGGGATTTTAGTTCTTATTCTGTGATAACTATCCTCCTCATATAATACTATTCTTTTTGACACCATTTGAAGGAACCAATA
TTTGGACCTTATTTTGAGGTTGTCTGTCTCGAAGAAAAAGAAAATAAAATGTATAGGCAGGGTTCCTTCAATTGGCATTTTCCCCAGAAT
TGTGAGCCAAAGCCTATAGTAATTGCAGACAGCAAATGATTCCGGATCTCTAAAAGGCTCTCTCAGATGAAAAGGGAGTAAAGGAAAAAA
GAGGTCAACCACTGTTTCTGATAATGTACTTGAGTTTCATTGTTCTTTTAGTTTGTATTCTTATAAAAAATGTTTACACTCTGCAGATTG
ATTTTTTTTTTTTAGTACTGTGGCTTTCTTTTCCTATTTTATGAAAAAAATGATAATCTTTTTGTAAAATTGTCTGTGAAATATAAACAT
TAATATATAAAGAAAAACCTTGAAGTGCTGTATAGTGAAGTATAAATTAATGTTTTATTGATTTGTGAAGAATTTAAGACTATTATATAA
TTATCTTGGTGGATCTATTTTATGCATGACCTTTTAACCTTTGACTTTGCTTATTTCCCACTACGAAGGGGAAGGTAGATTTTATGAATG
ATTTTAATAGCAAATATATTTTATAAAGTGAAAATCCAGTGTGGAGGTAGCAAAGCATCTATCTATTCTGAATCATGTTTGGAAATAAAA


Top

FusionGenePPI for TNFSF10_NCEH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TNFSF10ACP5, RBM48, TNFSF10, TNFRSF10D, TNFRSF10B, TNFRSF10A, CFLAR, CASP8, FADD, SOCS3, RIPK1, TNFAIP3, TRAF2, CASP3, ZDHHC17NCEH1LYPD3, EVI2A, TMEM38A, ZNRF1, SGTB, COQ9, UGT3A2, NRN1, LRRC3, TMEM231, ST3GAL6, CANT1, AMIGO1, ALG9, LMF2, STAM, BTN2A2, GLB1L2, UGT8, POMT1, C1QL1, EIF2AK3, CD1E, ITPRIP, FAM69A, TMTC3, CANX, CD151, GALNT7, CCPG1, ITGA7, FAM177A1, HYAL2, SCARB1, ST6GALNAC3, PGAP1, MTFP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TNFSF10_NCEH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TNFSF10_NCEH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTNFSF10C0033578Prostatic Neoplasms4CTD_human
HgeneTNFSF10C0017638Glioma2CTD_human
HgeneTNFSF10C0027659Neoplasms, Experimental2CTD_human
HgeneTNFSF10C0027686Pathologic Neovascularization2CTD_human
HgeneTNFSF10C0000786Spontaneous abortion1CTD_human
HgeneTNFSF10C0007134Renal Cell Carcinoma1CTD_human
HgeneTNFSF10C0009375Colonic Neoplasms1CTD_human
HgeneTNFSF10C0009404Colorectal Neoplasms1CTD_human
HgeneTNFSF10C0014170Endometrial Neoplasms1CTD_human
HgeneTNFSF10C0017636Glioblastoma1CTD_human
HgeneTNFSF10C0021400Influenza1CTD_human
HgeneTNFSF10C0022665Kidney Neoplasm1CTD_human
HgeneTNFSF10C0023418leukemia1CTD_human
HgeneTNFSF10C0023467Leukemia, Myelocytic, Acute1CTD_human
HgeneTNFSF10C0023903Liver neoplasms1CTD_human
HgeneTNFSF10C0024668Mammary Neoplasms, Experimental1CTD_human
HgeneTNFSF10C0027627Neoplasm Metastasis1CTD_human
HgeneTNFSF10C0027819Neuroblastoma1CTD_human
HgeneTNFSF10C0030297Pancreatic Neoplasm1CTD_human
HgeneTNFSF10C0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneTNFSF10C0919267ovarian neoplasm1CTD_human
HgeneTNFSF10C1458155Mammary Neoplasms1CTD_human
HgeneTNFSF10C2239176Liver carcinoma1CTD_human