FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38775

FusionGeneSummary for TMPRSS6_PPP6R3

check button Fusion gene summary
Fusion gene informationFusion gene name: TMPRSS6_PPP6R3
Fusion gene ID: 38775
HgeneTgene
Gene symbol

TMPRSS6

PPP6R3

Gene ID

164656

55291

Gene nametransmembrane serine protease 6protein phosphatase 6 regulatory subunit 3
SynonymsIRIDAC11orf23|PP6R3|SAP190|SAPL|SAPLa|SAPS3
Cytomap

22q12.3

11q13.2

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protease serine 6matriptase-2membrane-bound mosaic serine proteinase matriptase-2transmembrane protease, serine 6type II transmembrane serine protease 6serine/threonine-protein phosphatase 6 regulatory subunit 3SAPS domain family, member 3sporulation-induced transcript 4-associated protein SAPL
Modification date2018052320180520
UniProtAcc

Q8IU80

Q5H9R7

Ensembl transtripts involved in fusion geneENST00000381792, ENST00000346753, 
ENST00000406725, ENST00000406856, 
ENST00000442782, 
ENST00000393799, 
ENST00000530427, ENST00000393800, 
ENST00000534534, ENST00000524845, 
ENST00000265637, ENST00000524904, 
ENST00000393801, ENST00000265636, 
ENST00000529710, ENST00000527403, 
Fusion gene scores* DoF score3 X 3 X 2=1815 X 15 X 6=1350
# samples 419
** MAII scorelog2(4/18*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(19/1350*10)=-2.82888808360725
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMPRSS6 [Title/Abstract] AND PPP6R3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMPRSS6

GO:0006508

proteolysis

12149247

HgeneTMPRSS6

GO:0042730

fibrinolysis

12149247

TgenePPP6R3

GO:0043666

regulation of phosphoprotein phosphatase activity

16716191


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-2Y-A9GT-01ATMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
TCGALDLIHCTCGA-2Y-A9H2-01ATMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000381792ENST00000393799TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000530427TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000393800TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000534534TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000524845TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000265637TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000524904TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000393801TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000265636TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000529710TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000381792ENST00000527403TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
Frame-shitENST00000346753ENST00000393799TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000530427TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000393800TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000534534TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000524845TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000265637TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000524904TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000393801TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000265636TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000529710TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000346753ENST00000527403TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
Frame-shitENST00000406725ENST00000393799TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000530427TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000393800TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000534534TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000524845TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000265637TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000524904TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000393801TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000265636TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000529710TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406725ENST00000527403TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
Frame-shitENST00000406856ENST00000393799TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000530427TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000393800TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000534534TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000524845TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000265637TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000524904TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000393801TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000265636TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000529710TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000406856ENST00000527403TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
Frame-shitENST00000442782ENST00000393799TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000530427TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000393800TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000534534TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000524845TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000265637TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000524904TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000393801TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000265636TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000529710TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+
5CDS-intronENST00000442782ENST00000527403TMPRSS6chr22

37499256

-PPP6R3chr11

68377372

+

Top

FusionProtFeatures for TMPRSS6_PPP6R3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMPRSS6

Q8IU80

PPP6R3

Q5H9R7


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-2181_5576812Topological domainCytoplasmic
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-2191_5567825Topological domainCytoplasmic
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-2181_5567803Topological domainCytoplasmic
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-2191_5567825Topological domainCytoplasmic
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-21856_7676812TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218213_33676812DomainCUB 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218335_45276812DomainCUB 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218457_48976812DomainLDL-receptor class A 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218490_52676812DomainLDL-receptor class A 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218530_56776812DomainLDL-receptor class A 3
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-218577_81176812DomainPeptidase S1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-21884_20976812DomainSEA
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219213_33667825DomainCUB 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219335_45267825DomainCUB 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219457_48967825DomainLDL-receptor class A 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219490_52667825DomainLDL-receptor class A 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219530_56767825DomainLDL-receptor class A 3
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-219577_81167825DomainPeptidase S1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-21984_20967825DomainSEA
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218213_33667803DomainCUB 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218335_45267803DomainCUB 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218457_48967803DomainLDL-receptor class A 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218490_52667803DomainLDL-receptor class A 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218530_56767803DomainLDL-receptor class A 3
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-218577_81167803DomainPeptidase S1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-21884_20967803DomainSEA
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219213_33667825DomainCUB 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219335_45267825DomainCUB 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219457_48967825DomainLDL-receptor class A 1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219490_52667825DomainLDL-receptor class A 2
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219530_56767825DomainLDL-receptor class A 3
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-219577_81167825DomainPeptidase S1
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-21984_20967825DomainSEA
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000346753-21877_81176812Topological domainExtracellular
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-21977_81167825Topological domainExtracellular
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-21877_81167803Topological domainExtracellular
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-21977_81167825Topological domainExtracellular
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000381792-21956_7667825TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406725-21856_7667803TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS6chr22:37499256chr11:68377372ENST00000406856-21956_7667825TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for TMPRSS6_PPP6R3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMPRSS6_ENST00000381792_chr22_37499256_-_PPP6R3_ENST00000393799_chr11_68377372_+_125aa
MPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAGVLLWTFLAVRKGNCLPLKMLLVKTQRSVPR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMPRSS6_ENST00000381792_chr22_37499256_-_PPP6R3_ENST00000393799_chr11_68377372_+_377nt
ATGCCCGTGGCCGAGGCCCCCCAGGTGGCTGGCGGGCAGGGGGACGGAGGTGATGGCGAGGAAGCGGAGCCGGAGGGGATGTTCAAGGCC
TGTGAGGACTCCAAGAGAAAAGCCCGGGGCTACCTCCGCCTGGTGCCCCTGTTTGTGCTGCTGGCCCTGCTCGTGCTGGCTTCGGCGGGG
GTGCTACTCTGGTATTTCCTAGCAGTGAGGAAGGGAAACTGTCTACCTCTCAAGATGCTGCTTGTAAAGACGCAGAGGAGTGTCCCGAGA
CTGCAGAGGCGAAGTGCGCGGCGCCCAGGCCTCCCAGCAGCAGTCCCGAGCAGAGGACTGGCCAACCAAGCGCACCAGGTGACACTTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMPRSS6_ENST00000381792_chr22_37499256_-_PPP6R3_ENST00000393799_chr11_68377372_+_2730nt
CTTGAGCCAGACCCAGTCCAGCTCTGGTGCCTGCCCTCTGGTGCGAGCTGACCTGAGATGCACTTCCCTCCTCTGTGAGCTGTCTCGGCA
CCCACTTGCAGTCACTGCCGCCTGATGTTGTTACTCTTCCACTCCAAAAGGATGCCCGTGGCCGAGGCCCCCCAGGTGGCTGGCGGGCAG
GGGGACGGAGGTGATGGCGAGGAAGCGGAGCCGGAGGGGATGTTCAAGGCCTGTGAGGACTCCAAGAGAAAAGCCCGGGGCTACCTCCGC
CTGGTGCCCCTGTTTGTGCTGCTGGCCCTGCTCGTGCTGGCTTCGGCGGGGGTGCTACTCTGGTATTTCCTAGCAGTGAGGAAGGGAAAC
TGTCTACCTCTCAAGATGCTGCTTGTAAAGACGCAGAGGAGTGTCCCGAGACTGCAGAGGCGAAGTGCGCGGCGCCCAGGCCTCCCAGCA
GCAGTCCCGAGCAGAGGACTGGCCAACCAAGCGCACCAGGTGACACTTCAGTGAATGGCCCTGTATGACGGGTGACGTCTGCTGCTGCTG
ACTGAGGACTGCAGACCGCCACCACTCAGGGGCTCTGGAGGGGTCAGCTGGAGCCCACCAAGCTGTCACTGCTGCACTCACTCTGCAAGG
GATCAGGACCAGCAACCTTTATATTCTAGATTCTAAGACATTGTACAGAGAAATTCAGAAGTGTAAAAATATTGCACATTGACAAATACC
AAGAATTTTTGCGTATGTTTATATTGTATTGTTCTAAATAATGGGTAGCCTGTGAAATAAGATCTTGCCACCCATGTAATAATAGTAGTA
ATACTATAGTTAAAATGGCTGTAAGAATAGTTTTATAAAAGTGAATACACAGATCTATTGTATTTGAAACATAACTTTGACAATTATTAG
TGTGACCAAAGTATTAGGCGGTTTTCATACATTTTTCACCTTGTACAAAATTATGAATTCATTTTTCCTCCAGGCCGACAAGGAGTTGTA
GAATGAAAATGCCCTCTAAGTGTTATTTTGGTTGTTCTAACTTACAAAAGTGATTTTGAATAAGAAATATTTGGTGTTCTTTTTATAACC
AGTTTTTGATTGGTAATTGTTTTCTGTATTGTTTAAAACGGATCAAAAATGTAAGTCTATTGGTAGAGATTAAGTAAAGTATTTATTGCT
ACATCATAGTTGATAAATTGATGTTATCGTAAAGCCATATGTTCTGTTCAAGTCTTGTTTGCTTGAAATGATTATTCCTACAAGTGAAAC
ACTAGACTATTTGGAGTGTATATGGCTTGTGTTTTGGGATTTTTTTTTTTTTTTTTTGGCTTTTGTTTTTGTTTGTTTTTTTGTTTCATT
TGGTAGTTCATCTGCCTTTTAACCCATTCACCAAAATTTACCTTGTTAACAAGCATCACCAATGAACATTTCAGAGCAATCTGCATATTT
AACAGACCTAAAATAAATCCTATTAGGCAAGTCAGTTGAAAATGCTCGTGCTGCTAATGGAATTAGAGTGCGTTCATTTTACAGGCTAGT
ATTTTAAAAGTAGAAATCAAAATCTGGCACCGAAGCATGCTAATTGTTTACTGTACCTTGTGAGGTTTTCACTCATAAATTTAAACCAGT
GTATTTTTTTAGAACTGGTTTGTGTATATATATAGTGATTATGGATACTAATTCAATGTAATTTATAATTTTCTATGTCAATACAAAAAT
ACATCACAGCCTTCTCAAACAGCTCAAGCAATATATTGTATATTGCCATATCGTCTGGTGAAAGGGTTAAATTACTTCACCTCTTGCACT
TTTAGATGCAAATCAGTTTTTCATTTCTGTAATAGAAAATTATTCACGTATTTTTACATCATTTGTTTTTCCTGACCAGTATTTAAAACC
AAAAGGATATTCTGAAAAATGGCCAACAATTTTTTTAGAAGTAGCATCCCAAGCAGCGTGCCTAAACATTACATTGCATATGGAAATAAA
AGAATCAAACGTCTAATGCCTTATTATTTCTGATTTCCTTTTTCATTTTAAGTGGTGTGGAGATTCCAGCACTCCCAGGACAGTGGAGTC
AGCAGTAAGCCCTGGGACAGGTGGCAAGGGTGGGTCCCTTGACCTTTGCACGCCTCCTCAGGAACCCCCTTTCCCGGGTGAGCCCCTCTC
TGAAGAGACTGTCCTTGGGCCTCCTCTGGAAGCAGCACCCCCAGAGGACAGGGCTCCTCCTGCTTGCCTCAGGGCTGCCTGACTTGAATG
GCGTTGGACCTCGGGGATTACTGGTAGATAATATGCTCTGGTCTCGCCTGGTGGTGAGTTTTGCCAGCCATGGCCAGGGTTTGGCTCCAC
TGGTGGCACACGTGGCCTCCGTGGTATGGACCTGGTGGCTTCTCCATCCCACTGTGGCCTCTGTGGTATGGACCTGGTGGCTTCTCCATC
CTACCCAAGGTAACAGTGTCTTGCTTCATCCCACTGACTGCTGGGAGAGAGCCTCTGGGACTTTTCTTTGGGGCATCATTTTGTTTTGTC
TTTCGTAGCAGGGAAAGGATATGACAATGGGGAGGACAGTTCTTTTGGAGGTTGGAGGGGCCAAGCCAAGGACAGGAGCAAGTGTGCCCT
CATTTTGTTTCTACTTTTAATTTCTGTGTGTTGGCCATACTGAATTATGAGACTAACAGATGTCTACAATACAATACCTGTATTCAAAAT


Top

FusionGenePPI for TMPRSS6_PPP6R3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMPRSS6PPP6R3KDM6A, TNFAIP3, USP21, USP36, USP49, PPP6C, PRKDC, HDAC1, HDAC2, ELAVL1, SIRT7, TERF2IP, TINF2, TFAP4, GRK5, PFAS, BRCA1, ECT2, NOTCH1, LATS1, GPSM1, HDAC11, USP10, ANKRD28, MOB1A, MOB1B, ACAD11, ANKRD44, ANKRD52, AP1B1, AP2A1, AP2A2, AURKA, DNAJC11, ECH1, ERLIN2, PPP6R1, PPP6R2, CDC37, ENAH, ETFA, HSP90AA1, HSP90AB1, RUVBL2, SRRT, TPM1, USP7, CSNK1E, SNAI2, RNF2, GPHA2, RPS6KB2, UNK, DIEXF, NSUN5, EIF4A3, TIPRL, NTRK1, CEP44, CEP19, XPO1, ZNRF2, ZNF746, TRMT2A, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMPRSS6_PPP6R3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMPRSS6_PPP6R3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMPRSS6C0085576Iron-Refractory Iron Deficiency Anemia7CTD_human;ORPHANET;UNIPROT
HgeneTMPRSS6C0162316Iron deficiency anemia2CTD_human