FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38761

FusionGeneSummary for TMPRSS2_MORC3

check button Fusion gene summary
Fusion gene informationFusion gene name: TMPRSS2_MORC3
Fusion gene ID: 38761
HgeneTgene
Gene symbol

TMPRSS2

MORC3

Gene ID

7113

23515

Gene nametransmembrane serine protease 2MORC family CW-type zinc finger 3
SynonymsPP9284|PRSS10NXP2|ZCW5|ZCWCC3
Cytomap

21q22.3

21q22.12

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2MORC family CW-type zinc finger protein 3nuclear matrix protein 2nuclear matrix protein NXP2zinc finger CW-type coiled-coil domain protein 3zinc finger, CW type with coiled-coil domain 3
Modification date2018052320180522
UniProtAcc

O15393

Q14149

Ensembl transtripts involved in fusion geneENST00000332149, ENST00000398585, 
ENST00000458356, ENST00000497881, 
ENST00000400485, ENST00000487909, 
Fusion gene scores* DoF score29 X 21 X 6=36545 X 5 X 3=75
# samples 2285
** MAII scorelog2(228/3654*10)=-0.680442809575384
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMPRSS2 [Title/Abstract] AND MORC3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

HgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843

TgeneMORC3

GO:0006468

protein phosphorylation

17332504

TgeneMORC3

GO:0007569

cell aging

17332504

TgeneMORC3

GO:0018105

peptidyl-serine phosphorylation

17332504

TgeneMORC3

GO:0048147

negative regulation of fibroblast proliferation

17332504

TgeneMORC3

GO:0050821

protein stabilization

17332504

TgeneMORC3

GO:0051457

maintenance of protein location in nucleus

17332504


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-CH-5762-01ATMPRSS2chr21

42870046

-MORC3chr21

37705944

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332149ENST00000400485TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
5CDS-intronENST00000332149ENST00000487909TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
In-frameENST00000398585ENST00000400485TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
5CDS-intronENST00000398585ENST00000487909TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
Frame-shitENST00000458356ENST00000400485TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
5CDS-intronENST00000458356ENST00000487909TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
5UTR-3CDSENST00000497881ENST00000400485TMPRSS2chr21

42870046

-MORC3chr21

37705944

+
5UTR-intronENST00000497881ENST00000487909TMPRSS2chr21

42870046

-MORC3chr21

37705944

+

Top

FusionProtFeatures for TMPRSS2_MORC3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMPRSS2

O15393

MORC3

Q14149

Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}. Nuclear factor which forms MORC3-NBs (nuclear bodies)via an ATP-dependent mechanism (PubMed:20501696). SumoylatedMORC3-NBs can also associate with PML-NBs (PubMed:20501696).Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity(PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May berequired for influenza A transcription during viral infection(PubMed:26202233). {ECO:0000269|PubMed:11927593,ECO:0000269|PubMed:17332504, ECO:0000269|PubMed:20501696,ECO:0000269|PubMed:26202233}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMORC3chr21:42870046chr21:37705944ENST00000400485+017686_87713940Coiled coilOntology_term=ECO:0000255
TgeneMORC3chr21:42870046chr21:37705944ENST00000400485+017326_35313940RegionNuclear matrix binding
TgeneMORC3chr21:42870046chr21:37705944ENST00000400485+017500_59113940RegionRNA binding
TgeneMORC3chr21:42870046chr21:37705944ENST00000400485+017404_45413940Zinc fingerCW-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-214112_1495493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-214150_2425493DomainSRCR
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-214256_4895493DomainPeptidase S1
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-214112_14942530DomainLDL-receptor class A
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-214150_24242530DomainSRCR
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-214256_48942530DomainPeptidase S1
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-214112_1495493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-214150_2425493DomainSRCR
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-214256_4895493DomainPeptidase S1
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-214106_4925493Topological domainExtracellular
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-2141_845493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-214106_49242530Topological domainExtracellular
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-2141_8442530Topological domainCytoplasmic
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-214106_4925493Topological domainExtracellular
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-2141_845493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000332149-21485_1055493TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000398585-21485_10542530TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42870046chr21:37705944ENST00000458356-21485_1055493TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for TMPRSS2_MORC3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMPRSS2_ENST00000332149_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_932aa
MALNSLCPKFLHTNSTSHTWPFSAVAELIDNATDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVG
LTGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAI
IGKKGTRIIIWNLRSYKNATEFDFEKDKTDIRIPEDLDEITGKKGYKKQERMDQIAPESDTSLRATCSILTLKPRMQIILRGQKVKTQLV
SKSLAYIERDVTRPKFLSKTVRITFGFNCRNKDHTGIMMTHRNRLIKATEKVGCQLRANNMGVGVVGIIECNFLKPTHNKQDFDTTNEYR
LTITALGEKLNDYWNEMKVKKNTETPLNLPVEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWTCSNNPDPQFRNCEVPEEPEDEDLV
HPTTEKTYKKTNKEKFRIRQPEMIPRINAELLFRPTALSTPSFSSPKESVPRRHLSEGTNSTATRLLNNHQVPPQSEPESNSLKRRLSTR
SSILNAKNRRLSSQFENSVTKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQSHVEQGGVQVEFVGDSEPCGQTGSTSTSSSRCDQGNTA
ATQTEVPSLVVKKEETVEDEIDVRNDAVILPSCVEAEAKIHETQETTDKSADDAGCQLQELRNQLLLVTEEKENTKRQCHMFTDQIKVLQ
QRILEMNDKTVKKETCHQSTETDAVFLLESINGKSESPDHMVSQTQQALEEIERLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDD
VFRQLDKCSIERDQTKSEVELLEMEKSQIRSQCEELKTEVEQLKSTNQQTATDVSTSSNIEESVNHMDGESLKLRSLRVNVGQLLAMIVP

>In-frame_TMPRSS2_ENST00000398585_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_969aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSLCPKFLHTNSTSHTWPFSAVAELIDNATDPDVNAKQIWIDKTVINDHI
CLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLTGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFN
KHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKTDIRIPEDLDEITGKKGYKKQERMD
QIAPESDTSLRATCSILTLKPRMQIILRGQKVKTQLVSKSLAYIERDVTRPKFLSKTVRITFGFNCRNKDHTGIMMTHRNRLIKATEKVG
CQLRANNMGVGVVGIIECNFLKPTHNKQDFDTTNEYRLTITALGEKLNDYWNEMKVKKNTETPLNLPVEDIQKRPDQTWVQCDACLKWRK
LPDGMDQLPEKWTCSNNPDPQFRNCEVPEEPEDEDLVHPTTEKTYKKTNKEKFRIRQPEMIPRINAELLFRPTALSTPSFSSPKESVPRR
HLSEGTNSTATRLLNNHQVPPQSEPESNSLKRRLSTRSSILNAKNRRLSSQFENSVTKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQS
HVEQGGVQVEFVGDSEPCGQTGSTSTSSSRCDQGNTAATQTEVPSLVVKKEETVEDEIDVRNDAVILPSCVEAEAKIHETQETTDKSADD
AGCQLQELRNQLLLVTEEKENTKRQCHMFTDQIKVLQQRILEMNDKTVKKETCHQSTETDAVFLLESINGKSESPDHMVSQTQQALEEIE
RLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDDVFRQLDKCSIERDQTKSEVELLEMEKSQIRSQCEELKTEVEQLKSTNQQTATD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMPRSS2_ENST00000332149_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_2796nt
ATGGCTTTGAACTCACTTTGCCCGAAGTTTTTACATACAAATTCTACTAGTCACACCTGGCCATTCAGTGCAGTTGCTGAATTAATAGAT
AATGCTTATGATCCTGATGTGAACGCTAAACAAATATGGATTGACAAAACAGTGATAAATGACCATATATGCTTGACATTCACCGACAAT
GGGAATGGTATGACTTCTGATAAATTACATAAAATGCTAAGCTTTGGCTTCAGTGACAAAGTCACCATGAATGGTCATGTCCCAGTTGGA
TTATATGGGAATGGCTTCAAGTCGGGTTCTATGCGTCTGGGTAAAGACGCAATCGTTTTTACCAAAAATGGAGAAAGCATGAGCGTGGGC
CTTTTGTCTCAGACCTACTTGGAAGTCATAAAAGCGGAGCATGTTGTTGTTCCAATAGTGGCATTCAACAAGCACCGACAGATGATTAAT
TTAGCAGAATCAAAAGCCAGCCTTGCTGCAATTCTGGAACATTCTCTGTTTTCCACGGAACAGAAGTTACTGGCAGAACTTGATGCTATT
ATAGGCAAGAAGGGGACGAGGATCATCATTTGGAATCTTAGAAGCTACAAAAATGCAACAGAGTTCGATTTTGAAAAGGATAAATATGAT
ATCAGAATTCCCGAGGATTTAGATGAGATAACAGGGAAGAAGGGGTACAAGAAGCAGGAAAGGATGGACCAGATTGCCCCTGAGAGTGAC
TATTCCCTGAGGGCTTATTGCAGTATATTATATCTAAAGCCAAGAATGCAGATCATCCTACGTGGACAGAAAGTGAAGACACAGCTGGTT
TCGAAGAGTCTTGCCTACATCGAACGTGATGTTTATCGACCAAAATTTTTATCTAAAACAGTGAGAATTACCTTTGGATTCAACTGCAGA
AATAAAGATCATTATGGGATAATGATGTATCACAGAAATAGACTCATCAAAGCTTATGAAAAAGTTGGATGTCAGTTAAGGGCAAACAAC
ATGGGTGTTGGAGTGGTTGGAATTATAGAGTGTAATTTCCTTAAGCCAACTCATAATAAACAAGATTTCGACTATACTAATGAGTACAGA
CTTACAATAACAGCACTAGGAGAAAAGCTGAATGATTACTGGAATGAAATGAAAGTGAAGAAAAATACAGAATATCCTCTAAATTTGCCA
GTTGAAGATATACAGAAGCGTCCTGATCAGACATGGGTTCAGTGTGATGCCTGTCTAAAGTGGCGGAAATTACCTGATGGGATGGATCAA
CTTCCTGAAAAATGGTATTGCTCCAATAACCCTGACCCACAGTTCAGAAATTGTGAGGTTCCAGAAGAACCTGAAGATGAGGATTTGGTA
CATCCCACTTATGAAAAAACCTACAAAAAGACCAACAAGGAAAAATTCAGGATCAGACAACCGGAAATGATCCCTCGGATTAATGCTGAA
CTGTTGTTTCGGCCAACTGCTCTTTCAACTCCAAGCTTTTCTTCTCCTAAGGAAAGTGTTCCAAGAAGACATCTTTCAGAAGGAACAAAT
TCTTATGCGACAAGACTTCTAAATAATCATCAAGTTCCACCTCAGTCTGAACCTGAGAGCAACAGCTTGAAACGGAGACTTTCTACTCGT
TCCTCAATTTTGAATGCAAAGAATCGGAGATTGAGTAGTCAGTTTGAAAATTCAGTTTATAAAGGTGATGATGATGATGAAGATGTCATC
ATCTTAGAAGAAAACAGTACCCCCAAACCTGCAGTAGATCATGATATTGACATGAAATCAGAACAGAGTCACGTTGAGCAAGGTGGTGTT
CAGGTTGAGTTTGTGGGTGACAGTGAACCTTGTGGCCAGACTGGTTCAACAAGCACCTCATCATCCCGATGCGACCAGGGAAATACTGCA
GCTACCCAGACTGAAGTACCAAGTTTAGTTGTTAAAAAAGAAGAAACTGTTGAAGACGAGATAGACGTAAGAAATGATGCAGTGATTCTG
CCCTCCTGTGTAGAAGCTGAAGCAAAGATACATGAAACCCAGGAAACCACCGATAAATCTGCAGATGATGCAGGCTGCCAATTACAAGAA
CTGAGAAACCAGCTACTCCTTGTCACTGAGGAAAAAGAGAATTATAAAAGACAGTGTCATATGTTTACTGATCAAATCAAAGTGTTACAA
CAGAGGATACTAGAAATGAATGACAAGTATGTTAAGAAAGAAACTTGCCATCAGTCCACTGAAACCGATGCTGTATTTTTACTTGAAAGT
ATTAATGGCAAATCTGAAAGTCCAGACCATATGGTATCTCAGTATCAGCAAGCTTTGGAAGAAATAGAAAGGCTGAAAAAACAATGTAGT
GCTTTGCAACATGTAAAGGCTGAATGCAGCCAGTGTTCCAATAATGAGAGTAAAAGTGAAATGGATGAGATGGCTGTGCAGCTTGACGAT
GTGTTTAGACAACTGGACAAATGCAGTATTGAGAGGGACCAGTATAAAAGTGAGGTTGAATTGCTGGAAATGGAAAAGTCACAAATCCGT
TCACAGTGTGAAGAACTCAAAACTGAAGTAGAACAGTTAAAATCTACAAATCAACAGACGGCAACAGATGTTTCAACATCAAGTAACATT
GAGGAGTCTGTAAATCATATGGATGGAGAAAGCCTCAAACTCCGATCTCTTCGAGTTAACGTAGGACAACTGCTGGCTATGATTGTGCCT
GATCTTGATCTTCAGCAAGTGAATTACGATGTTGATGTAGTTGATGAGATTTTAGGACAAGTTGTTGAACAAATGAGTGAAATCAGTAGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_2907nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCACTTTGCCCGAAGTTTTTACATACAAATTCTACTAGTCACACCTGGCCATTCAGT
GCAGTTGCTGAATTAATAGATAATGCTTATGATCCTGATGTGAACGCTAAACAAATATGGATTGACAAAACAGTGATAAATGACCATATA
TGCTTGACATTCACCGACAATGGGAATGGTATGACTTCTGATAAATTACATAAAATGCTAAGCTTTGGCTTCAGTGACAAAGTCACCATG
AATGGTCATGTCCCAGTTGGATTATATGGGAATGGCTTCAAGTCGGGTTCTATGCGTCTGGGTAAAGACGCAATCGTTTTTACCAAAAAT
GGAGAAAGCATGAGCGTGGGCCTTTTGTCTCAGACCTACTTGGAAGTCATAAAAGCGGAGCATGTTGTTGTTCCAATAGTGGCATTCAAC
AAGCACCGACAGATGATTAATTTAGCAGAATCAAAAGCCAGCCTTGCTGCAATTCTGGAACATTCTCTGTTTTCCACGGAACAGAAGTTA
CTGGCAGAACTTGATGCTATTATAGGCAAGAAGGGGACGAGGATCATCATTTGGAATCTTAGAAGCTACAAAAATGCAACAGAGTTCGAT
TTTGAAAAGGATAAATATGATATCAGAATTCCCGAGGATTTAGATGAGATAACAGGGAAGAAGGGGTACAAGAAGCAGGAAAGGATGGAC
CAGATTGCCCCTGAGAGTGACTATTCCCTGAGGGCTTATTGCAGTATATTATATCTAAAGCCAAGAATGCAGATCATCCTACGTGGACAG
AAAGTGAAGACACAGCTGGTTTCGAAGAGTCTTGCCTACATCGAACGTGATGTTTATCGACCAAAATTTTTATCTAAAACAGTGAGAATT
ACCTTTGGATTCAACTGCAGAAATAAAGATCATTATGGGATAATGATGTATCACAGAAATAGACTCATCAAAGCTTATGAAAAAGTTGGA
TGTCAGTTAAGGGCAAACAACATGGGTGTTGGAGTGGTTGGAATTATAGAGTGTAATTTCCTTAAGCCAACTCATAATAAACAAGATTTC
GACTATACTAATGAGTACAGACTTACAATAACAGCACTAGGAGAAAAGCTGAATGATTACTGGAATGAAATGAAAGTGAAGAAAAATACA
GAATATCCTCTAAATTTGCCAGTTGAAGATATACAGAAGCGTCCTGATCAGACATGGGTTCAGTGTGATGCCTGTCTAAAGTGGCGGAAA
TTACCTGATGGGATGGATCAACTTCCTGAAAAATGGTATTGCTCCAATAACCCTGACCCACAGTTCAGAAATTGTGAGGTTCCAGAAGAA
CCTGAAGATGAGGATTTGGTACATCCCACTTATGAAAAAACCTACAAAAAGACCAACAAGGAAAAATTCAGGATCAGACAACCGGAAATG
ATCCCTCGGATTAATGCTGAACTGTTGTTTCGGCCAACTGCTCTTTCAACTCCAAGCTTTTCTTCTCCTAAGGAAAGTGTTCCAAGAAGA
CATCTTTCAGAAGGAACAAATTCTTATGCGACAAGACTTCTAAATAATCATCAAGTTCCACCTCAGTCTGAACCTGAGAGCAACAGCTTG
AAACGGAGACTTTCTACTCGTTCCTCAATTTTGAATGCAAAGAATCGGAGATTGAGTAGTCAGTTTGAAAATTCAGTTTATAAAGGTGAT
GATGATGATGAAGATGTCATCATCTTAGAAGAAAACAGTACCCCCAAACCTGCAGTAGATCATGATATTGACATGAAATCAGAACAGAGT
CACGTTGAGCAAGGTGGTGTTCAGGTTGAGTTTGTGGGTGACAGTGAACCTTGTGGCCAGACTGGTTCAACAAGCACCTCATCATCCCGA
TGCGACCAGGGAAATACTGCAGCTACCCAGACTGAAGTACCAAGTTTAGTTGTTAAAAAAGAAGAAACTGTTGAAGACGAGATAGACGTA
AGAAATGATGCAGTGATTCTGCCCTCCTGTGTAGAAGCTGAAGCAAAGATACATGAAACCCAGGAAACCACCGATAAATCTGCAGATGAT
GCAGGCTGCCAATTACAAGAACTGAGAAACCAGCTACTCCTTGTCACTGAGGAAAAAGAGAATTATAAAAGACAGTGTCATATGTTTACT
GATCAAATCAAAGTGTTACAACAGAGGATACTAGAAATGAATGACAAGTATGTTAAGAAAGAAACTTGCCATCAGTCCACTGAAACCGAT
GCTGTATTTTTACTTGAAAGTATTAATGGCAAATCTGAAAGTCCAGACCATATGGTATCTCAGTATCAGCAAGCTTTGGAAGAAATAGAA
AGGCTGAAAAAACAATGTAGTGCTTTGCAACATGTAAAGGCTGAATGCAGCCAGTGTTCCAATAATGAGAGTAAAAGTGAAATGGATGAG
ATGGCTGTGCAGCTTGACGATGTGTTTAGACAACTGGACAAATGCAGTATTGAGAGGGACCAGTATAAAAGTGAGGTTGAATTGCTGGAA
ATGGAAAAGTCACAAATCCGTTCACAGTGTGAAGAACTCAAAACTGAAGTAGAACAGTTAAAATCTACAAATCAACAGACGGCAACAGAT
GTTTCAACATCAAGTAACATTGAGGAGTCTGTAAATCATATGGATGGAGAAAGCCTCAAACTCCGATCTCTTCGAGTTAACGTAGGACAA
CTGCTGGCTATGATTGTGCCTGATCTTGATCTTCAGCAAGTGAATTACGATGTTGATGTAGTTGATGAGATTTTAGGACAAGTTGTTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMPRSS2_ENST00000332149_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_4281nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCACTTTGCCCGAAGTTTTTACATACAAATTCT
ACTAGTCACACCTGGCCATTCAGTGCAGTTGCTGAATTAATAGATAATGCTTATGATCCTGATGTGAACGCTAAACAAATATGGATTGAC
AAAACAGTGATAAATGACCATATATGCTTGACATTCACCGACAATGGGAATGGTATGACTTCTGATAAATTACATAAAATGCTAAGCTTT
GGCTTCAGTGACAAAGTCACCATGAATGGTCATGTCCCAGTTGGATTATATGGGAATGGCTTCAAGTCGGGTTCTATGCGTCTGGGTAAA
GACGCAATCGTTTTTACCAAAAATGGAGAAAGCATGAGCGTGGGCCTTTTGTCTCAGACCTACTTGGAAGTCATAAAAGCGGAGCATGTT
GTTGTTCCAATAGTGGCATTCAACAAGCACCGACAGATGATTAATTTAGCAGAATCAAAAGCCAGCCTTGCTGCAATTCTGGAACATTCT
CTGTTTTCCACGGAACAGAAGTTACTGGCAGAACTTGATGCTATTATAGGCAAGAAGGGGACGAGGATCATCATTTGGAATCTTAGAAGC
TACAAAAATGCAACAGAGTTCGATTTTGAAAAGGATAAATATGATATCAGAATTCCCGAGGATTTAGATGAGATAACAGGGAAGAAGGGG
TACAAGAAGCAGGAAAGGATGGACCAGATTGCCCCTGAGAGTGACTATTCCCTGAGGGCTTATTGCAGTATATTATATCTAAAGCCAAGA
ATGCAGATCATCCTACGTGGACAGAAAGTGAAGACACAGCTGGTTTCGAAGAGTCTTGCCTACATCGAACGTGATGTTTATCGACCAAAA
TTTTTATCTAAAACAGTGAGAATTACCTTTGGATTCAACTGCAGAAATAAAGATCATTATGGGATAATGATGTATCACAGAAATAGACTC
ATCAAAGCTTATGAAAAAGTTGGATGTCAGTTAAGGGCAAACAACATGGGTGTTGGAGTGGTTGGAATTATAGAGTGTAATTTCCTTAAG
CCAACTCATAATAAACAAGATTTCGACTATACTAATGAGTACAGACTTACAATAACAGCACTAGGAGAAAAGCTGAATGATTACTGGAAT
GAAATGAAAGTGAAGAAAAATACAGAATATCCTCTAAATTTGCCAGTTGAAGATATACAGAAGCGTCCTGATCAGACATGGGTTCAGTGT
GATGCCTGTCTAAAGTGGCGGAAATTACCTGATGGGATGGATCAACTTCCTGAAAAATGGTATTGCTCCAATAACCCTGACCCACAGTTC
AGAAATTGTGAGGTTCCAGAAGAACCTGAAGATGAGGATTTGGTACATCCCACTTATGAAAAAACCTACAAAAAGACCAACAAGGAAAAA
TTCAGGATCAGACAACCGGAAATGATCCCTCGGATTAATGCTGAACTGTTGTTTCGGCCAACTGCTCTTTCAACTCCAAGCTTTTCTTCT
CCTAAGGAAAGTGTTCCAAGAAGACATCTTTCAGAAGGAACAAATTCTTATGCGACAAGACTTCTAAATAATCATCAAGTTCCACCTCAG
TCTGAACCTGAGAGCAACAGCTTGAAACGGAGACTTTCTACTCGTTCCTCAATTTTGAATGCAAAGAATCGGAGATTGAGTAGTCAGTTT
GAAAATTCAGTTTATAAAGGTGATGATGATGATGAAGATGTCATCATCTTAGAAGAAAACAGTACCCCCAAACCTGCAGTAGATCATGAT
ATTGACATGAAATCAGAACAGAGTCACGTTGAGCAAGGTGGTGTTCAGGTTGAGTTTGTGGGTGACAGTGAACCTTGTGGCCAGACTGGT
TCAACAAGCACCTCATCATCCCGATGCGACCAGGGAAATACTGCAGCTACCCAGACTGAAGTACCAAGTTTAGTTGTTAAAAAAGAAGAA
ACTGTTGAAGACGAGATAGACGTAAGAAATGATGCAGTGATTCTGCCCTCCTGTGTAGAAGCTGAAGCAAAGATACATGAAACCCAGGAA
ACCACCGATAAATCTGCAGATGATGCAGGCTGCCAATTACAAGAACTGAGAAACCAGCTACTCCTTGTCACTGAGGAAAAAGAGAATTAT
AAAAGACAGTGTCATATGTTTACTGATCAAATCAAAGTGTTACAACAGAGGATACTAGAAATGAATGACAAGTATGTTAAGAAAGAAACT
TGCCATCAGTCCACTGAAACCGATGCTGTATTTTTACTTGAAAGTATTAATGGCAAATCTGAAAGTCCAGACCATATGGTATCTCAGTAT
CAGCAAGCTTTGGAAGAAATAGAAAGGCTGAAAAAACAATGTAGTGCTTTGCAACATGTAAAGGCTGAATGCAGCCAGTGTTCCAATAAT
GAGAGTAAAAGTGAAATGGATGAGATGGCTGTGCAGCTTGACGATGTGTTTAGACAACTGGACAAATGCAGTATTGAGAGGGACCAGTAT
AAAAGTGAGGTTGAATTGCTGGAAATGGAAAAGTCACAAATCCGTTCACAGTGTGAAGAACTCAAAACTGAAGTAGAACAGTTAAAATCT
ACAAATCAACAGACGGCAACAGATGTTTCAACATCAAGTAACATTGAGGAGTCTGTAAATCATATGGATGGAGAAAGCCTCAAACTCCGA
TCTCTTCGAGTTAACGTAGGACAACTGCTGGCTATGATTGTGCCTGATCTTGATCTTCAGCAAGTGAATTACGATGTTGATGTAGTTGAT
GAGATTTTAGGACAAGTTGTTGAACAAATGAGTGAAATCAGTAGTACTTAAAGTATATGTTATGTAAGATAAAATATTTGCTCAATTCTT
TTGGTTGTACAGCTTTCAAAATATAATTAATTTTGTTTTATAGATATGATAGGCAACAGACTGAAAACCATAATCTTTACTGTATTCTAT
GCATTCAAATGTGGTCACAAATATTGTGGACACATTATCTTATGTTTTGAAATACCTGTGAATTGTTGGCATTGAGCAGCTGAAGCTAAC
TCATGACTCTGTTTTGAATGTAAATATTTGTAATTAAGCCTGCACATATTTTTTTATTGCCCTAGAGTACTCAAGTGTTTTTCACCAAGA
GCTTTTCAGGTTGCCCCTAAGCTTTGTGCAATTTTTTCTGGTTCCCCAAAGTGTATTTTTCTCTAAGTCGAGGGCTATGCCATAATACAA
ATGGAAATGTTACCTTTGATTTTCTTATAAAGGAGTTTAAATAGGATTTTTAAATAATGTAGTAACACTCCTGATACAACTCTGGTTATA
AGTGAATTGAGCATTAATGTTTCTTTTGTATAAATTCCTGTCCTGAAATATTTTATTCATGAAAATAAGGTAAGCAAAAACCAACTCCAT
TTTGCCAGGATTTTGTTGTGCTGAGATTGCCAATCACGGTTAAACACAAAGTGTTTTTATAGAATGAAGAAACAGTCTTTAACAGAAAAA
AGGTATTGAAATATTAAATGGCCACCAAGTTTACTTTGAAGCCCATTTTTGGCTGTTTAGTCAGCATGAAGTGGGCATGATAATTTTTTA
ATATTTCTTTTTGTGAAATTTCCTGTACAGCCTTTTGTAGGATTACTACAGGTTAATGTGAGTTGAGGAAGACAGTCTTTCTCAAACAAT
ACTACATACCTTTTATTATATTACAAACCTAAGTGTTTTATATCCTAGAGTCAAGGAACAAATTTCCTTAGGATTATAGTATTACATGCC
ATAAAATACTATGCTTTATTGGTCCCATGTTTTGTGCAATTTTAAAGAGATGGCTTTCTATTAAGTATAAACTATGTATATATAAGAACC
ATATTTTCCACAACTAAAATGTGCATTATTTTTTCCAAAGTTTTATCATTGCTATTTATTTTTACCTTTGTTTTTGAACATTCAATCCGT
TCATTTTGTATGTATGCTTAATACGTGTCGGTCATATACAGTATTGAATTTTTACTGTATAGTAATTCTGGAAAGAGCAAATAAATGAAG
ATTGTTTTTATTTGCCTGATAAAGTAATTGAAAGTGTATTTTTGGTATGAAGCTGGTTTTCTGTCACAATTGTAATTTCCCAAATTTTAA

>In-frame_TMPRSS2_ENST00000398585_chr21_42870046_-_MORC3_ENST00000400485_chr21_37705944_+_4318nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCACTTTGCCCGAAGTTTTTACATACAAATTCTACTAGTCACACCTGGCCATTCAGTGCAGTTGCTGAATTAATAGATAATGCTTA
TGATCCTGATGTGAACGCTAAACAAATATGGATTGACAAAACAGTGATAAATGACCATATATGCTTGACATTCACCGACAATGGGAATGG
TATGACTTCTGATAAATTACATAAAATGCTAAGCTTTGGCTTCAGTGACAAAGTCACCATGAATGGTCATGTCCCAGTTGGATTATATGG
GAATGGCTTCAAGTCGGGTTCTATGCGTCTGGGTAAAGACGCAATCGTTTTTACCAAAAATGGAGAAAGCATGAGCGTGGGCCTTTTGTC
TCAGACCTACTTGGAAGTCATAAAAGCGGAGCATGTTGTTGTTCCAATAGTGGCATTCAACAAGCACCGACAGATGATTAATTTAGCAGA
ATCAAAAGCCAGCCTTGCTGCAATTCTGGAACATTCTCTGTTTTCCACGGAACAGAAGTTACTGGCAGAACTTGATGCTATTATAGGCAA
GAAGGGGACGAGGATCATCATTTGGAATCTTAGAAGCTACAAAAATGCAACAGAGTTCGATTTTGAAAAGGATAAATATGATATCAGAAT
TCCCGAGGATTTAGATGAGATAACAGGGAAGAAGGGGTACAAGAAGCAGGAAAGGATGGACCAGATTGCCCCTGAGAGTGACTATTCCCT
GAGGGCTTATTGCAGTATATTATATCTAAAGCCAAGAATGCAGATCATCCTACGTGGACAGAAAGTGAAGACACAGCTGGTTTCGAAGAG
TCTTGCCTACATCGAACGTGATGTTTATCGACCAAAATTTTTATCTAAAACAGTGAGAATTACCTTTGGATTCAACTGCAGAAATAAAGA
TCATTATGGGATAATGATGTATCACAGAAATAGACTCATCAAAGCTTATGAAAAAGTTGGATGTCAGTTAAGGGCAAACAACATGGGTGT
TGGAGTGGTTGGAATTATAGAGTGTAATTTCCTTAAGCCAACTCATAATAAACAAGATTTCGACTATACTAATGAGTACAGACTTACAAT
AACAGCACTAGGAGAAAAGCTGAATGATTACTGGAATGAAATGAAAGTGAAGAAAAATACAGAATATCCTCTAAATTTGCCAGTTGAAGA
TATACAGAAGCGTCCTGATCAGACATGGGTTCAGTGTGATGCCTGTCTAAAGTGGCGGAAATTACCTGATGGGATGGATCAACTTCCTGA
AAAATGGTATTGCTCCAATAACCCTGACCCACAGTTCAGAAATTGTGAGGTTCCAGAAGAACCTGAAGATGAGGATTTGGTACATCCCAC
TTATGAAAAAACCTACAAAAAGACCAACAAGGAAAAATTCAGGATCAGACAACCGGAAATGATCCCTCGGATTAATGCTGAACTGTTGTT
TCGGCCAACTGCTCTTTCAACTCCAAGCTTTTCTTCTCCTAAGGAAAGTGTTCCAAGAAGACATCTTTCAGAAGGAACAAATTCTTATGC
GACAAGACTTCTAAATAATCATCAAGTTCCACCTCAGTCTGAACCTGAGAGCAACAGCTTGAAACGGAGACTTTCTACTCGTTCCTCAAT
TTTGAATGCAAAGAATCGGAGATTGAGTAGTCAGTTTGAAAATTCAGTTTATAAAGGTGATGATGATGATGAAGATGTCATCATCTTAGA
AGAAAACAGTACCCCCAAACCTGCAGTAGATCATGATATTGACATGAAATCAGAACAGAGTCACGTTGAGCAAGGTGGTGTTCAGGTTGA
GTTTGTGGGTGACAGTGAACCTTGTGGCCAGACTGGTTCAACAAGCACCTCATCATCCCGATGCGACCAGGGAAATACTGCAGCTACCCA
GACTGAAGTACCAAGTTTAGTTGTTAAAAAAGAAGAAACTGTTGAAGACGAGATAGACGTAAGAAATGATGCAGTGATTCTGCCCTCCTG
TGTAGAAGCTGAAGCAAAGATACATGAAACCCAGGAAACCACCGATAAATCTGCAGATGATGCAGGCTGCCAATTACAAGAACTGAGAAA
CCAGCTACTCCTTGTCACTGAGGAAAAAGAGAATTATAAAAGACAGTGTCATATGTTTACTGATCAAATCAAAGTGTTACAACAGAGGAT
ACTAGAAATGAATGACAAGTATGTTAAGAAAGAAACTTGCCATCAGTCCACTGAAACCGATGCTGTATTTTTACTTGAAAGTATTAATGG
CAAATCTGAAAGTCCAGACCATATGGTATCTCAGTATCAGCAAGCTTTGGAAGAAATAGAAAGGCTGAAAAAACAATGTAGTGCTTTGCA
ACATGTAAAGGCTGAATGCAGCCAGTGTTCCAATAATGAGAGTAAAAGTGAAATGGATGAGATGGCTGTGCAGCTTGACGATGTGTTTAG
ACAACTGGACAAATGCAGTATTGAGAGGGACCAGTATAAAAGTGAGGTTGAATTGCTGGAAATGGAAAAGTCACAAATCCGTTCACAGTG
TGAAGAACTCAAAACTGAAGTAGAACAGTTAAAATCTACAAATCAACAGACGGCAACAGATGTTTCAACATCAAGTAACATTGAGGAGTC
TGTAAATCATATGGATGGAGAAAGCCTCAAACTCCGATCTCTTCGAGTTAACGTAGGACAACTGCTGGCTATGATTGTGCCTGATCTTGA
TCTTCAGCAAGTGAATTACGATGTTGATGTAGTTGATGAGATTTTAGGACAAGTTGTTGAACAAATGAGTGAAATCAGTAGTACTTAAAG
TATATGTTATGTAAGATAAAATATTTGCTCAATTCTTTTGGTTGTACAGCTTTCAAAATATAATTAATTTTGTTTTATAGATATGATAGG
CAACAGACTGAAAACCATAATCTTTACTGTATTCTATGCATTCAAATGTGGTCACAAATATTGTGGACACATTATCTTATGTTTTGAAAT
ACCTGTGAATTGTTGGCATTGAGCAGCTGAAGCTAACTCATGACTCTGTTTTGAATGTAAATATTTGTAATTAAGCCTGCACATATTTTT
TTATTGCCCTAGAGTACTCAAGTGTTTTTCACCAAGAGCTTTTCAGGTTGCCCCTAAGCTTTGTGCAATTTTTTCTGGTTCCCCAAAGTG
TATTTTTCTCTAAGTCGAGGGCTATGCCATAATACAAATGGAAATGTTACCTTTGATTTTCTTATAAAGGAGTTTAAATAGGATTTTTAA
ATAATGTAGTAACACTCCTGATACAACTCTGGTTATAAGTGAATTGAGCATTAATGTTTCTTTTGTATAAATTCCTGTCCTGAAATATTT
TATTCATGAAAATAAGGTAAGCAAAAACCAACTCCATTTTGCCAGGATTTTGTTGTGCTGAGATTGCCAATCACGGTTAAACACAAAGTG
TTTTTATAGAATGAAGAAACAGTCTTTAACAGAAAAAAGGTATTGAAATATTAAATGGCCACCAAGTTTACTTTGAAGCCCATTTTTGGC
TGTTTAGTCAGCATGAAGTGGGCATGATAATTTTTTAATATTTCTTTTTGTGAAATTTCCTGTACAGCCTTTTGTAGGATTACTACAGGT
TAATGTGAGTTGAGGAAGACAGTCTTTCTCAAACAATACTACATACCTTTTATTATATTACAAACCTAAGTGTTTTATATCCTAGAGTCA
AGGAACAAATTTCCTTAGGATTATAGTATTACATGCCATAAAATACTATGCTTTATTGGTCCCATGTTTTGTGCAATTTTAAAGAGATGG
CTTTCTATTAAGTATAAACTATGTATATATAAGAACCATATTTTCCACAACTAAAATGTGCATTATTTTTTCCAAAGTTTTATCATTGCT
ATTTATTTTTACCTTTGTTTTTGAACATTCAATCCGTTCATTTTGTATGTATGCTTAATACGTGTCGGTCATATACAGTATTGAATTTTT
ACTGTATAGTAATTCTGGAAAGAGCAAATAAATGAAGATTGTTTTTATTTGCCTGATAAAGTAATTGAAAGTGTATTTTTGGTATGAAGC


Top

FusionGenePPI for TMPRSS2_MORC3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMPRSS2CLK1MORC3RAD23A, ROR1, KPNA2, HIST1H2BG, HIST1H3A, HTT, SNTB1, MOGS, DYNLL1, CRIPT, TRIB1, SYNE2, DEPDC1, DOCK8, RDH10, C6orf141, UBC, DYNLL2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMPRSS2_MORC3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMPRSS2_MORC3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human