FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38750

FusionGeneSummary for TMPRSS2_ETV4

check button Fusion gene summary
Fusion gene informationFusion gene name: TMPRSS2_ETV4
Fusion gene ID: 38750
HgeneTgene
Gene symbol

TMPRSS2

ETV4

Gene ID

7113

2118

Gene nametransmembrane serine protease 2ETS variant 4
SynonymsPP9284|PRSS10E1A-F|E1AF|PEA3|PEAS3
Cytomap

21q22.3

17q21.31

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2ETS translocation variant 4EWS protein/E1A enhancer binding protein chimeraadenovirus E1A enhancer-binding proteinets variant gene 4 (E1A enhancer-binding protein, E1AF)polyomavirus enhancer activator 3 homolog
Modification date2018052320180523
UniProtAcc

O15393

P43268

Ensembl transtripts involved in fusion geneENST00000332149, ENST00000398585, 
ENST00000458356, ENST00000497881, 
ENST00000319349, ENST00000393664, 
ENST00000538265, ENST00000545954, 
ENST00000545089, ENST00000591713, 
ENST00000586826, 
Fusion gene scores* DoF score29 X 21 X 6=36549 X 8 X 3=216
# samples 22818
** MAII scorelog2(228/3654*10)=-0.680442809575384
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/216*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMPRSS2 [Title/Abstract] AND ETV4 [Title/Abstract] AND fusion [Title/Abstract]

TMPRSS2:ETV4 gene fusions define a third molecular subtype of prostate cancer. (pmid: 16585160)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

HgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843

TgeneETV4

GO:0045944

positive regulation of transcription by RNA polymerase II

24983502


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-G9-6351-01ATMPRSS2chr21

42866283

-ETV4chr17

41607549

-
TCGARVPRADTCGA-HC-7079-01ATMPRSS2chr21

42870046

-ETV4chr17

41623036

-
TCGARVPRADTCGA-KK-A7AW-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
TCGARVPRADTCGA-G9-6371-01ATMPRSS2chr21

42879877

-ETV4chr17

41622735

-
TCGARVPRADTCGA-M7-A725-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
TCGARVPRADTCGA-KC-A7FD-01ATMPRSS2chr21

42880008

-ETV4chr17

41623036

-
TCGARVPRADTCGA-HC-7077-01ATMPRSS2chr21

42870046

-ETV4chr17

41623036

-
TCGALDPRADTCGA-CH-5763-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
TCGALDPRADTCGA-G9-6371-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
TCGALDPRADTCGA-HC-7077-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
TCGALDPRADTCGA-KC-A7FD-01ATMPRSS2chr21

42880008

-ETV4chr17

41622735

-
ChiTaRS3.1EU693079TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332149ENST00000319349TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000332149ENST00000393664TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000332149ENST00000538265TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000332149ENST00000545954TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000332149ENST00000545089TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000332149ENST00000591713TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
5CDS-5UTRENST00000332149ENST00000586826TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000319349TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000393664TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000538265TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000545954TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000545089TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
In-frameENST00000398585ENST00000591713TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
5CDS-5UTRENST00000398585ENST00000586826TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000319349TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000393664TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000538265TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000545954TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000545089TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
Frame-shitENST00000458356ENST00000591713TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
5CDS-5UTRENST00000458356ENST00000586826TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000319349TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000393664TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000538265TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000545954TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000545089TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-3CDSENST00000497881ENST00000591713TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
intron-5UTRENST00000497881ENST00000586826TMPRSS2chr21

42866283

-ETV4chr17

41607549

-
5CDS-5UTRENST00000332149ENST00000319349TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000393664TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000538265TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000545954TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000545089TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000591713TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000586826TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000319349TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000393664TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000538265TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000545954TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000545089TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000591713TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000586826TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000319349TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000393664TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000538265TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000545954TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000545089TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000591713TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000586826TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000319349TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000393664TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000538265TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000545954TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000545089TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000591713TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000586826TMPRSS2chr21

42870046

-ETV4chr17

41623036

-
5UTR-3CDSENST00000332149ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-3CDSENST00000332149ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000332149ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000332149ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000332149ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000332149ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-intronENST00000332149ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-3CDSENST00000398585ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-3CDSENST00000398585ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000398585ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000398585ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000398585ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000398585ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-intronENST00000398585ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-3CDSENST00000458356ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-3CDSENST00000458356ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000458356ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000458356ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000458356ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-5UTRENST00000458356ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-intronENST00000458356ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-3CDSENST00000497881ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-3CDSENST00000497881ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000497881ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000497881ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000497881ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-5UTRENST00000497881ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
5UTR-intronENST00000497881ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41622735

-
intron-3CDSENST00000332149ENST00000319349TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-3CDSENST00000332149ENST00000393664TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000332149ENST00000538265TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000332149ENST00000545954TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000332149ENST00000545089TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000332149ENST00000591713TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-intronENST00000332149ENST00000586826TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
In-frameENST00000398585ENST00000319349TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
In-frameENST00000398585ENST00000393664TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5CDS-5UTRENST00000398585ENST00000538265TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5CDS-5UTRENST00000398585ENST00000545954TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5CDS-5UTRENST00000398585ENST00000545089TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5CDS-5UTRENST00000398585ENST00000591713TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5CDS-intronENST00000398585ENST00000586826TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-3CDSENST00000458356ENST00000319349TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-3CDSENST00000458356ENST00000393664TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-5UTRENST00000458356ENST00000538265TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-5UTRENST00000458356ENST00000545954TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-5UTRENST00000458356ENST00000545089TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-5UTRENST00000458356ENST00000591713TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-intronENST00000458356ENST00000586826TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-3CDSENST00000497881ENST00000319349TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-3CDSENST00000497881ENST00000393664TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000497881ENST00000538265TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000497881ENST00000545954TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000497881ENST00000545089TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-5UTRENST00000497881ENST00000591713TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
intron-intronENST00000497881ENST00000586826TMPRSS2chr21

42879877

-ETV4chr17

41622735

-
5UTR-5UTRENST00000332149ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000332149ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000332149ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000332149ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000332149ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000332149ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000332149ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000398585ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000398585ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000398585ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000398585ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000398585ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000398585ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000398585ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000458356ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000458356ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000458356ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000458356ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000458356ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-5UTRENST00000458356ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
intron-intronENST00000458356ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000319349TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000393664TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000538265TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000545954TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000545089TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000591713TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000586826TMPRSS2chr21

42880008

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000319349TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000393664TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000538265TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000545954TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000545089TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000332149ENST00000591713TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000332149ENST00000586826TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000319349TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000393664TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000538265TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000545954TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000545089TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000398585ENST00000591713TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000398585ENST00000586826TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000319349TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000393664TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000538265TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000545954TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000545089TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-5UTRENST00000458356ENST00000591713TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5CDS-intronENST00000458356ENST00000586826TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000319349TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000393664TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000538265TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000545954TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000545089TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-5UTRENST00000497881ENST00000591713TMPRSS2chr21

42870044

-ETV4chr17

41623036

-
5UTR-intronENST00000497881ENST00000586826TMPRSS2chr21

42870044

-ETV4chr17

41623036

-

Top

FusionProtFeatures for TMPRSS2_ETV4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMPRSS2

O15393

ETV4

P43268

Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}. Transcriptional activator that binds to the enhancer ofthe adenovirus E1A gene; the core-binding sequence is5'[AC]GGA[AT]GT-3'. {ECO:0000269|PubMed:19307308}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-3141_84116530Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-31485_105116530TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneETV4chr21:42866283chr17:41607549ENST00000319349-713341_421270485DNA bindingETS
TgeneETV4chr21:42866283chr17:41607549ENST00000393664-612341_421270485DNA bindingETS
TgeneETV4chr21:42866283chr17:41607549ENST00000538265-612341_421231446DNA bindingETS
TgeneETV4chr21:42866283chr17:41607549ENST00000545954-612341_421231446DNA bindingETS
TgeneETV4chr21:42866283chr17:41607549ENST00000591713-713341_421270485DNA bindingETS

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-314112_14979493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-314150_24279493DomainSRCR
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-314256_48979493DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-314112_149116530DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-314150_242116530DomainSRCR
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-314256_489116530DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-314112_14979493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-314150_24279493DomainSRCR
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-314256_48979493DomainPeptidase S1
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-314106_49279493Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-3141_8479493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000398585-314106_492116530Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-314106_49279493Topological domainExtracellular
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-3141_8479493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000332149-31485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42866283chr17:41607549ENST00000458356-31485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneETV4chr21:42866283chr17:41607549ENST00000319349-713148_244270485Compositional biasNote=Gln-rich
TgeneETV4chr21:42866283chr17:41607549ENST00000319349-71349_75270485Compositional biasNote=Asp/Glu-rich (acidic)
TgeneETV4chr21:42866283chr17:41607549ENST00000393664-612148_244270485Compositional biasNote=Gln-rich
TgeneETV4chr21:42866283chr17:41607549ENST00000393664-61249_75270485Compositional biasNote=Asp/Glu-rich (acidic)
TgeneETV4chr21:42866283chr17:41607549ENST00000538265-612148_244231446Compositional biasNote=Gln-rich
TgeneETV4chr21:42866283chr17:41607549ENST00000538265-61249_75231446Compositional biasNote=Asp/Glu-rich (acidic)
TgeneETV4chr21:42866283chr17:41607549ENST00000545954-612148_244231446Compositional biasNote=Gln-rich
TgeneETV4chr21:42866283chr17:41607549ENST00000545954-61249_75231446Compositional biasNote=Asp/Glu-rich (acidic)
TgeneETV4chr21:42866283chr17:41607549ENST00000591713-713148_244270485Compositional biasNote=Gln-rich
TgeneETV4chr21:42866283chr17:41607549ENST00000591713-71349_75270485Compositional biasNote=Asp/Glu-rich (acidic)


Top

FusionGeneSequence for TMPRSS2_ETV4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_294aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLH
TEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKL
IEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDE

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_331aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSNVTGCASMYLHTEGFSGPSPGDGAMGTGTEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPP
YQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYTTEKGIMQKVAGERYVYKFVCEP

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000319349_chr17_41622735_-_483aa
MPPAPPGGESGCEERGAAEIARKWELARSADRPAGEAHGPGLPAAPRL_RSLPGSKSLPGDVAR_SSGTRQ__AVCS_FPFRKPSFPQPH
HQDQEGAPESPHRPGPVLQQEAATPLPPWRAVPLLQCL_PPQTNRHQVPCPWCPWTVAPTALSPGRATEFPEILWHLPAPPWPWVPRGT_
LRLPAAPGHLPLLHISGRGPGTPPSPLPTPAVGALPTLSPAEL_ARIP_SPV_TGGPASRGPGWGQWAQVPRGGGGDQTGTDGLRLRLRC
HRVRINVPPHRGLLWALSR_RGHGLWL_ETSATIPR_CLRCP_EI_RRHQAGRGRCISRGAALPAPGCPAAVAISGGLAG_PNKCPFHCL
DGPGNGVQAH_A_GGRQALGHPEEPASHELRQAEPLAPILL_ERHHAEGGW_ALRVQVCV_ARGPLLFGLPGQSASSSQG_V_PACQ_GG

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000393664_chr17_41622735_-_483aa
MPPAPPGGESGCEERGAAEIARKWELARSADRPAGEAHGPGLPAAPRL_RSLPGSKSLPGDVAR_SSGTRQ__AVCS_FPFRKPSFPQPH
HQDQEGAPESPHRPGPVLQQEAATPLPPWRAVPLLQCL_PPQTNRHQVPCPWCPWTVAPTALSPGRATEFPEILWHLPAPPWPWVPRGT_
LRLPAAPGHLPLLHISGRGPGTPPSPLPTPAVGALPTLSPAEL_ARIP_SPV_TGGPASRGPGWGQWAQVPRGGGGDQTGTDGLRLRLRC
HRVRINVPPHRGLLWALSR_RGHGLWL_ETSATIPR_CLRCP_EI_RRHQAGRGRCISRGAALPAPGCPAAVAISGGLAG_PNKCPFHCL
DGPGNGVQAH_A_GGRQALGHPEEPASHELRQAEPLAPILL_ERHHAEGGW_ALRVQVCV_ARGPLLFGLPGQSASSSQG_V_PACQ_GG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_882nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCAC
ACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGC
GTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTG
CAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTC
ATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATAC
TATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCC
TTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAG

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_993nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGG
TGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGA
CCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCC
TACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGC
CGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAG
CTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCC
GAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTC
CCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTAC

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000319349_chr17_41622735_-_1450nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGAAATCGCCCGGAAATGGGAGCTTGCGCGAAGCGCT
GATCGGCCCGCTGGGGAAGCTCATGGACCCGGGCTCCCTGCCGCCCCTCGACTCTGAAGATCTCTTCCAGGATCTAAGTCACTTCCAGGA
GACGTGGCTCGCTGAAGCTCAGGTACCAGACAGTGATGAGCAGTTTGTTCCTGATTTCCATTCAGAAAACCTAGCTTTCCACAGCCCCAC
CACCAGGATCAAGAAGGAGCCCCAGAGTCCCCGCACAGACCCGGCCCTGTCCTGCAGCAGGAAGCCGCCACTCCCCTACCACCATGGCGA
GCAGTGCCTTTACTCCAGTGCCTATGACCCCCCCAGACAAATCGCCATCAAGTCCCCTGCCCCTGGTGCCCTTGGACAGTCGCCCCTACA
GCCCTTTCCCCGGGCAGAGCAACGGAATTTCCTGAGATCCTCTGGCACCTCCCAGCCCCACCCTGGCCATGGGTACCTCGGGGAACATAG
CTCCGTCTTCCAGCAGCCCCTGGACATTTGCCACTCCTTCACATCTCAGGGAGGGGGCCGGGAACCCCTCCCAGCCCCCTACCAACACCA
GCTGTCGGAGCCCTGCCCACCCTATCCCCAGCAGAGCTTTAAGCAAGAATACCATGATCCCCTGTATGAACAGGCGGGCCAGCCAGCCGT
GGACCAGGGTGGGGTCAATGGGCACAGGTACCCAGGGGCGGGGGTGGTGATCAAACAGGAACAGACGGACTTCGCCTACGACTCAGATGT
CACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACC
TCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGG
GCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTG
GACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTA
CGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTG
TGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGA
CACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTA

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000393664_chr17_41622735_-_1450nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGAAATCGCCCGGAAATGGGAGCTTGCGCGAAGCGCT
GATCGGCCCGCTGGGGAAGCTCATGGACCCGGGCTCCCTGCCGCCCCTCGACTCTGAAGATCTCTTCCAGGATCTAAGTCACTTCCAGGA
GACGTGGCTCGCTGAAGCTCAGGTACCAGACAGTGATGAGCAGTTTGTTCCTGATTTCCATTCAGAAAACCTAGCTTTCCACAGCCCCAC
CACCAGGATCAAGAAGGAGCCCCAGAGTCCCCGCACAGACCCGGCCCTGTCCTGCAGCAGGAAGCCGCCACTCCCCTACCACCATGGCGA
GCAGTGCCTTTACTCCAGTGCCTATGACCCCCCCAGACAAATCGCCATCAAGTCCCCTGCCCCTGGTGCCCTTGGACAGTCGCCCCTACA
GCCCTTTCCCCGGGCAGAGCAACGGAATTTCCTGAGATCCTCTGGCACCTCCCAGCCCCACCCTGGCCATGGGTACCTCGGGGAACATAG
CTCCGTCTTCCAGCAGCCCCTGGACATTTGCCACTCCTTCACATCTCAGGGAGGGGGCCGGGAACCCCTCCCAGCCCCCTACCAACACCA
GCTGTCGGAGCCCTGCCCACCCTATCCCCAGCAGAGCTTTAAGCAAGAATACCATGATCCCCTGTATGAACAGGCGGGCCAGCCAGCCGT
GGACCAGGGTGGGGTCAATGGGCACAGGTACCCAGGGGCGGGGGTGGTGATCAAACAGGAACAGACGGACTTCGCCTACGACTCAGATGT
CACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACC
TCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGG
GCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTG
GACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTA
CGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTG
TGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGA
CACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_1692nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT
GCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCTCAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAG
GAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAG
AGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGCTCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGG
ACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGG
AACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCCAAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGC

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_1690nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT
GCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCTCAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAG
GAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAG
AGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGCTCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGG
ACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGG
AACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCCAAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGC

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_1607nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT
GCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCTCAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAG
GAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAG
AGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGCTCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGG
ACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGG

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_1258nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_1256nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_1199nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGC
TATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTC
GGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAAT
GCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAAC
CGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTAC
GTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGG
CCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTT
GGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTG
GTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCT

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000319349_chr17_41607549_-_1729nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC
ACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCT
CAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAAC
CACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGC
TCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGC
TCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCC
AAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGCCCAGGCCTGGGTTTGTACTTCCACCTCCACCACATCTGCCAGACCTTAATAAA

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000393664_chr17_41607549_-_1727nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC
ACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCT
CAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAAC
CACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGC
TCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGC
TCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCC
AAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGCCCAGGCCTGGGTTTGTACTTCCACCTCCACCACATCTGCCAGACCTTAATAAA

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000538265_chr17_41607549_-_1644nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC
ACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCT
CAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTTCCCCAAC
CACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTCACTGAGC
TCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTCTTGGTGC
TCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTCCTGCTCC

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545954_chr17_41607549_-_1295nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC
ACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCT

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000545089_chr17_41607549_-_1293nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC
ACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCTAGAGTCT

>In-frame_TMPRSS2_ENST00000398585_chr21_42866283_-_ETV4_ENST00000591713_chr17_41607549_-_1236nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAATGTCACCGGGTGCGCATCAATGTACCTCCACACAGAGGG
CTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCGTTGTCCC
TGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGCAGCTGTG
GCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCATTGAGCC
TGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACTATTATGA
GAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCTTCCCGGA
CAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGAGCCCCGC
CTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCCCTGCCGC
AGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCAGATCCCC

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000319349_chr17_41622735_-_2186nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGAAATCGCCCGGAAATGGGAGCTTGCGCGAAGCGCTGATCGGCCCGCTGGGGAAGCTCATGGACC
CGGGCTCCCTGCCGCCCCTCGACTCTGAAGATCTCTTCCAGGATCTAAGTCACTTCCAGGAGACGTGGCTCGCTGAAGCTCAGGTACCAG
ACAGTGATGAGCAGTTTGTTCCTGATTTCCATTCAGAAAACCTAGCTTTCCACAGCCCCACCACCAGGATCAAGAAGGAGCCCCAGAGTC
CCCGCACAGACCCGGCCCTGTCCTGCAGCAGGAAGCCGCCACTCCCCTACCACCATGGCGAGCAGTGCCTTTACTCCAGTGCCTATGACC
CCCCCAGACAAATCGCCATCAAGTCCCCTGCCCCTGGTGCCCTTGGACAGTCGCCCCTACAGCCCTTTCCCCGGGCAGAGCAACGGAATT
TCCTGAGATCCTCTGGCACCTCCCAGCCCCACCCTGGCCATGGGTACCTCGGGGAACATAGCTCCGTCTTCCAGCAGCCCCTGGACATTT
GCCACTCCTTCACATCTCAGGGAGGGGGCCGGGAACCCCTCCCAGCCCCCTACCAACACCAGCTGTCGGAGCCCTGCCCACCCTATCCCC
AGCAGAGCTTTAAGCAAGAATACCATGATCCCCTGTATGAACAGGCGGGCCAGCCAGCCGTGGACCAGGGTGGGGTCAATGGGCACAGGT
ACCCAGGGGCGGGGGTGGTGATCAAACAGGAACAGACGGACTTCGCCTACGACTCAGATGTCACCGGGTGCGCATCAATGTACCTCCACA
CAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCG
TTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGC
AGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCA
TTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACT
ATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCT
TCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGA
GCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCC
CTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCA
GATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCT
AGAGTCTCAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTT
CCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTC
ACTGAGCTCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTC
TTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTC
CTGCTCCAAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGCCCAGGCCTGGGTTTGTACTTCCACCTCCACCACATCTGCCAGACCT

>In-frame_TMPRSS2_ENST00000398585_chr21_42879877_-_ETV4_ENST00000393664_chr17_41622735_-_2184nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGAAATCGCCCGGAAATGGGAGCTTGCGCGAAGCGCTGATCGGCCCGCTGGGGAAGCTCATGGACC
CGGGCTCCCTGCCGCCCCTCGACTCTGAAGATCTCTTCCAGGATCTAAGTCACTTCCAGGAGACGTGGCTCGCTGAAGCTCAGGTACCAG
ACAGTGATGAGCAGTTTGTTCCTGATTTCCATTCAGAAAACCTAGCTTTCCACAGCCCCACCACCAGGATCAAGAAGGAGCCCCAGAGTC
CCCGCACAGACCCGGCCCTGTCCTGCAGCAGGAAGCCGCCACTCCCCTACCACCATGGCGAGCAGTGCCTTTACTCCAGTGCCTATGACC
CCCCCAGACAAATCGCCATCAAGTCCCCTGCCCCTGGTGCCCTTGGACAGTCGCCCCTACAGCCCTTTCCCCGGGCAGAGCAACGGAATT
TCCTGAGATCCTCTGGCACCTCCCAGCCCCACCCTGGCCATGGGTACCTCGGGGAACATAGCTCCGTCTTCCAGCAGCCCCTGGACATTT
GCCACTCCTTCACATCTCAGGGAGGGGGCCGGGAACCCCTCCCAGCCCCCTACCAACACCAGCTGTCGGAGCCCTGCCCACCCTATCCCC
AGCAGAGCTTTAAGCAAGAATACCATGATCCCCTGTATGAACAGGCGGGCCAGCCAGCCGTGGACCAGGGTGGGGTCAATGGGCACAGGT
ACCCAGGGGCGGGGGTGGTGATCAAACAGGAACAGACGGACTTCGCCTACGACTCAGATGTCACCGGGTGCGCATCAATGTACCTCCACA
CAGAGGGCTTCTCTGGGCCCTCTCCAGGTGACGGGGCCATGGGCTATGGCTATGAGAAACCTCTGCGACCATTCCCAGATGATGTCTGCG
TTGTCCCTGAGAAATTTGAAGGAGACATCAAGCAGGAAGGGGTCGGTGCATTTCGAGAGGGGCCGCCCTACCAGCGCCGGGGTGCCCTGC
AGCTGTGGCAATTTCTGGTGGCCTTGCTGGATGACCCAACAAATGCCCATTTCATTGCCTGGACGGGCCGGGGAATGGAGTTCAAGCTCA
TTGAGCCTGAGGAGGTCGCCAGGCTCTGGGGCATCCAGAAGAACCGGCCAGCCATGAATTACGACAAGCTGAGCCGCTCGCTCCGATACT
ATTATGAGAAAGGCATCATGCAGAAGGTGGCTGGTGAGCGTTACGTGTACAAGTTTGTGTGTGAGCCCGAGGCCCTCTTCTCTTTGGCCT
TCCCGGACAATCAGCGTCCAGCTCTCAAGGCTGAGTTTGACCGGCCTGTCAGTGAGGAGGACACAGTCCCTTTGTCCCACTTGGATGAGA
GCCCCGCCTACCTCCCAGAGCTGGCTGGCCCCGCCCAGCCATTTGGCCCCAAGGGTGGCTACTCTTACTAGCCCCCAGCGGCTGTTCCCC
CTGCCGCAGGTGGGTGCTGCCCTGTGTACATATAAATGAATCTGGTGTTGGGGAAACCTTCATCTGAAACCCACAGATGTCTCTGGGGCA
GATCCCCACTGTCCTACCAGTTGCCCTAGCCCAGACTCTGAGCTGCTCACCGGAGTCATTGGGAAGGAAAAGTGGAGAAATGGCAAGTCT
AGAGTCTCAGAAACTCCCCTGGGGGTTTCACCTGGGCCCTGGAGGAATTCAGCTCAGCTTCTTCCTAGGTCCAAGCCCCCCACACCTTTT
CCCCAACCACAGAGAACAAGAGTTTGTTCTGTTCTGGGGGACAGAGAAGGCGCTTCCCAACTTCATACTGGCAGGAGGGTGAGGAGGTTC
ACTGAGCTCCCCAGATCTCCCACTGCGGGGAGACAGAAGCCTGGACTCTGCCCCACGCTGTGGCCCTGGAGGGTCCCGGTTTGTCAGTTC
TTGGTGCTCTGTGTTCCCAGAGGCAGGCGGAGGTTGAAGAAAGGAACCTGGGATGAGGGGTGCTGGGTATAAGCAGAGAGGGATGGGTTC
CTGCTCCAAGGGACCCTTTGCCTTTCTTCTGCCCTTTCCTAGGCCCAGGCCTGGGTTTGTACTTCCACCTCCACCACATCTGCCAGACCT


Top

FusionGenePPI for TMPRSS2_ETV4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMPRSS2CLK1ETV4HOXD4, RFWD2, SAE1, UBA2, SMAD2, APP, HTT, ATXN1, STK11, TP63, JUN, CARM1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMPRSS2_ETV4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMPRSS2_ETV4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human
TgeneETV4C0027627Neoplasm Metastasis1CTD_human
TgeneETV4C0033578Prostatic Neoplasms1CTD_human
TgeneETV4C1458155Mammary Neoplasms1CTD_human