FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38746

FusionGeneSummary for TMPRSS2_DIAPH1

check button Fusion gene summary
Fusion gene informationFusion gene name: TMPRSS2_DIAPH1
Fusion gene ID: 38746
HgeneTgene
Gene symbol

TMPRSS2

DIAPH1

Gene ID

7113

1729

Gene nametransmembrane serine protease 2diaphanous related formin 1
SynonymsPP9284|PRSS10DFNA1|DIA1|DRF1|LFHL1|SCBMS|hDIA1
Cytomap

21q22.3

5q31.3

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2protein diaphanous homolog 1
Modification date2018052320180527
UniProtAcc

O15393

O60610

Ensembl transtripts involved in fusion geneENST00000332149, ENST00000398585, 
ENST00000458356, ENST00000497881, 
ENST00000389054, ENST00000520569, 
ENST00000253811, ENST00000398566, 
ENST00000398562, ENST00000398557, 
ENST00000389057, ENST00000518047, 
ENST00000494967, 
Fusion gene scores* DoF score29 X 21 X 6=36546 X 5 X 3=90
# samples 2286
** MAII scorelog2(228/3654*10)=-0.680442809575384
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/90*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMPRSS2 [Title/Abstract] AND DIAPH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

HgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-EJ-5526-01ATMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332149ENST00000389054TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000520569TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000253811TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000398566TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000398562TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000398557TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000389057TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000332149ENST00000518047TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
5CDS-5UTRENST00000332149ENST00000494967TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000389054TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000520569TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000253811TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000398566TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000398562TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000398557TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000389057TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
In-frameENST00000398585ENST00000518047TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
5CDS-5UTRENST00000398585ENST00000494967TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000389054TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000520569TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000253811TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000398566TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000398562TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000398557TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000389057TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
Frame-shitENST00000458356ENST00000518047TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
5CDS-5UTRENST00000458356ENST00000494967TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000389054TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000520569TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000253811TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000398566TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000398562TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000398557TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000389057TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-3CDSENST00000497881ENST00000518047TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-
intron-5UTRENST00000497881ENST00000494967TMPRSS2chr21

42842575

-DIAPH1chr5

140914000

-

Top

FusionProtFeatures for TMPRSS2_DIAPH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMPRSS2

O15393

DIAPH1

O60610

Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}. Acts in a Rho-dependent manner to recruit PFY1 to themembrane. Required for the assembly of F-actin structures, such asactin cables and stress fibers. Nucleates actin filaments. Bindsto the barbed end of the actin filament and slows down actinpolymerization and depolymerization. Required for cytokinesis, andtranscriptional activation of the serum response factor. DFRproteins couple Rho and Src tyrosine kinase during signaling andthe regulation of actin dynamics. Functions as a scaffold proteinfor MAPRE1 and APC to stabilize microtubules and promote cellmigration (By similarity). Has neurite outgrowth promotingactivity (By similarity). In hear cells, it may play a role in theregulation of actin polymerization in hair cells. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Itcontrols the localization of APC and CLASP2 to the cell membrane,via the regulation of GSK3B activity. In turn, membrane-bound APCallows the localization of the MACF1 to the cell membrane, whichis required for microtubule capture and stabilization. Plays arole in the regulation of cell morphology and cytoskeletalorganization. Required in the control of cell shape(PubMed:20937854, PubMed:21834987). Plays a role in braindevelopment (PubMed:24781755). {ECO:0000250|UniProtKB:O08808,ECO:0000269|PubMed:20937854, ECO:0000269|PubMed:21834987,ECO:0000269|PubMed:24781755, ECO:0000269|PubMed:26912466}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-1114112_149390493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-1114150_242390493DomainSRCR
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-1114112_149427530DomainLDL-receptor class A
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-1114150_242427530DomainSRCR
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-1114112_149390493DomainLDL-receptor class A
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-1114150_242390493DomainSRCR
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-11141_84390493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-11141_84427530Topological domainCytoplasmic
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-11141_84390493Topological domainCytoplasmic
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-111485_105390493TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-111485_105427530TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-111485_105390493TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-16271039_11968181264Coiled coilOntology_term=ECO:0000255
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-17281039_11968271273Coiled coilOntology_term=ECO:0000255
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-16271213_12168181264Compositional biasNote=Arg/Lys-rich (basic)
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-17281213_12168271273Compositional biasNote=Arg/Lys-rich (basic)
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-16271194_12228181264DomainDAD
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-17281194_12228271273DomainDAD

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-1114256_489390493DomainPeptidase S1
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-1114256_489427530DomainPeptidase S1
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-1114256_489390493DomainPeptidase S1
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000332149-1114106_492390493Topological domainExtracellular
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000398585-1114106_492427530Topological domainExtracellular
HgeneTMPRSS2chr21:42842575chr5:140914000ENST00000458356-1114106_492390493Topological domainExtracellular
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-1627468_5728181264Coiled coilOntology_term=ECO:0000255
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-1728468_5728271273Coiled coilOntology_term=ECO:0000255
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-1627583_7648181264DomainNote=FH1
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-1627769_11718181264DomainFH2
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000389057-162784_4498181264DomainGBD/FH3
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-1728583_7648271273DomainNote=FH1
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-1728769_11718271273DomainFH2
TgeneDIAPH1chr21:42842575chr5:140914000ENST00000398557-172884_4498271273DomainGBD/FH3


Top

FusionGeneSequence for TMPRSS2_DIAPH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_836aa
MALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLT
LGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQ
VSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLT
ESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLL
EITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENDTPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQIS
DVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRE
TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVP

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTIFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_873aa
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYTENHGYQPENPTPAQPTVVPTVYEVHPAQYYPSPVPQYA
PRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSS
KAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTG
AGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKAKKDQEGGEEKKSVQKKKVKELK
VLDSKTAQNLSIFLGSFRMPTQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKDETDDLAESEQFGVVMGTVPRLRPRLNAI
LFKLQFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEND
TPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQTNKLRMMHSNMETLTKELGE
YFLFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_2508nt
ATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCC
ACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCT
TCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACC
CTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGC
GACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGC
CTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTAC
GGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATG
AAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGC
TGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAG
GTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAA
CCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAA
GTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTA
GTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAA
GCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCC
CAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACT
GAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTG
GCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGC
GAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTA
GAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTT
CGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTT
CCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCT
GATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCA
CAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAG
AAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAG
ACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATA
GACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGG
CCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_2619nt
ATGCCCCCTGCCCCGCCCGGAGGTGAAAGCGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTC
GATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAA
AACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCC
CCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAA
GCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGC
TCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAG
GACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAA
GACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGAC
AGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCA
AAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTC
CCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACA
GCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGA
GCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAG
CCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGG
TGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAG
GTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAG
GTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTG
AAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATT
CTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGT
GAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAAT
ATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGAC
TATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGAT
CAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATG
ACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAG
TACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAG
GAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAG
CAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCA
GCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGAT
GATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_4478nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_4472nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG
GAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTATGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTC
CCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTGGGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCC
TGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCGACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCA
GGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAAATGTATCAAGCCAAATGTGCAGATGCTAACTGGACAT
TCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTTCTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGG
TGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCCCTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAG
GAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAAGAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAG
GCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGGCAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTC
TGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACATCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTT
GCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACAAAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTG

>In-frame_TMPRSS2_ENST00000332149_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_3519nt
CGAGTAGGCGCGAGCTAAGCAGGAGGCGGAGGCGGAGGCGGAGGGCGAGGGGCGGGGAGCGCCGCCTGGAGCGCGGCAGGTCATATTGAA
CATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTTGAACTCAGGGTCACCACCAGCTATTGGACCTTACTAT
GAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGTCCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTAC
CCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCCCGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACA
GTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTC
TGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGC
GTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGG
AAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTAC
TCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTG
TACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGG
ATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATC
ATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTG
AGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGAC
ATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCA
GAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAAGGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAA
AAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCTCTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAA
GAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTATGATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAG
CAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTCAGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGA
CTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGTGGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCT
GCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTACCTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGA
AATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACACCAAGTCCACAGATCAGAAGATGACGTTGTTACACTTC
TTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGAGCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCT
GAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGAACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAA
AAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACAGTATAACAAGCTGCGGATGATGCATTCTAACATGGAG
ACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTCTGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGG
AATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGAAAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCA
GAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAATGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTT
CTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCAAGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTG
CTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGTGTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAG
GAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGGCAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGC
AGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACCACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTC
TCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGCAGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTG
TTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCTGTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCC
TGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTTGCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCC
CTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTGCTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTA
TTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAAATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCC
AAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGCCTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGG
ACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTGCACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCA
TGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGACCATCCCAACACCTCACCCTCTGTCTACAAGGAAATGG

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389054_chr5_140914000_-_4515nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000520569_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000253811_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398566_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398562_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCATCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000398557_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000389057_chr5_140914000_-_4509nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC
CATCCCAACACCTCACCCTCTGTCTACAAGGAAATGGGAGGTGGAGCCTCCTGGCTGAGAAATTGTTTTGCAAATGGATCTATTTTTGTA
TGAAAAAAAAAATTTTTTTAAAGAAAACTGTTCCTTCCCCCTTTCCCCTCCATAATGTAAGAAGCTTTGGTGGCAGGTTACAGAGTTCTG
GGATTTCTTCTCACAGGCCCAATCCTGAATGTGCCCCTGGACCTTCTGGACCCTTGAGTCCAAGGCAGATCCTCTCTCCCAGGGAATCCG
ACACAGGAGGAACCCCTTCTCTGGTTGAGCTGGGCCAGGCCTAAGAGTAGCAGGAACTCTAAGACCACAGAGTTTTTTATAAATGTATAA
ATGTATCAAGCCAAATGTGCAGATGCTAACTGGACATTCTGGGGAACTGGGCACCAGGAGTGCCTTCATACACTGTACCCCAGCTCTCTT
CTAAAAGAGAAGTGGGTGGGCACACTGAACTGTTTGGTGGCCCCAACCACAGGAAGCTGCAATTCTCTGGCTTAGGGTGATACTTTTGCC
CTCCTTGTGCCCCTCTCAGCTTTCCATCCCCAGCTAGGAAGAAAGAATGGCACTCTTGGGCTTGGCCCAGAATTAGAGTTATTAGAGCAA
GAGAGAGCTTAGGAAGCATGAGGGCAACTATAGTGAGGCCTTATTGCCAGGAGGGAGGGTTTTGGTTGCTGGCGCTTGTGTATAAAGGGG
CAAGAGCAGCTCCTTTGGACTATTCCTGGGAGGACTCTGATGCAGGGCGTCTGTTGCTCCCCTGGGTCACCTCCTCCCTGCTCGCTGACA
TCTGGGGCTTTGACCCTTTCTTTTTTAATCTACTTTTGCTAAGATGCATTTAATAAAAAAAAAGAGAGAGAGAGAGAGGTGTGAGGGACA
AAATGCAAACCTATTTCCCTTGCCTCATAGGCTTCTGGGATGTCATCACCTCCAGTTTGTTGGTTTTGTTTCCAACTGTTAATAAAGCAT

>In-frame_TMPRSS2_ENST00000398585_chr21_42842575_-_DIAPH1_ENST00000518047_chr5_140914000_-_3556nt
ACCAGGGTCCCGGCTCGGGGTCCGGGCTGGGGAGGGGAACCTGGGCGCCTGGGACCCGCCGATGCCCCCTGCCCCGCCCGGAGGTGAAAG
CGGGTGTGAGGAGCGCGGCGCGGCAGGTCATATTGAACATTCCAGATACCTATCATTACTCGATGCTGTTGATAACAGCAAGATGGCTTT
GAACTCAGGGTCACCACCAGCTATTGGACCTTACTATGAAAACCATGGATACCAACCGGAAAACCCCTATCCCGCACAGCCCACTGTGGT
CCCCACTGTCTACGAGGTGCATCCGGCTCAGTACTACCCGTCCCCCGTGCCCCAGTACGCCCCGAGGGTCCTGACGCAGGCTTCCAACCC
CGTCGTCTGCACGCAGCCCAAATCCCCATCCGGGACAGTGTGCACCTCAAAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGAC
CTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTC
AGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGG
ACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGC
GGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAA
CACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGC
CTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCT
GCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAA
CAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTC
TCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACC
AGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGCCAAGAA
GGATCAAGAAGGTGGAGAAGAAAAGAAATCTGTGCAAAAGAAAAAAGTAAAAGAGTTAAAGGTGTTGGATTCAAAGACAGCCCAGAATCT
CTCAATCTTTTTGGGTTCCTTCCGCATGCCCTATCAAGAGATTAAGAATGTCATCCTGGAGGTGAATGAGGCTGTTCTGACTGAGTCTAT
GATCCAGAACCTCATTAAGCAAATGCCAGAGCCAGAGCAGTTAAAAATGCTTTCTGAACTGAAGGATGAATATGATGACCTGGCTGAGTC
AGAGCAGTTTGGCGTGGTGATGGGCACTGTGCCCCGACTGCGGCCTCGCCTCAATGCCATTCTCTTCAAGCTACAATTCAGCGAGCAAGT
GGAGAATATCAAGCCAGAGATTGTGTCTGTCACTGCTGCATGTGAGGAGTTACGTAAGAGTGAGAGCTTTTCCAATCTCCTAGAGATTAC
CTTGCTTGTTGGAAATTACATGAATGCTGGCTCCAGAAATGCTGGTGCTTTTGGCTTCAATATCAGCTTCCTCTGTAAGCTTCGAGACAC
CAAGTCCACAGATCAGAAGATGACGTTGTTACACTTCTTGGCTGAGTTGTGTGAGAATGACTATCCCGATGTCCTCAAGTTTCCAGACGA
GCTTGCCCATGTGGAGAAAGCCAGCCGAGTTTCTGCTGAAAACTTGCAAAAGAACCTAGATCAGATGAAGAAACAAATTTCTGATGTGGA
ACGTGATGTTCAGAATTTCCCAGCTGCCACAGATGAAAAAGACAAGTTTGTTGAAAAAATGACCAGCTTTGTGAAGGATGCACAGGAACA
GTATAACAAGCTGCGGATGATGCATTCTAACATGGAGACCCTCTATAAGGAGCTGGGCGAGTACTTCCTCTTTGACCCCAAGAAGTTGTC
TGTTGAAGAATTTTTCATGGATCTTCACAATTTTCGGAATATGTTTTTGCAAGCAGTCAAGGAGAACCAGAAGCGGCGGGAGACAGAAGA
AAAGATGAGGCGAGCAAAACTAGCCAAGGAGAAGGCAGAGAAGGAGCGGCTAGAGAAGCAGCAGAAGAGAGAGCAACTCATAGACATGAA
TGCAGAGGGCGATGAGACAGGTGTGATGGACAGTCTTCTAGAAGCCCTGCAGTCAGGGGCAGCATTCCGACGGAAGAGAGGGCCCCGTCA
AGCCAACAGGAAGGCCGGGTGTGCAGTCACATCTCTGCTAGCTTCGGAGCTGACCAAGGATGATGCCATGGCTGCTGTTCCTGCCAAGGT
GTCCAAGAACAGTGAGACATTCCCCACAATCCTTGAGGAAGCCAAGGAGTTGGTTGGCCGTGCAAGCTAATGTGGGTCCTGTGACCGCGG
CAGCTCCTCAGCGGAGCCGCAGACTGTCCTGCCCTGCAGCATGTGCCTAAAGGCTCAAGGGGATATTCCTCTGGGGTGGCCACTCCCACC
ACCCTGACCCTGTCTTTCTCTCTGGCCTGCTGCTCTCTCAACATCACATACAGCTTCAGCTGCCTGGAGGCCAGAAGGAAAGGGCAGTGC
AGGGGAGGCCTGAGCCCGACTTAGCCAGCCCTGGCTGTTGTATTACCAAAGCAGGGTCCATGTTTGCTGCCTTAACCCTGTCTCCTCTCT
GTTACTCAGAGGGCCTCATCTCAGACAAGGCCCAGCCTGCTTTTTCTCAGCCCTGACTTTCTAATGGGCTTTCCCCCCTAGGTCAGTCTT
GCTGGATTTGTGCTTTTCTTTTGTGGTTTCTCTGGCCCTGAGAATAGCATGGGGCTTGTAAACCTTTGGGCTAGATCCCTCCTTTCATTG
CTGTTGTCTCTGCTCTTCCCTCTCCTGGCTGTGGTTATTTATTATTAGTGGTGTGGCACTGGGAGCTGCTCCTAAGGAAGCAGGGAGCAA
ATCCCACCTTTACCCCACCTTCCTGGGAAAGGCCTCCAAAGCAAAGGATCTGGACCAGTTTCCCTGCTGTGCTGTGGCCCAGGCCAGAGC
CTGTGGGCAGGCAGGCAGGGCATAGCGACAGTGTGGGACCTGCCCCCAGCTTCTGCCACGCTTTATGCCCTTGCCTCTCTGGACGCTCTG
CACCAACCCCAGGCTACTGAGCCACCTTCCCTCCTCATGCCTTCCCTGAGCTTTGGTGCATCTCATCTGGACTATGGGTTGTACTGTGAC


Top

FusionGenePPI for TMPRSS2_DIAPH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMPRSS2CLK1DIAPH1XPO6, RHOA, SRGAP2, TCERG1, DCAF7, MYO1E, HSPA4L, FN1, VCAM1, GRB2, PRPF40A, CENPA, WBP4, APBB1, GAS7, NEDD4, ARCN1, COPB1, COPZ1, KIF5B, KLC1, KLC4, PTPN23, SMEK2, WWOX, IQGAP1, RHOD, PSMC3, CCNL2, UBA6, UPF1, MTOR, TLN2, TTC4, UBL7, NTRK1, MED23, LRP1, PLXNB1, PABPN1, SLC16A3, CEP192, SOWAHC, ZCCHC6, RAB34, SKI, SNW1, CDC5L, RHOC, PFN2, TRIM25, BRCA1, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMPRSS2_DIAPH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMPRSS2_DIAPH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human