FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38566

FusionGeneSummary for TMEM242_PREP

check button Fusion gene summary
Fusion gene informationFusion gene name: TMEM242_PREP
Fusion gene ID: 38566
HgeneTgene
Gene symbol

TMEM242

PREP

Gene ID

729515

5550

Gene nametransmembrane protein 242prolyl endopeptidase
SynonymsBM033|C6orf35PE|PEP
Cytomap

6q25.3

6q21

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protein 242UPF0463 transmembrane protein C6orf35prolyl endopeptidasedJ355L5.1 (prolyl endopeptidase)post-proline cleaving enzymeprolyl oligopeptidase
Modification date2018051920180523
UniProtAcc

Q9NWH2

P48147

Ensembl transtripts involved in fusion geneENST00000400788, ENST00000367144, 
ENST00000369110, 
Fusion gene scores* DoF score3 X 1 X 3=96 X 3 X 6=108
# samples 36
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TMEM242 [Title/Abstract] AND PREP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDTHCATCGA-CE-A13K-01ATMEM242chr6

157739814

-PREPchr6

105845802

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000400788ENST00000369110TMEM242chr6

157739814

-PREPchr6

105845802

-
intron-3CDSENST00000367144ENST00000369110TMEM242chr6

157739814

-PREPchr6

105845802

-

Top

FusionProtFeatures for TMEM242_PREP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMEM242

Q9NWH2

PREP

P48147

Cleaves peptide bonds on the C-terminal side of prolylresidues within peptides that are up to approximately 30 aminoacids long.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMEM242chr6:157739814chr6:105845802ENST00000400788-3430_50109142TransmembraneHelical
HgeneTMEM242chr6:157739814chr6:105845802ENST00000400788-3482_102109142TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TMEM242_PREP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMEM242_ENST00000400788_chr6_157739814_-_PREP_ENST00000369110_chr6_105845802_-_805aa
METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYA
WCGVGVISFAVWKALGVHSVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRY
FYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCM
AWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDL
QQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHD
VKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPSKD
GTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEY
LIKEGYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLPEAD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMEM242_ENST00000400788_chr6_157739814_-_PREP_ENST00000369110_chr6_105845802_-_2415nt
ATGGAGACAGCGGGCGCTGCAACTGGGCAGCCGGCCTCTGGGCTGGAGGCTCCGGGGTCCACGAATGACCGGCTTTTCCTGGTTAAAGGT
GGAATTTTCCTTGGTACCGTTGCTGCAGCGGGAATGCTAGCTGGATTTATTACAACATTATCATTGGCTAAAAAGAAAAGCCCTGAATGG
TTCAATAAGGGAAGTATGGCCACGGCTGCATTACCGGAAAGCGGGTCTTCCCTTGCCTTGCGAGCTCTGGGCTGGGGCTCCCTGTATGCA
TGGTGTGGGGTTGGTGTGATTAGCTTCGCAGTCTGGAAAGCTTTAGGAGTTCACAGTGTACAGGATTATCATGGTCATAAAATTTGTGAC
CCTTACGCCTGGCTTGAAGACCCCGACAGTGAACAGACTAAGGCCTTTGTGGAGGCCCAGAATAAGATTACTGTGCCATTTCTTGAGCAG
TGTCCCATCAGAGGTTTATACAAAGAGAGAATGACTGAACTATATGATTATCCCAAGTATAGTTGCCACTTCAAGAAAGGAAAACGGTAT
TTTTATTTTTACAATACAGGTTTGCAGAACCAGCGAGTATTATATGTACAGGATTCCTTAGAGGGTGAGGCCAGAGTGTTCCTGGACCCC
AACATACTGTCTGACGATGGCACAGTGGCACTCCGAGGTTATGCGTTCAGCGAAGATGGTGAATATTTTGCCTATGGTCTGAGTGCCAGT
GGCTCAGACTGGGTGACAATCAAGTTCATGAAAGTTGATGGTGCCAAAGAGCTTCCAGATGTGCTTGAAAGAGTCAAGTTCAGCTGTATG
GCCTGGACCCATGATGGGAAGGGAATGTTCTACAACTCATACCCTCAACAGGATGGAAAAAGTGATGGCACAGAGACATCTACCAATCTC
CACCAAAAGCTCTACTACCATGTCTTGGGAACCGATCAGTCAGAAGATATTTTGTGTGCTGAGTTTCCTGATGAACCTAAATGGATGGGT
GGAGCTGAGTTATCTGATGATGGCCGCTATGTCTTGTTATCAATAAGGGAAGGATGTGATCCAGTAAACCGACTCTGGTACTGTGACCTA
CAGCAGGAATCCAGTGGCATCGCGGGAATCCTGAAGTGGGTAAAACTGATTGACAACTTTGAAGGGGAATATGACTACGTGACCAATGAG
GGGACGGTGTTCACATTCAAGACGAATCGCCAGTCTCCCAACTATCGCGTGATCAACATTGACTTCAGGGATCCTGAAGAGTCTAAGTGG
AAAGTACTTGTTCCTGAGCATGAGAAAGATGTCTTAGAATGGATAGCTTGTGTCAGGTCCAACTTCTTGGTCTTATGCTACCTCCATGAC
GTCAAGAACATTCTGCAGCTCCATGACCTGACTACTGGTGCTCTCCTTAAGACCTTCCCGCTCGATGTCGGCAGCATTGTAGGGTACAGC
GGTCAGAAGAAGGACACTGAAATCTTCTATCAGTTTACTTCCTTTTTATCTCCAGGTATCATTTATCACTGTGATCTTACCAAAGAGGAG
CTGGAGCCAAGAGTTTTCCGAGAGGTGACCGTAAAAGGAATTGATGCTTCTGATTACCAGACAGTCCAGATTTTCTACCCTAGCAAGGAT
GGTACGAAGATTCCAATGTTCATTGTGCATAAAAAAGGCATAAAATTGGATGGCTCTCATCCAGCTTTCTTATATGGCTATGGCGGCTTC
AACATATCCATCACACCCAACTACAGTGTTTCCAGGCTTATTTTTGTGAGACACATGGGTGGTATCCTGGCAGTGGCCAACATCAGAGGA
GGTGGCGAATATGGAGAGACGTGGCATAAAGGTGGTATCTTGGCCAACAAACAAAACTGCTTTGATGACTTTCAGTGTGCTGCTGAGTAT
CTGATCAAGGAAGGTTACACATCTCCCAAGAGGCTGACTATTAATGGAGGTTCAAATGGAGGCCTCTTAGTGGCTGCTTGTGCAAATCAG
AGACCTGACCTCTTTGGTTGTGTTATTGCCCAAGTTGGAGTAATGGACATGCTGAAGTTTCATAAATATACCATCGGCCATGCTTGGACC
ACTGATTATGGGTGCTCGGACAGCAAACAACACTTTGAATGGCTTGTCAAATACTCTCCATTGCATAATGTGAAGTTACCAGAAGCAGAT
GACATCCAGTACCCGTCCATGCTGCTCCTCACTGCTGACCATGATGACCGCGTGGTCCCGCTTCACTCCCTGAAGTTCATTGCCACCCTT
CAGTACATCGTGGGCCGCAGCAGGAAGCAAAGCAACCCCCTGCTTATCCACGTGGACACCAAGGCGGGCCACGGGGCGGGGAAGCCCACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMEM242_ENST00000400788_chr6_157739814_-_PREP_ENST00000369110_chr6_105845802_-_3096nt
AGATTGCACAGGAGGAGGCGGTAGCGGAACCTTTCTCCTCCGCCTGGTTCTCGCTTCCACCCGGGCCCAGTTGGGGACGGACGCACTAGA
GGCGACCTAAACATGGAGACAGCGGGCGCTGCAACTGGGCAGCCGGCCTCTGGGCTGGAGGCTCCGGGGTCCACGAATGACCGGCTTTTC
CTGGTTAAAGGTGGAATTTTCCTTGGTACCGTTGCTGCAGCGGGAATGCTAGCTGGATTTATTACAACATTATCATTGGCTAAAAAGAAA
AGCCCTGAATGGTTCAATAAGGGAAGTATGGCCACGGCTGCATTACCGGAAAGCGGGTCTTCCCTTGCCTTGCGAGCTCTGGGCTGGGGC
TCCCTGTATGCATGGTGTGGGGTTGGTGTGATTAGCTTCGCAGTCTGGAAAGCTTTAGGAGTTCACAGTGTACAGGATTATCATGGTCAT
AAAATTTGTGACCCTTACGCCTGGCTTGAAGACCCCGACAGTGAACAGACTAAGGCCTTTGTGGAGGCCCAGAATAAGATTACTGTGCCA
TTTCTTGAGCAGTGTCCCATCAGAGGTTTATACAAAGAGAGAATGACTGAACTATATGATTATCCCAAGTATAGTTGCCACTTCAAGAAA
GGAAAACGGTATTTTTATTTTTACAATACAGGTTTGCAGAACCAGCGAGTATTATATGTACAGGATTCCTTAGAGGGTGAGGCCAGAGTG
TTCCTGGACCCCAACATACTGTCTGACGATGGCACAGTGGCACTCCGAGGTTATGCGTTCAGCGAAGATGGTGAATATTTTGCCTATGGT
CTGAGTGCCAGTGGCTCAGACTGGGTGACAATCAAGTTCATGAAAGTTGATGGTGCCAAAGAGCTTCCAGATGTGCTTGAAAGAGTCAAG
TTCAGCTGTATGGCCTGGACCCATGATGGGAAGGGAATGTTCTACAACTCATACCCTCAACAGGATGGAAAAAGTGATGGCACAGAGACA
TCTACCAATCTCCACCAAAAGCTCTACTACCATGTCTTGGGAACCGATCAGTCAGAAGATATTTTGTGTGCTGAGTTTCCTGATGAACCT
AAATGGATGGGTGGAGCTGAGTTATCTGATGATGGCCGCTATGTCTTGTTATCAATAAGGGAAGGATGTGATCCAGTAAACCGACTCTGG
TACTGTGACCTACAGCAGGAATCCAGTGGCATCGCGGGAATCCTGAAGTGGGTAAAACTGATTGACAACTTTGAAGGGGAATATGACTAC
GTGACCAATGAGGGGACGGTGTTCACATTCAAGACGAATCGCCAGTCTCCCAACTATCGCGTGATCAACATTGACTTCAGGGATCCTGAA
GAGTCTAAGTGGAAAGTACTTGTTCCTGAGCATGAGAAAGATGTCTTAGAATGGATAGCTTGTGTCAGGTCCAACTTCTTGGTCTTATGC
TACCTCCATGACGTCAAGAACATTCTGCAGCTCCATGACCTGACTACTGGTGCTCTCCTTAAGACCTTCCCGCTCGATGTCGGCAGCATT
GTAGGGTACAGCGGTCAGAAGAAGGACACTGAAATCTTCTATCAGTTTACTTCCTTTTTATCTCCAGGTATCATTTATCACTGTGATCTT
ACCAAAGAGGAGCTGGAGCCAAGAGTTTTCCGAGAGGTGACCGTAAAAGGAATTGATGCTTCTGATTACCAGACAGTCCAGATTTTCTAC
CCTAGCAAGGATGGTACGAAGATTCCAATGTTCATTGTGCATAAAAAAGGCATAAAATTGGATGGCTCTCATCCAGCTTTCTTATATGGC
TATGGCGGCTTCAACATATCCATCACACCCAACTACAGTGTTTCCAGGCTTATTTTTGTGAGACACATGGGTGGTATCCTGGCAGTGGCC
AACATCAGAGGAGGTGGCGAATATGGAGAGACGTGGCATAAAGGTGGTATCTTGGCCAACAAACAAAACTGCTTTGATGACTTTCAGTGT
GCTGCTGAGTATCTGATCAAGGAAGGTTACACATCTCCCAAGAGGCTGACTATTAATGGAGGTTCAAATGGAGGCCTCTTAGTGGCTGCT
TGTGCAAATCAGAGACCTGACCTCTTTGGTTGTGTTATTGCCCAAGTTGGAGTAATGGACATGCTGAAGTTTCATAAATATACCATCGGC
CATGCTTGGACCACTGATTATGGGTGCTCGGACAGCAAACAACACTTTGAATGGCTTGTCAAATACTCTCCATTGCATAATGTGAAGTTA
CCAGAAGCAGATGACATCCAGTACCCGTCCATGCTGCTCCTCACTGCTGACCATGATGACCGCGTGGTCCCGCTTCACTCCCTGAAGTTC
ATTGCCACCCTTCAGTACATCGTGGGCCGCAGCAGGAAGCAAAGCAACCCCCTGCTTATCCACGTGGACACCAAGGCGGGCCACGGGGCG
GGGAAGCCCACAGCCAAAGTGATAGAGGAAGTCTCAGACATGTTTGCGTTCATCGCGCGGTGCCTGAACGTCGACTGGATTCCATAAACA
GTTTTCGTGCTTCCTCCTGACAGCGACAGAAAACCTCAAGGGCTTTCCCACGTTGACACCAAGAAACCACTGGGCATAATGCTTCCCCAC
GGGAACATTATTCCTGCACTCACAGGCTACAGTTGAACAGAACTGCCGTGGGAATTTTATCTTTTTTAGGCTTCTCCTTTTTAGCAAGGC
CTTGGTGTTTCTTTTTCCACCCTGTCTAGGCACATGTGGTTTTTTGGTGTTTTTTTTAAGGGCATGTTGGGATAAATAGCTAAATGGCAA
CAAACACATTGTGAATATTAGATTGCTGAATTAAGGATCATAGTCGGGCATACTTATCTATATCCATAACCTCTATATCTTTAAATAAAT
GTGAGAACTGTTCTCATGGAGAAGACTTCTTTGCAACAATAATAAATGTTATTTAAGAATGACAGGCTTTTACTTCCGGTTTCTTCATAT
TGAGGGGCAACTCCAGAAGTGGAGTTTTCTGTGAGAATAAAGCATTTCACCTTTCTGCAACAAGTTAGTTTTCAAGCAGTTAAGTCATAG


Top

FusionGenePPI for TMEM242_PREP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMEM242VKORC1, GGT7, RNF5, SLC22A9, SLC2A12, TMEM63A, TRIM25PREPSIRT7, TARS, BRCA1, SGOL2, AIP, GLO1, HSPA4, HSPD1, HSPH1, KCNAB2, PABPC4, ALDOA, ALDOC, CTH, GDI2, ISYNA1, ME1, OAT, PABPC1, QDPR, NTRK1, SUCO, MTG2, NSMAF, RHPN1, KIF3A, SNCA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMEM242_PREP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMEM242_PREP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePREPC0002622Amnesia1CTD_human
TgenePREPC0002624Retrograde amnesia1CTD_human
TgenePREPC0005586Bipolar Disorder1PSYGENET
TgenePREPC0038356Stomach Neoplasms1CTD_human
TgenePREPC0338831Manic1PSYGENET