FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38559

FusionGeneSummary for TMEM234_RUSC1

check button Fusion gene summary
Fusion gene informationFusion gene name: TMEM234_RUSC1
Fusion gene ID: 38559
HgeneTgene
Gene symbol

TMEM234

RUSC1

Gene ID

56063

23623

Gene nametransmembrane protein 234RUN and SH3 domain containing 1
SynonymsAASL548|C1orf91|PRO1105|RP4-622L5|dJ622L5.7NESCA
Cytomap

1p35.2

1q22

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protein 234RUN and SH3 domain-containing protein 1new molecule containing SH3 at the carboxy-terminus
Modification date2018051920180519
UniProtAcc

Q8WY98

Q9BVN2

Ensembl transtripts involved in fusion geneENST00000545122, ENST00000309777, 
ENST00000373593, ENST00000344461, 
ENST00000485689, 
ENST00000368354, 
ENST00000368352, ENST00000368347, 
ENST00000462780, ENST00000368349, 
ENST00000292254, 
Fusion gene scores* DoF score3 X 3 X 3=273 X 3 X 3=27
# samples 33
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TMEM234 [Title/Abstract] AND RUSC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRUSC1

GO:0000209

protein polyubiquitination

19365808


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-D1-A3DG-01ATMEM234chr1

32681795

-RUSC1chr1

155295107

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000545122ENST00000368354TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3CDSENST00000545122ENST00000368352TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3CDSENST00000545122ENST00000368347TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000545122ENST00000462780TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000545122ENST00000368349TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000545122ENST00000292254TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000309777ENST00000368354TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000309777ENST00000368352TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000309777ENST00000368347TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000309777ENST00000462780TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000309777ENST00000368349TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000309777ENST00000292254TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000373593ENST00000368354TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000373593ENST00000368352TMEM234chr1

32681795

-RUSC1chr1

155295107

+
Frame-shitENST00000373593ENST00000368347TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000373593ENST00000462780TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000373593ENST00000368349TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000373593ENST00000292254TMEM234chr1

32681795

-RUSC1chr1

155295107

+
In-frameENST00000344461ENST00000368354TMEM234chr1

32681795

-RUSC1chr1

155295107

+
In-frameENST00000344461ENST00000368352TMEM234chr1

32681795

-RUSC1chr1

155295107

+
In-frameENST00000344461ENST00000368347TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000344461ENST00000462780TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000344461ENST00000368349TMEM234chr1

32681795

-RUSC1chr1

155295107

+
5CDS-3UTRENST00000344461ENST00000292254TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3CDSENST00000485689ENST00000368354TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3CDSENST00000485689ENST00000368352TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3CDSENST00000485689ENST00000368347TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000485689ENST00000462780TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000485689ENST00000368349TMEM234chr1

32681795

-RUSC1chr1

155295107

+
intron-3UTRENST00000485689ENST00000292254TMEM234chr1

32681795

-RUSC1chr1

155295107

+

Top

FusionProtFeatures for TMEM234_RUSC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMEM234

Q8WY98

RUSC1

Q9BVN2

Putative signaling adapter which may play a role inneuronal differentiation. May be involved in regulation of NGF-dependent neurite outgrowth. Proposed to play a role in neuronalvesicular trafficking, specifically involving pre-synapticmembrane proteins. Seems to be involved in signaling pathways thatare regulated by the prolonged activation of MAPK. Can regulatethe polyubiquitination of IKBKG and thus may be involved inregulation of the NF-kappa-B pathway.{ECO:0000269|PubMed:19365808}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TMEM234_RUSC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368354_chr1_155295107_+_286aa
AQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLTSQVSRLAPLSSSRSRFHAFIL
GLLNTKQLELWFSSLQEDAGSWWEQLTQASRVTASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRGLWLGRLFGVPGGPAEN
ENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRD

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368352_chr1_155295107_+_392aa
AQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLTSQVSRLAPLSSSRSRFHAFIL
GLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQT
MQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVTASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRG
LWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVL

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368347_chr1_155295107_+_392aa
AQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLTSQVSRLAPLSSSRSRFHAFIL
GLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQT
MQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVTASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRG
LWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368354_chr1_155295107_+_858nt
GCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGAC
GGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTCC
AGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCTG
GGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTCC
CGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTCCCGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACAG
GAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGGCCTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAAT
GAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCTGCCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCCC
GAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAGGATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGCT
GCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCTGCGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGAT

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368352_chr1_155295107_+_1176nt
GCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGAC
GGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTCC
AGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCTG
GGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGCCTGCTCTCCCTCCTGTACCTGCCAACAGGA
TTTTTCTCCCTGGCCCGCGGTGGTTGTCCCTCCCTGTCCACAGAGCTGCTGCTCCTGCTGCAGCCATTGTCGGTGCTCACTTTCCACCTG
GACCTGCTCTTTGAGCACCACCACCACCTGCCCCTGGGCCCACCTCAGGCCCCTGCCCCTCCAGGCCCACCTCCAGCTCTGCAGCAGACT
ATGCAAGCCATGCTGCACTTTGGGGGCCGGCTGGCCCAGAGCCTTCGGGGGACTTCCAAGGAAGCTGCTTCAGACCCCTCTGACTCTCCA
AACCTTCCCACACCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTCCCGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTCC
CGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACAGGAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGGC
CTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAATGAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCTG
CCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCCCGAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAGG
ATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGCTGCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCTG
CGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGATGGCATGGAGGGTCTGGTGCCTGTGGGGTATACCTCCCTTGTT

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368347_chr1_155295107_+_1176nt
GCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGAC
GGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTCC
AGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCTG
GGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGCCTGCTCTCCCTCCTGTACCTGCCAACAGGA
TTTTTCTCCCTGGCCCGCGGTGGTTGTCCCTCCCTGTCCACAGAGCTGCTGCTCCTGCTGCAGCCATTGTCGGTGCTCACTTTCCACCTG
GACCTGCTCTTTGAGCACCACCACCACCTGCCCCTGGGCCCACCTCAGGCCCCTGCCCCTCCAGGCCCACCTCCAGCTCTGCAGCAGACT
ATGCAAGCCATGCTGCACTTTGGGGGCCGGCTGGCCCAGAGCCTTCGGGGGACTTCCAAGGAAGCTGCTTCAGACCCCTCTGACTCTCCA
AACCTTCCCACACCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTCCCGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTCC
CGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACAGGAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGGC
CTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAATGAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCTG
CCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCCCGAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAGG
ATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGCTGCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCTG
CGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGATGGCATGGAGGGTCTGGTGCCTGTGGGGTATACCTCCCTTGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368354_chr1_155295107_+_2120nt
AGACAGCGGCGTTGCCATGGCGGCGTCTCTGGGGCAGGTGTTGGCTCTGGTGCTGGTGGCCGCTCTGTGGGGTGGCACGCAGCCGCTGCT
GAAGCGGGCCTCCGCCGGCCTGCAGCGGGTTCATGAGCCGACCTGGGCCCAGCAGTTGCTACAGGAGATGAAGACCCTCTTCTTGAATAC
TGAGTACCTGATGCCCTTTCTCCTCAACCAGTGTGGATCCCTTCTCTATTACCTCACCTTGGCATCGACAGATCTGACCCTGGCTGTGCC
CATCTGTAACTCTCTGGCTATCATCTTCACACTGATTGTTGGGAAGGCCCTTGGAGAAGATATTGGTGGAAAACGAGCAGTTGCTGGCAT
GGTGCTCACCGTGATAGGAATTTCACTCTGCATCACAAGCTCAGTTCCATGGACTGCAGAACTCCAGCTGCATGGAAAGGGCCAGCTGCA
GACTTTGAGCCAGAAATGCAAACGGGAGGCCTCTGGGACTCAGTCAGAGCGCTTTGGCTGAATGAGGGGTGGAACCGAGGGAAGAAGGTG
CGTCGGAGTGGCAGATGCAGGAAATGAGCTGTCTATTAGCCTTGCCTGCCCCACCCATGAGGTAGGCAGAAATCCTCACTGCCAGCCCCT
CTTAAACAGGTAGAGAGCTGTGAGCCCCAGCCCCACCTGACTCCAGCACACCTGGCGAGTAGTAGCTGTCAATAAATCTATGGTAAACAG
AGCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGA
CGGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTC
CAGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCT
GGGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTC
CCGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTCCCGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACA
GGAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGGCCTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAA
TGAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCTGCCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCC
CGAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAGGATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGC
TGCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCTGCGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGA
TGGCATGGAGGGTCTGGTGCCTGTGGGGTATACCTCCCTTGTTCTGTAGCCCTGGGACCCTTTCCTGCGTATGTGTCTCCTTCCTGTCAC
CTGGGAATGGAATGGCCAGTGAACACCATCCCAGAAGCATTTTCCCTCTGCAAAATGACGTTTCTTCCCACGTCTGTTTCTGCTAATATT
TAAAATAAACTTTCCTTCTTCCCTCCTATACCCACCTGTAAGGTGAAATCTGCTCTTCTTCCAAATATATAAAAAAGGAATTGCCCTCCA
GGTAATCCCTTTCCTTTTTCCCGTCTATATAAGGGAATGTCTTCCTTCCTATCTATCTGCAAAATGGAAATCTAGACCTCCTTCTTCATC
CATAAGTGGACTGTGCCAGTACAATACATGCCTCAGCCCCCAAGCCTAGAAGGACCTCTAGTCTCCTTCCTGTGTGGAATCTTCCCCACT
CCATCCCTCCCAAGTTGCCTGTATTGATAATGTACTCACTCATGCTGTACTAGGTGCTGAAGCCTGGACACCCTTGGTGGGTGGGCCTGT

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368352_chr1_155295107_+_2440nt
AGACAGCGGCGTTGCCATGGCGGCGTCTCTGGGGCAGGTGTTGGCTCTGGTGCTGGTGGCCGCTCTGTGGGGTGGCACGCAGCCGCTGCT
GAAGCGGGCCTCCGCCGGCCTGCAGCGGGTTCATGAGCCGACCTGGGCCCAGCAGTTGCTACAGGAGATGAAGACCCTCTTCTTGAATAC
TGAGTACCTGATGCCCTTTCTCCTCAACCAGTGTGGATCCCTTCTCTATTACCTCACCTTGGCATCGACAGATCTGACCCTGGCTGTGCC
CATCTGTAACTCTCTGGCTATCATCTTCACACTGATTGTTGGGAAGGCCCTTGGAGAAGATATTGGTGGAAAACGAGCAGTTGCTGGCAT
GGTGCTCACCGTGATAGGAATTTCACTCTGCATCACAAGCTCAGTTCCATGGACTGCAGAACTCCAGCTGCATGGAAAGGGCCAGCTGCA
GACTTTGAGCCAGAAATGCAAACGGGAGGCCTCTGGGACTCAGTCAGAGCGCTTTGGCTGAATGAGGGGTGGAACCGAGGGAAGAAGGTG
CGTCGGAGTGGCAGATGCAGGAAATGAGCTGTCTATTAGCCTTGCCTGCCCCACCCATGAGGTAGGCAGAAATCCTCACTGCCAGCCCCT
CTTAAACAGGTAGAGAGCTGTGAGCCCCAGCCCCACCTGACTCCAGCACACCTGGCGAGTAGTAGCTGTCAATAAATCTATGGTAAACAG
AGCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGA
CGGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTC
CAGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCT
GGGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGCCTGCTCTCCCTCCTGTACCTGCCAACAGG
ATTTTTCTCCCTGGCCCGCGGTGGTTGTCCCTCCCTGTCCACAGAGCTGCTGCTCCTGCTGCAGCCATTGTCGGTGCTCACTTTCCACCT
GGACCTGCTCTTTGAGCACCACCACCACCTGCCCCTGGGCCCACCTCAGGCCCCTGCCCCTCCAGGCCCACCTCCAGCTCTGCAGCAGAC
TATGCAAGCCATGCTGCACTTTGGGGGCCGGCTGGCCCAGAGCCTTCGGGGGACTTCCAAGGAAGCTGCTTCAGACCCCTCTGACTCTCC
AAACCTTCCCACACCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTCCCGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTC
CCGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACAGGAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGG
CCTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAATGAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCT
GCCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCCCGAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAG
GATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGCTGCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCT
GCGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGATGGCATGGAGGGTCTGGTGCCTGTGGGGTATACCTCCCTTGT
TCTGTAGCCCTGGGACCCTTTCCTGCGTATGTGTCTCCTTCCTGTCACCTGGGAATGGAATGGCCAGTGAACACCATCCCAGAAGCATTT
TCCCTCTGCAAAATGACGTTTCTTCCCACGTCTGTTTCTGCTAATATTTAAAATAAACTTTCCTTCTTCCCTCCTATACCCACCTGTAAG
GTGAAATCTGCTCTTCTTCCAAATATATAAAAAAGGAATTGCCCTCCAGGTAATCCCTTTCCTTTTTCCCGTCTATATAAGGGAATGTCT
TCCTTCCTATCTATCTGCAAAATGGAAATCTAGACCTCCTTCTTCATCCATAAGTGGACTGTGCCAGTACAATACATGCCTCAGCCCCCA
AGCCTAGAAGGACCTCTAGTCTCCTTCCTGTGTGGAATCTTCCCCACTCCATCCCTCCCAAGTTGCCTGTATTGATAATGTACTCACTCA
TGCTGTACTAGGTGCTGAAGCCTGGACACCCTTGGTGGGTGGGCCTGTGGTGATGGTTTGCATCCTTCCTCCTTTGTCCCAATAAAGTAT

>In-frame_TMEM234_ENST00000344461_chr1_32681795_-_RUSC1_ENST00000368347_chr1_155295107_+_2440nt
AGACAGCGGCGTTGCCATGGCGGCGTCTCTGGGGCAGGTGTTGGCTCTGGTGCTGGTGGCCGCTCTGTGGGGTGGCACGCAGCCGCTGCT
GAAGCGGGCCTCCGCCGGCCTGCAGCGGGTTCATGAGCCGACCTGGGCCCAGCAGTTGCTACAGGAGATGAAGACCCTCTTCTTGAATAC
TGAGTACCTGATGCCCTTTCTCCTCAACCAGTGTGGATCCCTTCTCTATTACCTCACCTTGGCATCGACAGATCTGACCCTGGCTGTGCC
CATCTGTAACTCTCTGGCTATCATCTTCACACTGATTGTTGGGAAGGCCCTTGGAGAAGATATTGGTGGAAAACGAGCAGTTGCTGGCAT
GGTGCTCACCGTGATAGGAATTTCACTCTGCATCACAAGCTCAGTTCCATGGACTGCAGAACTCCAGCTGCATGGAAAGGGCCAGCTGCA
GACTTTGAGCCAGAAATGCAAACGGGAGGCCTCTGGGACTCAGTCAGAGCGCTTTGGCTGAATGAGGGGTGGAACCGAGGGAAGAAGGTG
CGTCGGAGTGGCAGATGCAGGAAATGAGCTGTCTATTAGCCTTGCCTGCCCCACCCATGAGGTAGGCAGAAATCCTCACTGCCAGCCCCT
CTTAAACAGGTAGAGAGCTGTGAGCCCCAGCCCCACCTGACTCCAGCACACCTGGCGAGTAGTAGCTGTCAATAAATCTATGGTAAACAG
AGCCCAGTTGGGTGATAGCCGGCTGAGCCCGGATGTGGGGCACCTGGTGCTGACCACCCTCTGCCCGGCCCTCCACGCCCTGGTGGCGGA
CGGGCTGAAGCCTTTCCGGAAGGACCTCATCACCGGGCAGCGCAGGAGCAGCCCCTGGAGCGTGGTGGAGGCGTCGGTGAAGCCAGGCTC
CAGCACCCGCTCCCTTGGAACCCTGTATAGCCAGGTCAGCCGTCTAGCCCCGCTGAGCAGCAGCCGTAGCCGCTTCCATGCCTTTATCCT
GGGCCTCCTCAACACCAAGCAGTTGGAGCTGTGGTTTTCCAGTCTCCAGGAAGATGCAGGCCTGCTCTCCCTCCTGTACCTGCCAACAGG
ATTTTTCTCCCTGGCCCGCGGTGGTTGTCCCTCCCTGTCCACAGAGCTGCTGCTCCTGCTGCAGCCATTGTCGGTGCTCACTTTCCACCT
GGACCTGCTCTTTGAGCACCACCACCACCTGCCCCTGGGCCCACCTCAGGCCCCTGCCCCTCCAGGCCCACCTCCAGCTCTGCAGCAGAC
TATGCAAGCCATGCTGCACTTTGGGGGCCGGCTGGCCCAGAGCCTTCGGGGGACTTCCAAGGAAGCTGCTTCAGACCCCTCTGACTCTCC
AAACCTTCCCACACCAGGGAGCTGGTGGGAGCAGTTGACCCAGGCCTCCCGGGTCTATGCCTCTGGGGGCACTGAGGGCTTTCCTCTTTC
CCGATGGGCACCGGGGCGTCATGGGACTGCAGCTGAAGAAGGTGCACAGGAGAGACCCCTGCCCACAGATGAGATGGCACCAGGCAGGGG
CCTCTGGTTGGGAAGACTATTTGGAGTGCCTGGGGGCCCCGCAGAAAATGAGAATGGAGCCCTAAAGTCCAGGAGACCATCTAGCTGGCT
GCCCCCGACAGTGAGTGTGTTGGCTCTTGTGAAGCGGGGGGCACCTCCCGAGATGCCTTCTCCTCAGGAGCTTGAGGCCTCAGCACCCAG
GATGGTGCAAACCCATAGGGCAGTGCGGGCTCTCTGTGATCACACTGCTGCAAGACCTGACCAGTTGAGCTTCCGGCGTGGGGAAGTGCT
GCGTGTCATCACCACAGTGGATGAGGACTGGCTCCGCTGTGGGCGGGATGGCATGGAGGGTCTGGTGCCTGTGGGGTATACCTCCCTTGT
TCTGTAGCCCTGGGACCCTTTCCTGCGTATGTGTCTCCTTCCTGTCACCTGGGAATGGAATGGCCAGTGAACACCATCCCAGAAGCATTT
TCCCTCTGCAAAATGACGTTTCTTCCCACGTCTGTTTCTGCTAATATTTAAAATAAACTTTCCTTCTTCCCTCCTATACCCACCTGTAAG
GTGAAATCTGCTCTTCTTCCAAATATATAAAAAAGGAATTGCCCTCCAGGTAATCCCTTTCCTTTTTCCCGTCTATATAAGGGAATGTCT
TCCTTCCTATCTATCTGCAAAATGGAAATCTAGACCTCCTTCTTCATCCATAAGTGGACTGTGCCAGTACAATACATGCCTCAGCCCCCA
AGCCTAGAAGGACCTCTAGTCTCCTTCCTGTGTGGAATCTTCCCCACTCCATCCCTCCCAAGTTGCCTGTATTGATAATGTACTCACTCA
TGCTGTACTAGGTGCTGAAGCCTGGACACCCTTGGTGGGTGGGCCTGTGGTGATGGTTTGCATCCTTCCTCCTTTGTCCCAATAAAGTAT


Top

FusionGenePPI for TMEM234_RUSC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMEM234CREB3L1, CREB3, LMNARUSC1IKBKG, TRAF6, APP, PNMA1, STUB1, RBPMS, WWP2, FAM9B, DVL2, HNRNPH2, UBE2S, FAM83H


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMEM234_RUSC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMEM234_RUSC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource