FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38464

FusionGeneSummary for TMEM165_DACH1

check button Fusion gene summary
Fusion gene informationFusion gene name: TMEM165_DACH1
Fusion gene ID: 38464
HgeneTgene
Gene symbol

TMEM165

DACH1

Gene ID

55858

1602

Gene nametransmembrane protein 165dachshund family transcription factor 1
SynonymsCDG2K|FT27|GDT1|TMPT27|TPARLDACH
Cytomap

4q12

13q21.33

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane protein 165TPA regulated locustransmembrane protein PT27transmembrane protein TPARLdachshund homolog 1dac homolog
Modification date2018051920180523
UniProtAcc

Q9HC07

Q9UI36

Ensembl transtripts involved in fusion geneENST00000506198, ENST00000381334, 
ENST00000542052, ENST00000514904, 
ENST00000313174, ENST00000305425, 
ENST00000354591, ENST00000359684, 
Fusion gene scores* DoF score3 X 2 X 4=242 X 2 X 2=8
# samples 42
** MAII scorelog2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: TMEM165 [Title/Abstract] AND DACH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTMEM165

GO:0032472

Golgi calcium ion transport

23569283

TgeneDACH1

GO:0030336

negative regulation of cell migration

20956529

TgeneDACH1

GO:2000279

negative regulation of DNA biosynthetic process

16980615


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-29-1778-01ATMEM165chr4

56290810

+DACH1chr13

72063280

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000506198ENST00000313174TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000506198ENST00000305425TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000506198ENST00000354591TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000506198ENST00000359684TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000381334ENST00000313174TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000381334ENST00000305425TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000381334ENST00000354591TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000381334ENST00000359684TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000542052ENST00000313174TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000542052ENST00000305425TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000542052ENST00000354591TMEM165chr4

56290810

+DACH1chr13

72063280

-
In-frameENST00000542052ENST00000359684TMEM165chr4

56290810

+DACH1chr13

72063280

-
3UTR-3CDSENST00000514904ENST00000313174TMEM165chr4

56290810

+DACH1chr13

72063280

-
3UTR-3CDSENST00000514904ENST00000305425TMEM165chr4

56290810

+DACH1chr13

72063280

-
3UTR-3CDSENST00000514904ENST00000354591TMEM165chr4

56290810

+DACH1chr13

72063280

-
3UTR-3CDSENST00000514904ENST00000359684TMEM165chr4

56290810

+DACH1chr13

72063280

-

Top

FusionProtFeatures for TMEM165_DACH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TMEM165

Q9HC07

DACH1

Q9UI36

May function as a calcium/proton transporter involved incalcium and in lysosomal pH homeostasis. Therefore, it may play anindirect role in protein glycosylation.{ECO:0000269|PubMed:22683087, ECO:0000269|PubMed:23569283}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56184_211299325Coiled coilOntology_term=ECO:0000255
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56111_126299325Topological domainCytoplasmic
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56148_151299325Topological domainLumenal
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56173_228299325Topological domainCytoplasmic
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56250_267299325Topological domainLumenal
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56289_299299325Topological domainCytoplasmic
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+5634_89299325Topological domainLumenal
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56127_147299325TransmembraneHelical
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56152_172299325TransmembraneHelical
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56229_249299325TransmembraneHelical
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56268_288299325TransmembraneHelical
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+5690_110299325TransmembraneHelical
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511632_720525709Coiled coilOntology_term=ECO:0000255
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28632_720377561Coiled coilOntology_term=ECO:0000255
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17632_720323507Coiled coilOntology_term=ECO:0000255
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612632_720577761Coiled coilOntology_term=ECO:0000255
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28469_472377561Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17327_335323507Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17469_472323507Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511618_698525709RegionNote=DACHbox-C
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28618_698377561RegionNote=DACHbox-C
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17618_698323507RegionNote=DACHbox-C
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612618_698577761RegionNote=DACHbox-C

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56321_324299325Topological domainLumenal
HgeneTMEM165chr4:56290810chr13:72063280ENST00000381334+56300_320299325TransmembraneHelical
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511116_123525709Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511142_165525709Compositional biasNote=Poly-Ser
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511327_335525709Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511469_472525709Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-51161_68525709Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-51174_89525709Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-51192_103525709Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28116_123377561Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28142_165377561Compositional biasNote=Poly-Ser
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28327_335377561Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-2861_68377561Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-2874_89377561Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-2892_103377561Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17116_123323507Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17142_165323507Compositional biasNote=Poly-Ser
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-1761_68323507Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-1774_89323507Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-1792_103323507Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612116_123577761Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612142_165577761Compositional biasNote=Poly-Ser
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612327_335577761Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612469_472577761Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-61261_68577761Compositional biasNote=Poly-Ala
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-61274_89577761Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-61292_103577761Compositional biasNote=Poly-Gly
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511191_277525709RegionNote=DACHbox-N
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28191_277377561RegionNote=DACHbox-N
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17191_277323507RegionNote=DACHbox-N
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612191_277577761RegionNote=DACHbox-N


Top

FusionGeneSequence for TMEM165_DACH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_288aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEDPYGVAVGGTVGHCLCTGLAV
IGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELK
MDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_288aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEDPYGVAVGGTVGHCLCTGLAV
IGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELK
MDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_288aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEDPYGVAVGGTVGHCLCTGLAV
IGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELK
MDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_288aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEDPYGVAVGGTVGHCLCTGLAV
IGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELK
MDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDA

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_483aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTN
LGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVA
VGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNA
RAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSL

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_483aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTN
LGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVA
VGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNA
RAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSL

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_483aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTN
LGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVA
VGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNA
RAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSL

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_483aa
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEKIFTPAAPVHTNKEDPATQTN
LGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVA
VGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGLLKVAIDNA
RAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSL

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_420aa
MEIPMQKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTV
IPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTL
TFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPF
LFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFE

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_420aa
MEIPMQKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTV
IPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTL
TFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPF
LFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFE

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_420aa
MEIPMQKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTV
IPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTL
TFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPF
LFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFE

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_420aa
MEIPMQKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLMTCLSVLFGYATTV
IPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQALTL
TFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPF
LFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEFE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_864nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTA
ATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAA
CTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTT
CTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAG
ATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGG
CTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAA
CAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCT

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_864nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTA
ATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAA
CTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTT
CTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAG
ATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGG
CTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAA
CAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCT

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_864nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTA
ATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAA
CTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTT
CTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAG
ATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGG
CTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAA
CAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCT

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_864nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTA
ATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAA
CTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTT
CTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAG
ATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGG
CTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAA
CAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCT

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_1449nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAAT
TTGGGATTTATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATG
GCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCC
ACCACAGTCATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAG
ATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTA
AATGGACCGGGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCT
CTTACATTAACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCC
GTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGAT
GAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCA
TCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCC
AGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAG
CAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTT
GAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTG
ACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTC

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_1449nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAAT
TTGGGATTTATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATG
GCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCC
ACCACAGTCATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAG
ATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTA
AATGGACCGGGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCT
CTTACATTAACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCC
GTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGAT
GAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCA
TCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCC
AGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAG
CAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTT
GAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTG
ACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTC

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_1449nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAAT
TTGGGATTTATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATG
GCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCC
ACCACAGTCATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAG
ATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTA
AATGGACCGGGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCT
CTTACATTAACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCC
GTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGAT
GAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCA
TCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCC
AGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAG
CAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTT
GAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTG
ACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTC

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_1449nt
ATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCG
GTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTG
CAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAAT
TTGGGATTTATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATG
GCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCC
ACCACAGTCATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAG
ATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTA
AATGGACCGGGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCT
CTTACATTAACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCC
GTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGAT
GAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCA
TCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCC
AGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAG
CAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTT
GAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTG
ACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTC

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_1260nt
ATGGAGATTCCGATGCAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTT
ATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGC
TATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTC
ATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCT
GATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCG
GGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTA
ACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGA
ACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCG
CTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTT
CTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAA
GAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCT
ATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAG
ACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAG
ATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_1260nt
ATGGAGATTCCGATGCAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTT
ATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGC
TATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTC
ATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCT
GATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCG
GGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTA
ACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGA
ACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCG
CTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTT
CTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAA
GAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCT
ATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAG
ACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAG
ATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_1260nt
ATGGAGATTCCGATGCAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTT
ATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGC
TATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTC
ATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCT
GATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCG
GGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTA
ACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGA
ACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCG
CTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTT
CTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAA
GAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCT
ATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAG
ACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAG
ATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_1260nt
ATGGAGATTCCGATGCAGAAAATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTT
ATCCATGCATTTGTCGCTGCCATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGC
TATAACCGCCTGACCGTGCTGGCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTC
ATCCCCAGGGTCTATACATACTATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCT
GATGAGGGTCAAGAGGAACTGGAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCG
GGAGATGTTGAAACGGGTACAAGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTA
ACATTCTTAGCAGAATGGGGTGATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGA
ACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCG
CTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTT
CTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAA
GAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCT
ATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAG
ACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAG
ATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_3786nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATG
GTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCA
GAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAG
GTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAG
ATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACAC
TTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGG
AAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATG
ACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAA
CTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAG
AAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGT
TTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACT
GCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTT
CCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCA
GCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATT
CAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAA
CCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAA
AAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGT
TGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTT
AGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAG
TATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCA
AGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTT
GCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACC
CTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAA
GTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATG
AATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAA
TCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATA
GATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTA
AGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTAT
TGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCC
TAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCAT
ACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTT
TGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGC
AAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTA
AGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTT
TATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGA
ACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTAT
TACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATT
TGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATTTAATTTTCTTTTCCTTTTCAACAATCTCCTAATAAAACTGTCTGA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_3786nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATG
GTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCA
GAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAG
GTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAG
ATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACAC
TTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGG
AAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATG
ACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAA
CTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAG
AAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGT
TTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACT
GCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTT
CCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCA
GCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATT
CAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAA
CCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAA
AAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGT
TGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTT
AGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAG
TATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCA
AGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTT
GCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACC
CTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAA
GTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATG
AATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAA
TCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATA
GATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTA
AGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTAT
TGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCC
TAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCAT
ACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTT
TGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGC
AAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTA
AGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTT
TATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGA
ACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTAT
TACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATT
TGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATTTAATTTTCTTTTCCTTTTCAACAATCTCCTAATAAAACTGTCTGA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_3786nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATG
GTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCA
GAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAG
GTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAG
ATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACAC
TTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGG
AAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATG
ACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAA
CTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAG
AAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGT
TTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACT
GCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTT
CCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCA
GCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATT
CAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAA
CCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAA
AAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGT
TGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTT
AGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAG
TATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCA
AGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTT
GCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACC
CTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAA
GTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATG
AATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAA
TCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATA
GATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTA
AGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTAT
TGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCC
TAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCAT
ACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTT
TGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGC
AAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTA
AGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTT
TATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGA
ACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTAT
TACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATT
TGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATTTAATTTTCTTTTCCTTTTCAACAATCTCCTAATAAAACTGTCTGA

>In-frame_TMEM165_ENST00000506198_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_1806nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGACCCCTATG
GTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCA
GAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAG
GTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAG
ATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACAC
TTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGG
AAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATG
ACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAA
CTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAG
AAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGT
TTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACT
GCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTT
CCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCA
GCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATT
CAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAA
CCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAA

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_4371nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTA
CACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCCATATCAG
TTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTG
CAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATACTATGTTT
CAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAG
TTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACAAGCATAA
CAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGTGATCGCT
CTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGAT
TGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCC
TTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCG
AGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTG
AGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTC
AAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGA
CGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAA
CAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTA
TAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTAT
TAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGA
ATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCT
GAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGT
AGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGA
GGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTT
TTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATA
TAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTG
GTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTA
TTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCT
GGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTG
TGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAA
CACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACC
ATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTT
TGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTC
TTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTA
AAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTT
CTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCA
ATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCT
ATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTC
TTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTA
CAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGT
AGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTT
TGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTC
TTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGT
TTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGT
TGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTAT
TTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACA
TCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATT

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_4371nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTA
CACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCCATATCAG
TTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTG
CAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATACTATGTTT
CAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAG
TTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACAAGCATAA
CAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGTGATCGCT
CTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGAT
TGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCC
TTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCG
AGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTG
AGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTC
AAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGA
CGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAA
CAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTA
TAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTAT
TAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGA
ATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCT
GAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGT
AGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGA
GGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTT
TTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATA
TAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTG
GTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTA
TTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCT
GGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTG
TGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAA
CACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACC
ATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTT
TGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTC
TTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTA
AAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTT
CTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCA
ATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCT
ATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTC
TTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTA
CAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGT
AGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTT
TGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTC
TTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGT
TTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGT
TGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTAT
TTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACA
TCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATT

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_4371nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTA
CACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCCATATCAG
TTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTG
CAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATACTATGTTT
CAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAG
TTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACAAGCATAA
CAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGTGATCGCT
CTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGAT
TGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCC
TTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCG
AGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTG
AGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTC
AAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGA
CGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAA
CAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTA
TAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTAT
TAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGA
ATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCT
GAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGT
AGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGA
GGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTT
TTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATA
TAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACTGGTAGTG
GTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAGGAAGGTA
TTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATGTCTTTCT
GGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAGAACTCTG
TGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAAATCAAAA
CACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTCCAATACC
ATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACTGTCTTTT
TGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTACCTTCTC
TTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGTCATCTTA
AAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAATATAGTT
CTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTTCCTTGCA
ATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTACAGTTCCT
ATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGCATAGTTC
TTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAAAGGATTA
CAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTACATATGT
AGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGAAGACCTT
TGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGAGAGACTC
TTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACAGGTTGGT
TTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAATGTCTAGT
TGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAATTGTCTAT
TTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGTTTTTACA
TCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTATTGTATT

>In-frame_TMEM165_ENST00000381334_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_2391nt
GACTCCAGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCA
CCTCCCGGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCC
GTCGCCGGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGG
CGCCCCGGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGA
ACAAAGAACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGAAAATATTTA
CACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCCATATCAG
TTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTGGCTGGTG
CAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATACTATGTTT
CAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTGGAAGAAG
TTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACAAGCATAA
CAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGTGATCGCT
CTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGCACGGGAT
TGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCC
TTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCTTCCATCG
AGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTG
AGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTC
AAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCAGAACAGA
CGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGCGGCAGAA
CAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATCCATGTTA
TAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTTTGTGTAT
TAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGACCTGAGA
ATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGGCAGGTCT
GAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGACTCTTGT
AGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGGGCATAGA
GGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAGAATTTTT
TTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCATTGAATA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000313174_chr13_72063280_-_4468nt
AGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCACCTCCC
GGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCCGTCGCC
GGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCC
GGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAG
AACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGGACATCAGTTTTTTT
CTTGGTAGCAAGCTGTAGATTTTGTTTCAAGGAAAGCATCTTCATCTTCTCTAGTTTCATCATGTATAGATGGAGATTCCGATGCAGAAA
ATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCC
ATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTG
GCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATAC
TATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTG
GAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACA
AGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGT
GATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGC
ACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGA
GACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCT
TCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAA
AAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCC
ATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCA
GAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGC
GGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATC
CATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTT
TGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGA
CCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGG
CAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGA
CTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGG
GCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAG
AATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCA
TTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACT
GGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAG
GAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATG
TCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAG
AACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAA
ATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTC
CAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACT
GTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTA
CCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGT
CATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAA
TATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTT
CCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTAC
AGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGC
ATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAA
AGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTA
CATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGA
AGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGA
GAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACA
GGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAAT
GTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAAT
TGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGT
TTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000305425_chr13_72063280_-_4468nt
AGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCACCTCCC
GGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCCGTCGCC
GGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCC
GGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAG
AACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGGACATCAGTTTTTTT
CTTGGTAGCAAGCTGTAGATTTTGTTTCAAGGAAAGCATCTTCATCTTCTCTAGTTTCATCATGTATAGATGGAGATTCCGATGCAGAAA
ATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCC
ATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTG
GCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATAC
TATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTG
GAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACA
AGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGT
GATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGC
ACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGA
GACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCT
TCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAA
AAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCC
ATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCA
GAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGC
GGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATC
CATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTT
TGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGA
CCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGG
CAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGA
CTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGG
GCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAG
AATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCA
TTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACT
GGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAG
GAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATG
TCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAG
AACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAA
ATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTC
CAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACT
GTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTA
CCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGT
CATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAA
TATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTT
CCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTAC
AGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGC
ATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAA
AGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTA
CATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGA
AGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGA
GAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACA
GGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAAT
GTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAAT
TGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGT
TTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000354591_chr13_72063280_-_4468nt
AGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCACCTCCC
GGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCCGTCGCC
GGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCC
GGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAG
AACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGGACATCAGTTTTTTT
CTTGGTAGCAAGCTGTAGATTTTGTTTCAAGGAAAGCATCTTCATCTTCTCTAGTTTCATCATGTATAGATGGAGATTCCGATGCAGAAA
ATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCC
ATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTG
GCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATAC
TATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTG
GAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACA
AGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGT
GATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGC
ACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGA
GACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCT
TCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAA
AAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCC
ATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCA
GAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGC
GGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATC
CATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTT
TGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGA
CCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGG
CAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGA
CTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGG
GCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAG
AATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCA
TTGAATATAAGCCAAAAGCTTTCACTGAAGGTTTTTTTTTCTTAAAAATAAAAAAAAATATATAAGTGTAACATGTTTTCATTCCAAACT
GGTAGTGGTATGTAGAATTAAAGATAATAATGTTGCTTCTTATTCAAACTGTTGGTCATATGTACAGTATATAAACATAAAACACACAAG
GAAGGTATTATGTATGCAGTAGTATACTAGAGTTTAGGAAAATGAAAATTTTAGAAAATATGTTTTGTCACCCTGTTGGTCAGAAAGATG
TCTTTCTGGTTTTAACGCATGCAGGCATGTAAATATTTGTCTGGAGTCACAGTATTAATGAATGAGATCTTAAGCATCTGGTGACATCAG
AACTCTGTGTCAGCCACTTTTATTTGTATATTGAACCCTAGCTAGTGCCCCAAGCTGCACTATTGGGAATGGATTGTGGCTGAACAGCAA
ATCAAAACACCAGAAATATTTTTATATGTTAACGTCATATTATGTTAATGTTGCTGAAAACAAAACCTAACAAACCTTGATGTACCAGTC
CAATACCATGTAGCGCTGAGTGATAAAGTTAAAATGTGCTGTGCTTCCCACCCTTGTCAGAGGGAAGGGTGGCTATGTGTTATTTTCACT
GTCTTTTTGAAAGTTACAGTATGTGTTTTCACTTTCGTGCAGATAACTGGAAGTAAAGCGGCAAACAGTGCTTATTACATGCTAAAGTTA
CCTTCTCTTTGTTTTTTGCATATCTGGAATTACACCTTTAAAGACTGATATGAATCAGTACGGTCACTATACATTTTATGATTTTTCTGT
CATCTTAAAATTGTATGATCGTAACATTATTTATTACCACAAAACAGCAAAATCTTCAATGTCTAAGAAAACTAGCTTAAAATGTTTAAA
TATAGTTCTGATTGGGTATTAATTACTTGATTAAGAAAAAATTAACATTATAGATACTCTGGCATTACGCTTCTATACCTTTTAGGTCTT
CCTTGCAATACTGGAACATAATTCTTTTGTGTAGCTCACTATTAGCCAGCTAAGTTCATCTTTTTAATACCATAAAAAGGTTATATGTAC
AGTTCCTATTTTAGCTTGCTTACAAAGGGAGCATTATTTTTATTTAAAGTATTGCTAGTAAATGATTTGTAGAAACTTGGTTTTCTAAGC
ATAGTTCTTCCATAACCACCTTTTGTTGTTTGAGCACAAGGGATTCTTTTCCTAGTTCTATGTGTTTGTTTCCCTATATGCAGTCTTTAA
AGGATTACAACACTTAAAATTGAATGGACTTGTGTCAAGCTTTTTGCATCATACATTTTTTGAAAGATTTTTAAAAAAGCCTACAACTTA
CATATGTAGTAGAATCAGCCATTGCTCTGCTCCTGGCATAGAGTCACCTGTTTGTTATGTGGATTAAATAGTTTTAAAATACATATTTGA
AGACCTTTGAGAATGCTTTAGTGTTTGATTTGAAATAAAAGGAAATTTTAGCAAGGATTAAAGAAAAAAGCTATCAGCTGTATGTTAAGA
GAGACTCTTACTAACATGTTGTAAATATTACAATTCATGAAATGTTATTGTAAGTCTGTAACTTAATTTTTTCCCTGTTTTAGTTATACA
GGTTGGTTTGGAAATTTGTGTTTTGGCATAAACAAGTAAAATGTGCCCATTTTATGGTTTCCATGCTTTTGTAATCCTAAAAATATTAAT
GTCTAGTTGTTCTATATTATAACCACATTTGCGCTCTATGCAAGCCCTTGGAACAGAACATACTCATCTTCATGTAGGACCTATGAAAAT
TGTCTATTTTTATCTATATATTTAAAGTTTTCTAAAAATGATAAAAGGTTATTACGAATTTTGTTGTACAAAATCTGTACAAAAATCTGT
TTTTACATCATAATGCAAGAATTGGAAATTTTTCTATGGTAGCCTAGTTATTTGAGCCTGGTTTCAATGTGAGAACCACGTTTACTGTTA

>In-frame_TMEM165_ENST00000542052_chr4_56290810_+_DACH1_ENST00000359684_chr13_72063280_-_2488nt
AGTTTAGCCGCCGCCGGAGAGGACGGGCGCCGAGCCGGGGCTGCGGACTTCGGCCTGCCCCTCACCTCACTCCCGCTGCTTGCACCTCCC
GGATGGTGCTGACTGCTCCCTAAGCGGCGGCGGCGGCGAGTCGTGAGGACGCGCCGCGGAGGCTGTTCGGGGTCGAGGCTTCCCGTCGCC
GGCACTTCCTCTTGCGGCGCCCGTGCGCGGCCGGCCCGGCAGGCGGGATGGCGGCCGCGGCTCCAGGGAACGGCCGCGCATCGGCGCCCC
GGCTGCTTCTGCTCTTTCTGGTTCCGCTGCTGTGGGCCCCGGCTGCGGTCCGGGCCGGCCCAGATGAAGACCTTAGCCACCGGAACAAAG
AACCGCCGGCGCCGGCCCAGCAGCTGCAGCCGCAGCCTGTGGCTGTGCAGGGCCCCGAGCCGGCCCGGGTCGAGGGACATCAGTTTTTTT
CTTGGTAGCAAGCTGTAGATTTTGTTTCAAGGAAAGCATCTTCATCTTCTCTAGTTTCATCATGTATAGATGGAGATTCCGATGCAGAAA
ATATTTACACCAGCAGCTCCAGTTCATACCAATAAAGAAGATCCTGCTACCCAAACTAATTTGGGATTTATCCATGCATTTGTCGCTGCC
ATATCAGTTATTATTGTATCTGAATTGGGTGATAAGACATTTTTTATAGCAGCCATCATGGCAATGCGCTATAACCGCCTGACCGTGCTG
GCTGGTGCAATGCTTGCCTTGGGACTAATGACATGCTTGTCAGTTTTGTTTGGCTATGCCACCACAGTCATCCCCAGGGTCTATACATAC
TATGTTTCAACTGTATTATTTGCCATTTTTGGCATTAGAATGCTTCGGGAAGGCTTAAAGATGAGCCCTGATGAGGGTCAAGAGGAACTG
GAAGAAGTTCAAGCTGAATTAAAGAAGAAAGATGAAGAATTTCAACGAACCAAACTTTTAAATGGACCGGGAGATGTTGAAACGGGTACA
AGCATAACAGTACCTCAGAAAAAGTGGTTGCATTTTATTTCACCCATTTTTGTTCAAGCTCTTACATTAACATTCTTAGCAGAATGGGGT
GATCGCTCTCAACTAACTACAATTGTATTGGCAGCTAGAGAGGACCCCTATGGTGTAGCCGTGGGTGGAACTGTGGGGCACTGCCTGTGC
ACGGGATTGGCAGTAATTGGAGGAAGAATGATAGCACAGAAAATCTCTGTCAGAACTGATGAGACCCCGCTTTCTACACCAACCGCAAGA
GACAGCCTTGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCTGATGGACTGTCT
TCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATGCCAGAGCTCAAGAGAAACAGGTCCAACTGGAA
AAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGAACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCC
ATAGTTCAAAAGAGGCTAAAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAGCA
GAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGAGATAGAGGCTGACCGCAGTGGC
GGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTGAAAACTACTGTCATGTACTGAATCTTTCCTGTTGAAGAAATC
CATGTTATAGAAAAGAACTTTGCAGTCAGACATTCGTCATGGGAAAGTTCAGAAAAAAATAAAGTCCTTTTAAGGGAACTTCCTGAATTT
TGTGTATTAATGTTCTTTAAAAGTTTAAGTATTCTACAAAAAAAAAAAAAGTTTTCTCCATTGATTTTCACCTGTGGTTCATACCAGAGA
CCTGAGAATGTTTGTAAATGTACAAGTATCAAAGTTCTTACAGTTAATTACTGCAACTTGCTGCTGGACAATTGTATACAGAGTTAAAGG
CAGGTCTGAATAAGACCTAGCTTTGTTTTTTTCTAATGGAATGAACCATTTTCCTCTTCTGAAAATTCTGTATCTGAGCACATCAAGAGA
CTCTTGTAGCAGTGGTTACCCAGACTTACAGAATTATGTCCTCCAGAAACCAGCAAGAACACTTGGAATGAACGAATGAACTTGTAGGGG
GCATAGAGGATTCTTGAAAAAAAAAAATGCAAGAGTGATTTTCTGTTACATTCAATTTCAAACTCTCTAATTGTGGGTTTTCTCCTGAAG
AATTTTTTTTCACATACTTTCCAAAAGACCAACAAATGGATGTTGACAACAACCCAATGAAATAACATTTTGCATATCTGAAAAGAAGCA


Top

FusionGenePPI for TMEM165_DACH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TMEM165CUL3, RPLP1, MTHFD1, RPS26, CALU, REL, AHSP, CDK1, CNOT2, CDK2AP1, SMC3, GPATCH8, SMC6, USP43, UBXN8, ERRFI1, PTAR1, ARPC2, ATP2C1, UBE4B, PPME1, WDR62, VPS35, TRIM25DACH1UBE2I, NAGK, HDAC1, HDAC3, NCOR1, JUN, CREB1, SIN3A, SMAD4, SMAD3, DACH1, FGF12, PPIG, RNF14, AHCYL1, U2AF2, ZCCHC10, C1orf35, HBB, EWSR1, FOXA2, FOXC1, FOXC2, FOXE1, TRIM44, DACH2, GPSM1, NCKIPSD, SCOC, WDR83, TP53


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511629_708525709SIN3A
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28629_708377561SIN3A
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17629_708323507SIN3A
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612629_708577761SIN3A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneDACH1chr4:56290810chr13:72063280ENST00000305425-511191_386525709SIX6 and HDAC3
TgeneDACH1chr4:56290810chr13:72063280ENST00000313174-28191_386377561SIX6 and HDAC3
TgeneDACH1chr4:56290810chr13:72063280ENST00000354591-17191_386323507SIX6 and HDAC3
TgeneDACH1chr4:56290810chr13:72063280ENST00000359684-612191_386577761SIX6 and HDAC3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TMEM165_DACH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TMEM165_DACH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTMEM165C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneTMEM165C3553571CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIk1ORPHANET;UNIPROT