FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3835

FusionGeneSummary for BAP1_TCEA3

check button Fusion gene summary
Fusion gene informationFusion gene name: BAP1_TCEA3
Fusion gene ID: 3835
HgeneTgene
Gene symbol

BAP1

TCEA3

Gene ID

9223

6920

Gene namemembrane associated guanylate kinase, WW and PDZ domain containing 1transcription elongation factor A3
SynonymsAIP-3|AIP3|BAIAP1|BAP-1|BAP1|MAGI-1|Magi1d|TNRC19|WWP3TFIIS|TFIIS.H
Cytomap

3p14.1

1p36.12

Type of geneprotein-codingprotein-coding
Descriptionmembrane-associated guanylate kinase, WW and PDZ domain-containing protein 1BAI1-associated protein 1WW domain-containing protein 3atrophin-1-interacting protein 3membrane-associated guanylate kinase inverted 1trinucleotide repeat-containing gene 19 transcription elongation factor A protein 3rhabdomyosarcoma antigen MU-RMS-40.22transcription elongation factor A (SII), 3transcription elongation factor S-II protein 3transcription elongation factor TFIIS.h
Modification date2018051920180519
UniProtAcc

Q92560

O75764

Ensembl transtripts involved in fusion geneENST00000460680, ENST00000296288, 
ENST00000450454, ENST00000374601, 
ENST00000461794, 
Fusion gene scores* DoF score8 X 8 X 5=3206 X 6 X 4=144
# samples 87
** MAII scorelog2(8/320*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/144*10)=-1.04064198449735
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BAP1 [Title/Abstract] AND TCEA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVMESOTCGA-MQ-A4LC-01ABAP1chr3

52440269

-TCEA3chr1

23745632

-
TCGALDMESOTCGA-MQ-A4LC-01ABAP1chr3

52439781

-TCEA3chr1

23745632

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000460680ENST00000450454BAP1chr3

52440269

-TCEA3chr1

23745632

-
In-frameENST00000460680ENST00000374601BAP1chr3

52440269

-TCEA3chr1

23745632

-
5CDS-5UTRENST00000460680ENST00000461794BAP1chr3

52440269

-TCEA3chr1

23745632

-
In-frameENST00000296288ENST00000450454BAP1chr3

52440269

-TCEA3chr1

23745632

-
In-frameENST00000296288ENST00000374601BAP1chr3

52440269

-TCEA3chr1

23745632

-
5CDS-5UTRENST00000296288ENST00000461794BAP1chr3

52440269

-TCEA3chr1

23745632

-
Frame-shitENST00000460680ENST00000450454BAP1chr3

52439781

-TCEA3chr1

23745632

-
Frame-shitENST00000460680ENST00000374601BAP1chr3

52439781

-TCEA3chr1

23745632

-
5CDS-5UTRENST00000460680ENST00000461794BAP1chr3

52439781

-TCEA3chr1

23745632

-
Frame-shitENST00000296288ENST00000450454BAP1chr3

52439781

-TCEA3chr1

23745632

-
Frame-shitENST00000296288ENST00000374601BAP1chr3

52439781

-TCEA3chr1

23745632

-
5CDS-5UTRENST00000296288ENST00000461794BAP1chr3

52439781

-TCEA3chr1

23745632

-

Top

FusionProtFeatures for BAP1_TCEA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BAP1

Q92560

TCEA3

O75764

Deubiquitinating enzyme that plays a key role inchromatin by mediating deubiquitination of histone H2A and HCFC1.Catalytic component of the PR-DUB complex, a complex thatspecifically mediates deubiquitination of histone H2Amonoubiquitinated at 'Lys-119' (H2AK119ub1). Does notdeubiquitinate monoubiquitinated histone H2B. Acts as a regulatorof cell growth by mediating deubiquitination of HCFC1 N-terminaland C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linkedpolyubiquitin chains. Deubiquitination of HCFC1 does not lead toincrease stability of HCFC1. Interferes with the BRCA1 and BARD1heterodimer activity by inhibiting their ability to mediateubiquitination and autoubiquitination. It however does not mediatedeubiquitination of BRCA1 and BARD1. Able to mediateautodeubiquitination via intramolecular interactions to couteractmonoubiquitination at the nuclear localization signal (NLS),thereby protecting it from cytoplasmic sequestration(PubMed:24703950). Acts as a tumor suppressor.{ECO:0000269|PubMed:12485996, ECO:0000269|PubMed:18757409,ECO:0000269|PubMed:19117993, ECO:0000269|PubMed:19188440,ECO:0000269|PubMed:19815555, ECO:0000269|PubMed:20436459,ECO:0000269|PubMed:24703950, ECO:0000269|PubMed:9528852}. Necessary for efficient RNA polymerase II transcriptionelongation past template-encoded arresting sites. The arrestingsites in DNA have the property of trapping a certain fraction ofelongating RNA polymerases that pass through, resulting in lockedternary complexes. Cleavage of the nascent transcript by S-IIallows the resumption of elongation from the new 3'-terminus.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTCEA3chr3:52440269chr1:23745632ENST00000450454-011130_17323349Compositional biasNote=Ser-rich
TgeneTCEA3chr3:52440269chr1:23745632ENST00000450454-011187_30323349DomainTFIIS central
TgeneTCEA3chr3:52440269chr1:23745632ENST00000450454-011306_34623349Zinc fingerTFIIS-type

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBAP1chr3:52440269chr1:23745632ENST00000460680-917630_661261730Coiled coilOntology_term=ECO:0000255
TgeneTCEA3chr3:52440269chr1:23745632ENST00000450454-0115_8223349DomainTFIIS N-terminal


Top

FusionGeneSequence for BAP1_TCEA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_587aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQEGALDLLKK
LHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKRE
DPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCTLTGDSVRDKCVEMLSAALKADDDYKDTGVNC
DKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGG

>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_393aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQEGALDLLKK
LHSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKRE

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_569aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQEGALDLLKKLHSCQMSIQLLQTTRIGV
AVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS
PKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPCTLTGDSVRDKCVEMLSAALKADDDYKDTGVNCDKMASEIEDHIYQELKST
DMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKKKNCTT

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_375aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQEGALDLLKKLHSCQMSIQLLQTTRIGV
AVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_1761nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAG
CTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAG
GAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAA
AGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAA
GACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATCGGTGGAAAGATCAAACAGCAGC
AAATCAAAAGCGGAGAGCCCCAAAACACCTAGCAGCCCCTTGACCCCCACGTTTGCCTCTTCCATGTGTCTCCTGGCCCCCTGCTATCTC
ACAGGGGACTCTGTCCGGGACAAGTGTGTGGAGATGCTGTCAGCAGCCCTGAAGGCGGACGATGATTACAAGGACTATGGAGTCAACTGT
GACAAGATGGCATCAGAAATCGAAGATCATATCTACCAAGAGCTCAAGAGCACGGACATGAAGTACCGGAACCGCGTGCGCAGCCGCATA
AGCAACCTCAAGGACCCCAGGAACCCCGGCCTGCGGCGGAACGTGCTCAGTGGGGCCATCTCCGCAGGGCTTATAGCCAAGATGACGGCA
GAGGAAATGGCCAGTGATGAACTGAGGGAGTTGAGGAATGCCATGACCCAGGAGGCCATCCGTGAGCACCAGATGGCCAAGACTGGCGGC
ACCACCACTGACCTCTTCCAGTGCAGCAAATGCAAGAAGAAGAACTGCACCTATAACCAGGTGCAGACACGCAGTGCTGATGAGCCCATG

>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_1179nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAG
CTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAG
GAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAA
AGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAA
GACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATCGGTGGAAAGAGCATGCTCGCTG

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_1707nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTT
GCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGAC
TCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCA
GAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCT
CCAAAAAGACCATCGGTGGAAAGATCAAACAGCAGCAAATCAAAAGCGGAGAGCCCCAAAACACCTAGCAGCCCCTTGACCCCCACGTTT
GCCTCTTCCATGTGTCTCCTGGCCCCCTGCTATCTCACAGGGGACTCTGTCCGGGACAAGTGTGTGGAGATGCTGTCAGCAGCCCTGAAG
GCGGACGATGATTACAAGGACTATGGAGTCAACTGTGACAAGATGGCATCAGAAATCGAAGATCATATCTACCAAGAGCTCAAGAGCACG
GACATGAAGTACCGGAACCGCGTGCGCAGCCGCATAAGCAACCTCAAGGACCCCAGGAACCCCGGCCTGCGGCGGAACGTGCTCAGTGGG
GCCATCTCCGCAGGGCTTATAGCCAAGATGACGGCAGAGGAAATGGCCAGTGATGAACTGAGGGAGTTGAGGAATGCCATGACCCAGGAG
GCCATCCGTGAGCACCAGATGGCCAAGACTGGCGGCACCACCACTGACCTCTTCCAGTGCAGCAAATGCAAGAAGAAGAACTGCACCTAT

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_1125nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTT
GCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGAC
TCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCA
GAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_2638nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGG
GGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGT
CCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCC
AAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTC
TCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATC
GGTGGAAAGATCAAACAGCAGCAAATCAAAAGCGGAGAGCCCCAAAACACCTAGCAGCCCCTTGACCCCCACGTTTGCCTCTTCCATGTG
TCTCCTGGCCCCCTGCTATCTCACAGGGGACTCTGTCCGGGACAAGTGTGTGGAGATGCTGTCAGCAGCCCTGAAGGCGGACGATGATTA
CAAGGACTATGGAGTCAACTGTGACAAGATGGCATCAGAAATCGAAGATCATATCTACCAAGAGCTCAAGAGCACGGACATGAAGTACCG
GAACCGCGTGCGCAGCCGCATAAGCAACCTCAAGGACCCCAGGAACCCCGGCCTGCGGCGGAACGTGCTCAGTGGGGCCATCTCCGCAGG
GCTTATAGCCAAGATGACGGCAGAGGAAATGGCCAGTGATGAACTGAGGGAGTTGAGGAATGCCATGACCCAGGAGGCCATCCGTGAGCA
CCAGATGGCCAAGACTGGCGGCACCACCACTGACCTCTTCCAGTGCAGCAAATGCAAGAAGAAGAACTGCACCTATAACCAGGTGCAGAC
ACGCAGTGCTGATGAGCCCATGACTACCTTTGTCTTATGCAATGAATGTGGCAATCGCTGGAAGTTCTGCTGATGGAACAGCCAGCCATG
AACAAGGTGAGGAAGAAGAAAGAGGAAGCGCTGAATTATCTGAACTGGAGAAGCAATAAAAATTAAAGTGAAGGAAAATACTGAACTCTG
TCTGAGTGGGATGGTATGAGTTAGAGGAAGAATTCTCTTGCAAATTAATAATCGGTCATTAGAAACAATTGGTTAATGGGGGAGCCTAAT
TGGAGAATGATGCTGAGAATTTGTATTGATGAACCTCTTTTAGAAACTGCAGAGGGCTGGGCACGGTGGTTTATGGCTGTAATCTGCAAA
CTCTGGGAGGCTGAGGTGGGAGAATCGCTTAACCCCAGAAGTTTGAGTCCAGCCCAGGCAACACAGCAAGACCCCATCTCTATAAAAAGA

>In-frame_BAP1_ENST00000460680_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_2309nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGG
GGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATGTCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGT
CCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCCAAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCC
AAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAGAAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTC
TCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGAGACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATC
GGTGGAAAGAGCATGCTCGCTGATGCAGTAACTGAAATGCCCTCGAGGTGGCGCACAGAAGCAGCGGGCCCGGCCTCCAGATGCCTCTAC
TCAGACCTGGGGCAGGAGGATTTTCTAAGGACTGGTGCGGTGCGGGCACATCCGGGGAGCAGAAGGAAGCTGTTGATAAATCCAACCTCC
CACCCCGGCCGATGATGCCCTCTCTGCAGTTTGGCTCAGTTCCCAGGCGTGTGCATTGAAAGCAAAATGAGTGTGGCTGCCTGAAATGCT
GCCCAGACACGAATTCCAGCCAGCCAGCCAGCTCCTAACCGGGGAGGCGGGACCAGGGCTGGGTGTGCCCTGCCAGGAAGGTGGGAAGAA
ATGCTCCAAACAGCCTAGTCTTGCTCAGGTAGGAGGACTCTGGAAACCTCTCTTTTAAAGACACAGTTGATGTGTTGAAAAGAATTTGGA
AGGGCGACAGGCAGGTTCGTGGTCTGACTATACCCTTTGCTAGTTGGATGGATAACTTGGGGCAGTAACTTGGATGGATAATTCAGTTCA
GCTCTCTGAGCTTCAGTCTACTGATCTGTAAAATGGAGACAATTATGAACCCCTTTCAAGGTCATTGTGAGGATTAAATGAGGTAATGAA

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000450454_chr1_23745632_-_2148nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATG
TCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCC
AAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAG
AAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGA
GACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATCGGTGGAAAGATCAAACAGCAGCAAATCAAAAGCGGAGAGC
CCCAAAACACCTAGCAGCCCCTTGACCCCCACGTTTGCCTCTTCCATGTGTCTCCTGGCCCCCTGCTATCTCACAGGGGACTCTGTCCGG
GACAAGTGTGTGGAGATGCTGTCAGCAGCCCTGAAGGCGGACGATGATTACAAGGACTATGGAGTCAACTGTGACAAGATGGCATCAGAA
ATCGAAGATCATATCTACCAAGAGCTCAAGAGCACGGACATGAAGTACCGGAACCGCGTGCGCAGCCGCATAAGCAACCTCAAGGACCCC
AGGAACCCCGGCCTGCGGCGGAACGTGCTCAGTGGGGCCATCTCCGCAGGGCTTATAGCCAAGATGACGGCAGAGGAAATGGCCAGTGAT
GAACTGAGGGAGTTGAGGAATGCCATGACCCAGGAGGCCATCCGTGAGCACCAGATGGCCAAGACTGGCGGCACCACCACTGACCTCTTC
CAGTGCAGCAAATGCAAGAAGAAGAACTGCACCTATAACCAGGTGCAGACACGCAGTGCTGATGAGCCCATGACTACCTTTGTCTTATGC
AATGAATGTGGCAATCGCTGGAAGTTCTGCTGATGGAACAGCCAGCCATGAACAAGGTGAGGAAGAAGAAAGAGGAAGCGCTGAATTATC
TGAACTGGAGAAGCAATAAAAATTAAAGTGAAGGAAAATACTGAACTCTGTCTGAGTGGGATGGTATGAGTTAGAGGAAGAATTCTCTTG
CAAATTAATAATCGGTCATTAGAAACAATTGGTTAATGGGGGAGCCTAATTGGAGAATGATGCTGAGAATTTGTATTGATGAACCTCTTT
TAGAAACTGCAGAGGGCTGGGCACGGTGGTTTATGGCTGTAATCTGCAAACTCTGGGAGGCTGAGGTGGGAGAATCGCTTAACCCCAGAA

>In-frame_BAP1_ENST00000296288_chr3_52440269_-_TCEA3_ENST00000374601_chr1_23745632_-_1819nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGGAAGGGGCCCTGGACCTTCTGAAGAAGCTGCACAGCTGCCAGATG
TCCATCCAGCTACTACAGACAACCAGGATTGGAGTTGCTGTTAATGGGGTCCGCAAGCACTGCTCAGACAAGGAGGTGGTGTCCTTGGCC
AAAGTCCTTATCAAAAACTGGAAGCGGCTGCTAGACTCCCCTGGACCCCCAAAAGGAGAAAAAGGAGAGGAAAGAGAAAAGGCAAAGAAG
AAGGAAAAAGGGCTTGAGTGTTCAGACTGGAAGCCAGAAGCAGGCCTTTCTCCACCAAGGAAAAAACGAGAAGACCCCAAAACCAGGAGA
GACTCTGTGGACTCCAAGTCTTCTGCCTCCTCCTCTCCAAAAAGACCATCGGTGGAAAGAGCATGCTCGCTGATGCAGTAACTGAAATGC
CCTCGAGGTGGCGCACAGAAGCAGCGGGCCCGGCCTCCAGATGCCTCTACTCAGACCTGGGGCAGGAGGATTTTCTAAGGACTGGTGCGG
TGCGGGCACATCCGGGGAGCAGAAGGAAGCTGTTGATAAATCCAACCTCCCACCCCGGCCGATGATGCCCTCTCTGCAGTTTGGCTCAGT
TCCCAGGCGTGTGCATTGAAAGCAAAATGAGTGTGGCTGCCTGAAATGCTGCCCAGACACGAATTCCAGCCAGCCAGCCAGCTCCTAACC
GGGGAGGCGGGACCAGGGCTGGGTGTGCCCTGCCAGGAAGGTGGGAAGAAATGCTCCAAACAGCCTAGTCTTGCTCAGGTAGGAGGACTC
TGGAAACCTCTCTTTTAAAGACACAGTTGATGTGTTGAAAAGAATTTGGAAGGGCGACAGGCAGGTTCGTGGTCTGACTATACCCTTTGC
TAGTTGGATGGATAACTTGGGGCAGTAACTTGGATGGATAATTCAGTTCAGCTCTCTGAGCTTCAGTCTACTGATCTGTAAAATGGAGAC
AATTATGAACCCCTTTCAAGGTCATTGTGAGGATTAAATGAGGTAATGAAATACCCAGCACTGTTCCCAAACCATGTAAATGCTCAATAA


Top

FusionGenePPI for BAP1_TCEA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BAP1HCFC1, FOXK2, IPO5, PPM1G, RBBP7, OGT, HAT1, EIF4EBP3, PSME3, CBX1, CBX3, AHCYL2, ANKRD17, ANAPC7, ASXL2, UBE2O, IPO4, ASXL1, KDM1B, FOXK1, HSPA2, PTEN, HIST2H2AC, ZC3H13, PRDM10, HSPA9, ZNF131, HSPA1A, EFNA2, ELF2, YY1, BRCA1, TRIM63, USP21, USP15, USP28, USP2, HIST2H2AA3, INO80, UBC, MAP3K1, BAG4, BCAR3, CASP8, ESR1, IGF1R, NBN, PTPRJ, RB1CC1, XRCC3, SMS, TSNAX, KIAA1107, ENTHD2, MCRS1, ASXL3, HIST1H2AB, KLF5, GOPC, CAMK2D, LINC00598TCEA3RPH3AL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneBAP1chr3:52440269chr1:23745632ENST00000460680-917596_721261730BRCA1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BAP1_TCEA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BAP1_TCEA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBAP1C0007134Renal Cell Carcinoma4CTD_human
HgeneBAP1C0025500Mesothelioma4CTD_human
HgeneBAP1C0345967Malignant mesothelioma4CTD_human
HgeneBAP1C0220633Uveal melanoma3CTD_human;HPO
HgeneBAP1C0038356Stomach Neoplasms2CTD_human
HgeneBAP1C0151779Cutaneous Melanoma2CTD_human
HgeneBAP1C0206698Cholangiocarcinoma2CTD_human
HgeneBAP1C1458155Mammary Neoplasms2CTD_human
HgeneBAP1C0005695Bladder Neoplasm1CTD_human
HgeneBAP1C0005967Bone neoplasms1CTD_human
HgeneBAP1C0007117Basal cell carcinoma1CTD_human
HgeneBAP1C0009375Colonic Neoplasms1CTD_human
HgeneBAP1C0018671Head and Neck Neoplasms1CTD_human
HgeneBAP1C0022665Kidney Neoplasm1CTD_human
HgeneBAP1C0023418leukemia1CTD_human
HgeneBAP1C0023798Lipoma1CTD_human
HgeneBAP1C0023903Liver neoplasms1CTD_human
HgeneBAP1C0024121Lung Neoplasms1CTD_human
HgeneBAP1C0025286Meningioma1CTD_human;HPO
HgeneBAP1C0030297Pancreatic Neoplasm1CTD_human
HgeneBAP1C0030421Paraganglioma1CTD_human
HgeneBAP1C0033578Prostatic Neoplasms1CTD_human
HgeneBAP1C0039590Testicular Neoplasms1CTD_human
HgeneBAP1C0040100Thymoma1CTD_human
HgeneBAP1C0042138Uterine Neoplasms1CTD_human
HgeneBAP1C0085136Central Nervous System Neoplasms1CTD_human
HgeneBAP1C0152013Adenocarcinoma of lung (disorder)1CTD_human;HPO
HgeneBAP1C0206686Adrenocortical carcinoma1CTD_human
HgeneBAP1C0206694Mucoepidermoid Carcinoma1CTD_human
HgeneBAP1C0206739Epithelioid and spindle cell nevus1CTD_human
HgeneBAP1C0206754Neuroendocrine Tumors1CTD_human
HgeneBAP1C0206769Nevi and Melanomas1CTD_human
HgeneBAP1C0919267ovarian neoplasm1CTD_human
HgeneBAP1C2931822Nasopharyngeal carcinoma1CTD_human