FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3832

FusionGeneSummary for BAP1_PBRM1

check button Fusion gene summary
Fusion gene informationFusion gene name: BAP1_PBRM1
Fusion gene ID: 3832
HgeneTgene
Gene symbol

BAP1

PBRM1

Gene ID

9223

55193

Gene namemembrane associated guanylate kinase, WW and PDZ domain containing 1polybromo 1
SynonymsAIP-3|AIP3|BAIAP1|BAP-1|BAP1|MAGI-1|Magi1d|TNRC19|WWP3BAF180|PB1
Cytomap

3p14.1

3p21.1

Type of geneprotein-codingprotein-coding
Descriptionmembrane-associated guanylate kinase, WW and PDZ domain-containing protein 1BAI1-associated protein 1WW domain-containing protein 3atrophin-1-interacting protein 3membrane-associated guanylate kinase inverted 1trinucleotide repeat-containing gene 19 protein polybromo-1BRG1-associated factor 180polybromo-1D
Modification date2018051920180523
UniProtAcc

Q92560

Q86U86

Ensembl transtripts involved in fusion geneENST00000460680, ENST00000296288, 
ENST00000356770, ENST00000394830, 
ENST00000296302, ENST00000337303, 
ENST00000410007, ENST00000409057, 
ENST00000409114, ENST00000409767, 
Fusion gene scores* DoF score8 X 8 X 5=3205 X 5 X 5=125
# samples 85
** MAII scorelog2(8/320*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/125*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BAP1 [Title/Abstract] AND PBRM1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A3ES-06ABAP1chr3

52438469

-PBRM1chr3

52663051

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000460680ENST00000356770BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000394830BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000296302BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000337303BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000410007BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000409057BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000409114BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000460680ENST00000409767BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000356770BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000394830BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000296302BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000337303BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000410007BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000409057BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000409114BAP1chr3

52438469

-PBRM1chr3

52663051

-
In-frameENST00000296288ENST00000409767BAP1chr3

52438469

-PBRM1chr3

52663051

-

Top

FusionProtFeatures for BAP1_PBRM1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BAP1

Q92560

PBRM1

Q86U86

Deubiquitinating enzyme that plays a key role inchromatin by mediating deubiquitination of histone H2A and HCFC1.Catalytic component of the PR-DUB complex, a complex thatspecifically mediates deubiquitination of histone H2Amonoubiquitinated at 'Lys-119' (H2AK119ub1). Does notdeubiquitinate monoubiquitinated histone H2B. Acts as a regulatorof cell growth by mediating deubiquitination of HCFC1 N-terminaland C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linkedpolyubiquitin chains. Deubiquitination of HCFC1 does not lead toincrease stability of HCFC1. Interferes with the BRCA1 and BARD1heterodimer activity by inhibiting their ability to mediateubiquitination and autoubiquitination. It however does not mediatedeubiquitination of BRCA1 and BARD1. Able to mediateautodeubiquitination via intramolecular interactions to couteractmonoubiquitination at the nuclear localization signal (NLS),thereby protecting it from cytoplasmic sequestration(PubMed:24703950). Acts as a tumor suppressor.{ECO:0000269|PubMed:12485996, ECO:0000269|PubMed:18757409,ECO:0000269|PubMed:19117993, ECO:0000269|PubMed:19188440,ECO:0000269|PubMed:19815555, ECO:0000269|PubMed:20436459,ECO:0000269|PubMed:24703950, ECO:0000269|PubMed:9528852}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-10301468_15994331690Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030630_6334331690Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-10281468_15994331583Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028630_6334331583Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-9281468_15994011603Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928630_6334011603Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-11301468_15994331583Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130630_6334331583Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-10291468_15994331635Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029630_6334331635Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-10301468_15994331653Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030630_6334331653Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-10291468_15994331598Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029630_6334331598Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-10291468_15994331610Compositional biasNote=Pro-rich
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029630_6334331610Compositional biasNote=Poly-Asp
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-10301379_14474331690DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-10281379_14474331583DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-9281379_14474011603DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-11301379_14474331583DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-10291379_14474331635DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-10301379_14474331653DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-10291379_14474331598DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-10291379_14474331610DNA bindingHMG box
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-10301156_12724331690DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030538_6084331690DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030676_7464331690DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030792_8624331690DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030956_10744331690DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-10281156_12724331583DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028538_6084331583DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028676_7464331583DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028792_8624331583DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028956_10744331583DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-9281156_12724011603DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928400_4704011603DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928538_6084011603DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928676_7464011603DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928792_8624011603DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928956_10744011603DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-11301156_12724331583DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130538_6084331583DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130676_7464331583DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130792_8624331583DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130956_10744331583DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-10291156_12724331635DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029538_6084331635DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029676_7464331635DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029792_8624331635DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029956_10744331635DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-10301156_12724331653DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030538_6084331653DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030676_7464331653DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030792_8624331653DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030956_10744331653DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-10291156_12724331598DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029538_6084331598DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029676_7464331598DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029792_8624331598DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029956_10744331598DomainBAH 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-10291156_12724331610DomainBAH 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029538_6084331610DomainBromo 4
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029676_7464331610DomainBromo 5
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029792_8624331610DomainBromo 6
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029956_10744331610DomainBAH 1

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBAP1chr3:52438469chr3:52663051ENST00000460680-1217630_661416730Coiled coilOntology_term=ECO:0000255
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030200_2704331690DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-1030400_4704331690DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000296302-103064_1344331690DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028200_2704331583DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-1028400_4704331583DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000337303-102864_1344331583DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-928200_2704011603DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000356770-92864_1344011603DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130200_2704331583DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-1130400_4704331583DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000394830-113064_1344331583DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029200_2704331635DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-1029400_4704331635DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000409057-102964_1344331635DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030200_2704331653DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-1030400_4704331653DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000409114-103064_1344331653DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029200_2704331598DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-1029400_4704331598DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000409767-102964_1344331598DomainBromo 1
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029200_2704331610DomainBromo 2
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-1029400_4704331610DomainBromo 3
TgenePBRM1chr3:52438469chr3:52663051ENST00000410007-102964_1344331610DomainBromo 1


Top

FusionGeneSequence for BAP1_PBRM1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_1618aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHL
ATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRV
ASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDG
AATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRF
SLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKS
AKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQP
LHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQ

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_1566aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAEKEVFKSDTYNKVPVSKIL
GKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAE
DNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYK
KEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPS
PLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSESTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRN
LETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVL
GPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLK

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_1673aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHL
ATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRV
ASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDG
AATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRF
SLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKS
AKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEERAAKVAEQQERERAAQQQQPSASPRAG
TPVGALMGVVPPPTPMGMLNQQLTPVAGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMV
GTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRD

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_1566aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHL
ATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRV
ASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDG
AATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRF
SLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKS
AKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGVMNQGVAPMVGTPAPGGSPTGQQVGVL
GPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLK

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_1593aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAEKEVFKSDTYNKVPVSKIL
GKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAE
DNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYK
KEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPS
PLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSE
MRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPG
VMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKW

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_1618aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPD
TTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGI
SPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACT
YNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRK
NVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEED
KLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHL
ATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRV
ASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDG
AATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRF
SLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKS
AKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQP
LHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQ

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_1636aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKRNTHDSEMLGLRRLSSKKNIRKQRMKILFNVVLEAREPGSGRRL
CDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDD
DMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDID
SMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDP
NFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDV
EKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKW
LTGCWFYRPNETFHLATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISS
VRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLV
RPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYN
ESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASE
LDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEERAAKVAEQQERE
RAAQQQQPSASPRAGTPVGALMGVVPPPTPMGMLNQQLTPVAGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPP
VIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLML

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_1581aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNS
AIYKRVLKLQQVMQAKKKELARRDDIEDGDSMISSATSDTGSAKRKRNTHDSEMLGLRRLSSKKNIRKQRMKILFNVVLEAREPGSGRRL
CDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDD
DMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDID
SMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDP
NFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDV
EKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKW
LTGCWFYRPNETFHLATRKFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISS
VRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLV
RPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYN
ESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASE
LDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGVMNQGVAPMVGT
PAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVH

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_1600aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATRKFLEKEVFKSDTYNK
VPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDN
SEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHE
PTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPI
VPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSG
YILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGL
PGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAE

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_1548aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPEN
FRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSN
GEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCIL
GKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELE
GGDDDIEEMGEEDSESTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPP
GLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAG
PPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDL

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_1655aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATRKFLEKEVFKSDTYNK
VPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDN
SEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHE
PTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPI
VPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSG
YILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEERAAKVAEQQERERAAQQQQPSASPRAGTPVGALMGVVPPPTPMGM
LNQQLTPVAGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLG
PPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKS

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_1548aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATRKFLEKEVFKSDTYNK
VPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDN
SEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHE
PTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPI
VPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSG
YILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAG
PPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDL

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_1575aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPEN
FRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSN
GEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCIL
GKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELE
GGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELS
RLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGS
PTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQE

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_1600aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTKIILEPMDLKIIEHNI
RNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEV
TEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKV
LLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMF
EVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSS
GAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATRKFLEKEVFKSDTYNK
VPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDN
SEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAATFTGPIFIHPEETEHE
PTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPI
VPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSG
YILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGMMGGTPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGL
PGIPPPGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAE

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_1618aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKRNTHDSEMLGLRRLSSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTK
IILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPK
KSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNE
PESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVE
NNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLK
REEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATR
KFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASV
FANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAT
FTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLS
AKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKG
SAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEERAAKVAEQQERERAAQQQQPSASPRAGTPV
GALMGVVPPPTPMGMLNQQLTPVAGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPPGQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQ

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_1563aa
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVTGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNS
CATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSA
SNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKLKNQETETLDHLECDLNLMFENAKRTNVPNSAIYKRVLKLQQVMQAKKK
ELARRDDIEDGDSMISSATSDTGSAKRKRNTHDSEMLGLRRLSSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDTPDTTK
IILEPMDLKIIEHNIRNDKTAGEEGMIEDMKLMFRNARHTNEEGSQVTNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPK
KSKYMTPMQQKLNEVTEAVKNTTDKRGRRLSAIFLRLPSRSELPDYTLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNE
PESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVE
NNRYRRLDLFQEHMFEVLERARRMNRTDSEITEDAVELQQFFIKIRDELCKNGEILLSPALSTTTKHLHNDVEKERKEKLPKEIEEDKLK
REEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVTVEPAEANLQPHIVCIERLWEDSAGEKWLTGCWFYRPNETFHLATR
KFLEKEVFKSDTYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRTSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASV
FANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAT
FTGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFKGLKRFSLS
AKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKG
SAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAETEGVMNQGVAPMVGTPAPGGSPTGQQVGVLGPP
GQQAPPPTPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_4854nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTG
GCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTC
ATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACC
AAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTG
GCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTG
GAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGG
CTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGA
GCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTG
AGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACT
GAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTT
TCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAG
AAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATT
GAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCT
GCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATT
AAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAA
TATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCA
CTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGA
GTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCA
CCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAG
CGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCA
GCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATG

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_4698nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTA
GGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGG
TATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTG
CCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAA
GACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCAT
TACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTA
TGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAA
AAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTC
TCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAA
GGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCA
CCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAA
GATAGTGAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTC
AGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAAT
CTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTT
GTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCA
CCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTG
GGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTT
GTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATT
AGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAA
AGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATAC

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_5019nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTG
GCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTC
ATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACC
AAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTG
GCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTG
GAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGG
CTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGA
GCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTG
AGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACT
GAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTT
TCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAG
AAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATT
GAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCT
GCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATT
AAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAA
TATGAAGAGCGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGC
ACCCCTGTGGGGGCTCTCATGGGGGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAGCAGTTGACACCTGTTGCAGGCATGATG
GGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGG
CCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTA
GGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGC
CCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCA
GAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGAC
GTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGG

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_4698nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTG
GCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTC
ATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACC
AAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTG
GCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTG
GAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGG
CTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGA
GCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTG
AGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACT
GAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTT
TCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAG
AAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATT
GAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCT
GCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATT
AAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAA
TATGAAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTG
GGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTT
GTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATT
AGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAA
AGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATAC

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_4779nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTA
GGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGG
TATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTG
CCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAA
GACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCAT
TACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTA
TGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAA
AAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTC
TCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAA
GGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCA
CCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAA
GATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAG
TCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAG
ATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACA
GCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATG
GGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGT
GTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCA
GGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCC
CCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGG
GATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGG
GCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAA

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_4854nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTC
AATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGAT
TATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATA
GAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTA
CTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATT
TCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGT
CGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAA
AAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACA
TACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAG
GACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGA
AGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAG
AATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACA
GATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTT
TCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGAT
AAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATAC
AGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATC
GTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTG
GCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTC
ATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACC
AAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTG
GCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTG
GAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGG
CTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGA
GCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTG
AGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACT
GAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTT
TCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAG
AAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATT
GAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCT
GCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATT
AAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAA
TATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCA
CTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGA
GTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCA
CCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAG
CGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCA
GCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATG

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_4908nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTA
TCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTT
TGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAG
CATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAG
GAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGAT
GACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTA
AATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAG
TTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGAC
TCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTA
CACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATC
CACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCC
AACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAG
CATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTT
ATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTG
GAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAA
GATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGAT
TACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGG
TTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTAT
TACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGA
GATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCA
GTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAAT
ACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAA
CCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTG
CGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACA
GAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAG
TGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAAT
GAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGA
AAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGA
GATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAG
CTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAAC
ATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTG
GTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAG
CGAGCAGCACAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTCATGGGGGTGGTGCCACCACCAACACCA
ATGGGGATGCTCAATCAGCAGTTGACACCTGTTGCAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGA
AGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCT
GTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATT
GAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAG
GAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTC

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_4743nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAG
TATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTG
ATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGG
GCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAAC
AAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTT
CTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCA
CCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTG
AAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCA
GCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGAC
AGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTA
TCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTT
TGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAG
CATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAG
GAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGAT
GACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTA
AATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAG
TTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGAC
TCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTA
CACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATC
CACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCC
AACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAG
CATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTT
ATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTG
GAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAA
GATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGAT
TACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGG
TTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTAT
TACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGA
GATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCA
GTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAAT
ACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAA
CCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTG
CGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACA
GAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAG
TGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAAT
GAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGA
AAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGA
GATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAG
CTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAAC
ATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTG
GTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACT
CCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACAT
CCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCC
TACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCAT
TTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_4800nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGC
TGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAA
GTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGAT
GTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTT
GTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAAC
TCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGC
CACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGT
GTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAG
CCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTG
TTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGAC
AAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATT
GTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGAT
ATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTC
ATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGC
TACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACA
GAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCA
GTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTC
CCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAG
GTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACA
ACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAG
TCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCT
CACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_4644nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGT
GACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAAC
TTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATC
AGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAG
AAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAAT
GGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGC
CTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAA
GAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTC
GGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGC
TACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTAC
TTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAA
GGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCC
AAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGG
GAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCA
GGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCAT
CTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCA
GGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGA
CCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAA
TACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAA
GAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTG

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_4965nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGC
TGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAA
GTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGAT
GTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTT
GTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAAC
TCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGC
CACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGT
GTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAG
CCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTG
TTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGAC
AAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATT
GTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGAT
ATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTC
ATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGC
TACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACA
GAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCA
CAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTCATGGGGGTGGTGCCACCACCAACACCAATGGGGATG
CTCAATCAGCAGTTGACACCTGTTGCAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTT
AGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCA
CCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGG
CCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTA
GCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGC
AAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGC
AAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAAC

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_4644nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGC
TGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAA
GTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGAT
GTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTT
GTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAAC
TCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGC
CACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGT
GTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAG
CCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTG
TTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGAC
AAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATT
GTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGAT
ATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTC
ATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGC
TACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACA
GAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCA
GGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGA
CCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAA
TACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAA
GAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTG

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_4725nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGT
GACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAAC
TTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATC
AGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAG
AAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAAT
GGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGC
CTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAA
GAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTC
GGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGC
TACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTAC
TTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAA
GGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCC
AGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAA
ATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGC
CGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCA
CCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCA
GGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGT
CCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTC
ATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAA
GGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAG
AGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGG

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_4800nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAA
AAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTA
TTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATC
CGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCC
CAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCT
TCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTC
TATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGAC
TACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTT
GAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTC
CTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTT
TTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCT
AACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTT
GAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATT
CGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAG
AGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCT
GGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTAT
GTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGC
TGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAA
GTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGAT
GTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTT
GTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAAC
TCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGC
CACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGT
GTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAG
CCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTG
TTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGAC
AAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATT
GTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGAT
ATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTC
ATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGC
TACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACA
GAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCA
GTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTC
CCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAG
GTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACA
ACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAG
TCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCT
CACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_4854nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAAC
ACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTT
CTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAA
ATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATG
AAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAG
AAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAA
AAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTC
AGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGA
AGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAG
CCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCAT
GTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTAC
AGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAA
AATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAA
ATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCA
CTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAA
CGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGAC
TGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATT
GAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGA
AAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTC
AAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTT
AAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTA
TTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAA
AAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTT
GGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATAT
TTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTG
GAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCA
GAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCT
GCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAG
TTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCT
TCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGC
AGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAA
CACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAG
CGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTG
GGGGCTCTCATGGGGGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAGCAGTTGACACCTGTTGCAGGTGTGATGAACCAAGGA
GTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCA
CCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAG
CGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCA
GCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATG

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_4689nt
ATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAG
GAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGA
AAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGCCCACCAGCTGATACCCAACTCT
TGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAGTCGCATGAAGGACTTCACCAAG
GGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGC
CACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTC
TTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATC
ATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCT
CTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCC
AGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGT
TCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCC
AACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCG
GCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGAC
GTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATG
TTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAA
GAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAAC
ACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTT
CTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAA
ATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATG
AAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAG
AAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAA
AAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTC
AGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGA
AGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAG
CCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCAT
GTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTAC
AGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAA
AATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAA
ATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCA
CTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAA
CGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGAC
TGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATT
GAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGA
AAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTC
AAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTT
AAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTA
TTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAA
AAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTT
GGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATAT
TTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTG
GAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCA
GAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCT
GCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAG
TTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCT
TCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGC
AGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAA
CACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGT
GTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCA
GGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCC
CCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGG
GATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGG
GCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_8037nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCG
ACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAA
AATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGA
ATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGT
GCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCG
AGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCA
GCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGA
AAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTT
CTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGA
CTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAA
ATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGA
GCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGG
AGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACC
CCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAG
CAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCT
TGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGT
TAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACC
ACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGG
GCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGT
AGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAG
CAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAG
CAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAA
CCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGGATCAGTAGCCATTTTAGTTACTGGGGGTG
GGGGGAAGGAACAAAGGAGGATAATTTTTATTGCATTTTACTGTACATCACAAGGCCATTTTTATATACGGACACTTTTAATAAGCTATT
TCAATTTGTTTGTTATATTAAGTTGACTTTATCAAATACACAAAGATTTTTTTGCATATGTTTCCTTCGTTTAAAACCAGTTTCATAATT
GGTTGTATATGTAGACTTGGAGTTTTATCTTTTTACTTGTTGCCATGGAACTGAAACCATTAGAGGTTTTTGTCTTGGCTTGGGGTTTTT
GTTTTCTTGGTTTTGGGTTTTTTTATATATATATATAAAAGAACAAAATGAAAAAAAACACACACACACAAGAGTTTACAGATTAGTTTA
AATTGATAATGAAATGTGAAGTTTGTCCTAGTTTACATCTTAGAGAGGGGAGTATACTTGTGTTTGTTTCATGTGCCTGAATATCTTAAG
CCACTTTCTGCAAAAGCTGTTTCTTACAGATGAAGTGCTTTCTTTGAAAGGTGGTTATTTAGGTTTTAGATGTTTAATAGACACAGCACA
TTTGCTCTATTAACTCAGAGGCTCACTACAGAAATATGTAATCAGTGCTGTGCATCTGTCTGCAGCTAATGTACCTCCTGGACACCAGGA
GGGGAAAAAGCACTTTTTCAATTGTGCTGAGTTAGACATCTGTGAGTTAGACTATGGTGTCAGTGATTTTTGCAGAACACGTGCACAACC
CTGAGGTATGTTTAATCTAGGCAGGTACGTTTAAGGATATTTTGATCTATTTATAATGAATTCACAATTTATGCCTATAAATTTCAGATG
ATTTAAAATTTTAAACCTGTTACATTGAAAAACATTGAAGTTCGTCTTGAAGAAAGCATTAAGGTATGCATGGAGGTGATTTATTTTTAA
ACATAACACCTAACCTAACATGGGTAAGAGAGTATGGAACTAGATATGAGCTGTATAAGAAGCATAATTGTGAACAAGTAGATTGATTGC
CTTCATATACAAGTATGTTTTAGTATTCCTTATTTCCTTATTATCAGATGTATTTTTTCTTTTAAGTTTCAATGTTGTTATAATTCTCAA
CCAGAAATTTAATACTTTCTAAAATATTTTTTAAATTTAGCTTGTGCTTTTGAATTACAGGAGAAGGGAATCATAATTTAATAAAACGCT
TACTAGAAAGACCATTACAGATCCCAAACACTTGGGTTTGGTGACCCTGTCTTTCTTATATGACCCTACAATAAACATTTGAAGGCAGCA
TAGGATGGCAGACAGTAGGAACATTGTTTCACTTGGCGGCATGTTTTTGAAACCTGCTTTATAGTAACTGGGTGATTGCCATTGTGGTAG
AGCTTCCACTGCTGTTTATAATCTGAGAGAGTTAATCTCAGAGGATGCTTTTTTCCTTTTAATCTGCTATGAATCAGTACCCAGATGTTT
AATTACTGTACTTATTAAATCATGAGGGCAAAAGAGTGTAGAATGGAAAAAAGTCTCTTGTATCTAGATACTTTAAATATGGGAGGCCCT
TTAACTTAATTGCCTTTAGTCAACCACTGGATTTGAATTTGCATCAAGTATTTTAAATAATATTGAATTTAAAAAAATGTATTGCAGTAG
TGTGTCAGTACCTTATTGTTAAAGTGAGTCAGATAAATCTTCAATTCCTGGCTATTTGGGCAATTGAATCATCATGGACTGTATAATGCA
ATCAGATTATTTTGTTTCTAGACATCCTTGAATTACACCAAAGAACATGAAATTTAGTTGTGGTTAAATTATTTATTTATTTCATGCATT
CATTTTATTTCCCTTAAGGTCTGGATGAGACTTCTTTGGGGAGCCTCTAAAAAAATTTTTCACTGGGGGCCACGTGGGTCATTAGAAGCC
AGAGCTCTCCTCCAGGCTCCTTCCCAGTGCCTAGAGGTGCTATAGGAAACATAGATCCAGCCAGGGGCTTCCCTAAAGCAGTGCAGCACC
GGCCCAGGGCATCACTAGACAGGCCCTAATTAAGTTTTTTTTAAAAAGCCTGTGTATTTATTTTAGAATCATGTTTTTCTGTATATTAAC
TTGGGGGATATCGTTAATATTTAGGATATAAGATTTGAGGTCAGCCATCTTCAAAAAAGAAAAAAAAATTGACTCAAGAAAGTACAAGTA
AACTATACACCTTTTTTTCATAAGTTTTAGGAACTGTAGTAATGTGGCTTAGAAAGTATAATGGCCTAAATGTTTTCAAAATGTAAGTTC
CTGTGGAGAAGAATTGTTTATATTGCAAACGGGGGGACTGAGGGGAACCTGTAGGTTTAAAACAGTATGTTTGTCAGCCAACTGATTTAA
AAGGCCTTTAACTGTTTTGGTTGTTGTTTTTTTTTTAAGCCACTCTCCCCTTCCTATGAGGAAGAATTGAGAGGGGCACCTATTTCTGTA
AAATCCCCAAATTGGTGTTGATGATTTTGAGCTTGAATGTTTTCATACCTGATTAAAACTTGGTTTATTCTAATTTCTGTATCATATCAT
CTGAGGTTTACGTGGTAACTAGTCTTATAACATGTATGTATCTTTTTTTTGTTGTTCATCTAAAGCTTTTTAATCCAAATAAATACAGAG

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_5392nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAA
AGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGA
TGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTT
TGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAA
CTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTG
CCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCG
TGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGA
GCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGT
GTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGA
CAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAAT
TGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGA
TATTGAAGAGATGGGAGAAGAAGATAGTGAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAA
CATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCT
GGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTT
GCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGT
GCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATA
TGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACA
GCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACT
CAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCG
CCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACAC
CCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGGATCAG
TAGCCATTTTAGTTACTGGGGGTGGGGGGAAGGAACAAAGGAGGATAATTTTTATTGCATTTTACTGTACATCACAAGGCCATTTTTATA

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_5564nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCG
ACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAA
AATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGA
ATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGT
GCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCG
AGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCA
GCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGA
AAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTT
CTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGA
CTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAA
ATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGA
GCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGG
AGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACC
CCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAG
CAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCT
TGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAGCAGCC
GAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTCATGGGGGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAGCAGTT
GACACCTGTTGCAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCAT
GCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAA
CCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCA
GGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAA
GACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGAC
ACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACAC
CACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTA

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_5243nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCG
ACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAA
AATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGA
ATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGT
GCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCG
AGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCA
GCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGA
AAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTT
CTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGA
CTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAA
ATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGA
GCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGG
AGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACC
CCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAG
CAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCT
TGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATA
TGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACA
GCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACT
CAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCG
CCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACAC
CCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGGATCAG

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_5323nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAA
AGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGA
TGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTT
TGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAA
CTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTG
CCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCG
TGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGA
GCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGT
GTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGA
CAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAAT
TGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGA
TATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCT
CATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGG
CTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGAC
AGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCC
AGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCT
CCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACA
GGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAAC
AACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGA
GTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTC
TCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACAT
TCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGGATCAGTAGCCATTT

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_5398nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAA
GCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACC
ATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATA
TGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGA
TGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAA
GCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAA
GAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTAT
TAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCAT
GATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACG
CAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCAT
GAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCT
TACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACG
AGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTG
CAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATT
GCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCT
CTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGA
GGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCG
ACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAA
AATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGA
ATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGT
GCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCG
AGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCA
GCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGA
AAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTT
CTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGA
CTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAA
ATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGA
GCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGG
AGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACC
CCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAG
CAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCT
TGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGT
TAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACC
ACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGG
GCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGT
AGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAG
CAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAG
CAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAA

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_5433nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGA
GATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGA
GCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCC
AATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCG
GAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCT
GGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACAT
GACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCT
GAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGC
CAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGAT
CTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGAC
TTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGC
AGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCG
TCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGC
AGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCAC
AAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAA
AAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAA
CAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGA
GGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAA
AGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAA
GTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACT
GTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGA
TAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCC
TGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTT
CATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCAT
CTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCC
CATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCT
GCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGA
TGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAA
ATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCT
TCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGA
AGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTC
TTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCTAAAGT
TGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTCATGGG
GGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAGCAGTTGACACCTGTTGCAGGTGTGATGAACCAAGGAGTGGCCCCTATGGT
AGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGG
CCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTC
AGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGA
CGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTG
GCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTT

>In-frame_BAP1_ENST00000460680_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_5267nt
CGCTCCGCCCCTCCCCTCGCAGCACCCGGGCCTAGTACTGCCCGTCCCGCCCCTCCTCTCGAGCCTCAGCGCTCAGCATCGCCCGGACCC
CCTCTTCCCTTCGCCCGCCTCGTCCCGACCCTCCCCTTCGCCCCCGTCCCGCCCCGCCCCTCCCCTTCGCCCCCGTCCCGTCCCGCCCCG
CCCCTCCCCTTCGCCCCCGTCCCTCCCCTTCGCCCCCGTCCCTCCGCGCGTGCGCGTTCGCCTTCGAGCGCATGCCCGCATCTGCTGTCC
GACAGGCGGAAGACGAGCCCAGAGGCGGAGCAGGGCCGTCGCGCCTTGGTGACGTCTGCCGCCGGCGCGGGCGGGTGACGCGACTGGGCC
CGTTGTCTGTGTGTGGGACTGAGGGGCCCCGGGGGCGGTGGGGGCTCCCGGTGGGGGCAGCGGTGGGGAGGGAGGGCCTGGACATGGCGC
TGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTCGTGGAAGATTTCGG
TGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTCCTGTTCAAATGGAT
CGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAATAACATGTTCTTTGC
CCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTGGGACCCACCCTGAG
TCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAG
CCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTA
TGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGAC
AGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGT
GGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGAT
AAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCC
GCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGC
CCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCAT
TGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCG
CAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAA
CTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAAACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAA
ACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTTCTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAG
AGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCCACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGA
GATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGA
GCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCC
AATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCG
GAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCT
GGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACAT
GACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCT
GAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGC
CAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGAT
CTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGAC
TTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGC
AGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCG
TCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGC
AGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCAC
AAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAA
AAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAA
CAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGA
GGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAA
AGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAA
GTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACT
GTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGA
TAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCC
TGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTT
CATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCAT
CTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCC
CATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCT
GCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGA
TGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAA
ATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCT
TCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGA
AGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTC
TTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAACCAAGG
AGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACC
ACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCA
GCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGC
AGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCAT
GGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACA

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000356770_chr3_52663051_-_7547nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTA
GAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATAC
TTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATT
AAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAAT
GCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGAT
GTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGT
GTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGC
CCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACC
TGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGAC
ATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTG
GTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAA
GCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCT
CAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAG
AAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGAC
TACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGT
GGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCT
CCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGG
ACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCA
CATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAG
GCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTC
CATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGC
CTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATA
TAGAAGCATAAAGAGTTGTGGATCAGTAGCCATTTTAGTTACTGGGGGTGGGGGGAAGGAACAAAGGAGGATAATTTTTATTGCATTTTA
CTGTACATCACAAGGCCATTTTTATATACGGACACTTTTAATAAGCTATTTCAATTTGTTTGTTATATTAAGTTGACTTTATCAAATACA
CAAAGATTTTTTTGCATATGTTTCCTTCGTTTAAAACCAGTTTCATAATTGGTTGTATATGTAGACTTGGAGTTTTATCTTTTTACTTGT
TGCCATGGAACTGAAACCATTAGAGGTTTTTGTCTTGGCTTGGGGTTTTTGTTTTCTTGGTTTTGGGTTTTTTTATATATATATATAAAA
GAACAAAATGAAAAAAAACACACACACACAAGAGTTTACAGATTAGTTTAAATTGATAATGAAATGTGAAGTTTGTCCTAGTTTACATCT
TAGAGAGGGGAGTATACTTGTGTTTGTTTCATGTGCCTGAATATCTTAAGCCACTTTCTGCAAAAGCTGTTTCTTACAGATGAAGTGCTT
TCTTTGAAAGGTGGTTATTTAGGTTTTAGATGTTTAATAGACACAGCACATTTGCTCTATTAACTCAGAGGCTCACTACAGAAATATGTA
ATCAGTGCTGTGCATCTGTCTGCAGCTAATGTACCTCCTGGACACCAGGAGGGGAAAAAGCACTTTTTCAATTGTGCTGAGTTAGACATC
TGTGAGTTAGACTATGGTGTCAGTGATTTTTGCAGAACACGTGCACAACCCTGAGGTATGTTTAATCTAGGCAGGTACGTTTAAGGATAT
TTTGATCTATTTATAATGAATTCACAATTTATGCCTATAAATTTCAGATGATTTAAAATTTTAAACCTGTTACATTGAAAAACATTGAAG
TTCGTCTTGAAGAAAGCATTAAGGTATGCATGGAGGTGATTTATTTTTAAACATAACACCTAACCTAACATGGGTAAGAGAGTATGGAAC
TAGATATGAGCTGTATAAGAAGCATAATTGTGAACAAGTAGATTGATTGCCTTCATATACAAGTATGTTTTAGTATTCCTTATTTCCTTA
TTATCAGATGTATTTTTTCTTTTAAGTTTCAATGTTGTTATAATTCTCAACCAGAAATTTAATACTTTCTAAAATATTTTTTAAATTTAG
CTTGTGCTTTTGAATTACAGGAGAAGGGAATCATAATTTAATAAAACGCTTACTAGAAAGACCATTACAGATCCCAAACACTTGGGTTTG
GTGACCCTGTCTTTCTTATATGACCCTACAATAAACATTTGAAGGCAGCATAGGATGGCAGACAGTAGGAACATTGTTTCACTTGGCGGC
ATGTTTTTGAAACCTGCTTTATAGTAACTGGGTGATTGCCATTGTGGTAGAGCTTCCACTGCTGTTTATAATCTGAGAGAGTTAATCTCA
GAGGATGCTTTTTTCCTTTTAATCTGCTATGAATCAGTACCCAGATGTTTAATTACTGTACTTATTAAATCATGAGGGCAAAAGAGTGTA
GAATGGAAAAAAGTCTCTTGTATCTAGATACTTTAAATATGGGAGGCCCTTTAACTTAATTGCCTTTAGTCAACCACTGGATTTGAATTT
GCATCAAGTATTTTAAATAATATTGAATTTAAAAAAATGTATTGCAGTAGTGTGTCAGTACCTTATTGTTAAAGTGAGTCAGATAAATCT
TCAATTCCTGGCTATTTGGGCAATTGAATCATCATGGACTGTATAATGCAATCAGATTATTTTGTTTCTAGACATCCTTGAATTACACCA
AAGAACATGAAATTTAGTTGTGGTTAAATTATTTATTTATTTCATGCATTCATTTTATTTCCCTTAAGGTCTGGATGAGACTTCTTTGGG
GAGCCTCTAAAAAAATTTTTCACTGGGGGCCACGTGGGTCATTAGAAGCCAGAGCTCTCCTCCAGGCTCCTTCCCAGTGCCTAGAGGTGC
TATAGGAAACATAGATCCAGCCAGGGGCTTCCCTAAAGCAGTGCAGCACCGGCCCAGGGCATCACTAGACAGGCCCTAATTAAGTTTTTT
TTAAAAAGCCTGTGTATTTATTTTAGAATCATGTTTTTCTGTATATTAACTTGGGGGATATCGTTAATATTTAGGATATAAGATTTGAGG
TCAGCCATCTTCAAAAAAGAAAAAAAAATTGACTCAAGAAAGTACAAGTAAACTATACACCTTTTTTTCATAAGTTTTAGGAACTGTAGT
AATGTGGCTTAGAAAGTATAATGGCCTAAATGTTTTCAAAATGTAAGTTCCTGTGGAGAAGAATTGTTTATATTGCAAACGGGGGGACTG
AGGGGAACCTGTAGGTTTAAAACAGTATGTTTGTCAGCCAACTGATTTAAAAGGCCTTTAACTGTTTTGGTTGTTGTTTTTTTTTTAAGC
CACTCTCCCCTTCCTATGAGGAAGAATTGAGAGGGGCACCTATTTCTGTAAAATCCCCAAATTGGTGTTGATGATTTTGAGCTTGAATGT
TTTCATACCTGATTAAAACTTGGTTTATTCTAATTTCTGTATCATATCATCTGAGGTTTACGTGGTAACTAGTCTTATAACATGTATGTA

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000394830_chr3_52663051_-_4902nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATG
TTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAA
TCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCC
TCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAA
AAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTG
AAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCT
GCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGT
AATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAA
ATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCA
CTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAG
ATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGTCTACCCCA
AAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCT
GTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAA
GCAGAATATGAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATG
CAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAAC
CAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAG
GCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAG
ACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACA
CTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACC
ACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAA
TCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGGATCAGTAGCCATTTTAGTTACTGGGGGTGGGGGGAAGGAACAAAG
GAGGATAATTTTTATTGCATTTTACTGTACATCACAAGGCCATTTTTATATACGGACACTTTTAATAAGCTATTTCAATTTGTTTGTTAT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000296302_chr3_52663051_-_5074nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTA
GAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATAC
TTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATT
AAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAAT
GCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGAT
GTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGT
GTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGC
CCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACC
TGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGAC
ATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTG
GTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAA
GCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCT
CAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAG
AAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGAC
TACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCT
AAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAGCAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTC
ATGGGGGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAGCAGTTGACACCTGTTGCAGGCATGATGGGTGGCTATCCGCCAGGC
CTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCTCCACCCCACCATCTT
CCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGT
GGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCC
CCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATAC
ATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAA
CAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATG
CTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAG

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000337303_chr3_52663051_-_4753nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTA
GAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATAC
TTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATT
AAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAAT
GCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGAT
GTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGT
GTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGC
CCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACC
TGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGAC
ATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTG
GTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAA
GCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCT
CAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAG
AAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGAC
TACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAAC
CAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAG
GCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAG
ACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACA
CTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACC
ACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAA

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000410007_chr3_52663051_-_4833nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATG
TTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAA
TCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCC
TCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAA
AAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTG
AAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCT
GCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGT
AATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAA
ATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCA
CTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAG
ATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAA
CCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCC
AAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAG
GCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATAT
GAAGGCATGATGGGTGGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTT
CACCCTGGGGGGCCTCCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTG
GCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCT
CCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGG
CTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCT
CGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCA
GATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCAT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409057_chr3_52663051_-_4908nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGTAAAAAGAACATAAGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCT
CGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTTAAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTG
GAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGACAAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATG
TTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTATAATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAA
GAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAACTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAA
TACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCTGTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATA
TTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTGACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATG
ATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTTGTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCT
TTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAAACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAAT
GTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCAGTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCT
TTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCACCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGC
TACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTGGAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAA
GATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAACTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTAT
ACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAAAAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAA
GAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCAGGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTT
AAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCTGCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTG
TGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTTTACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTA
GAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTTAGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATAC
TTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTCTGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATT
AAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGGGATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAAT
GCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGACAGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGAT
GTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTTGAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGT
GTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGAATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGC
CCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAAATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACC
TGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTCAAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGAC
ATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATGAAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTG
GTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAGAAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAA
GCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAGATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCT
CAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTACACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAG
AAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTGTTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGAC
TACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGAAATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGCATGATGGGT
GGCTATCCGCCAGGCCTTCCACCTTTGCAGGGCCCAGTTGATGGCCTTGTTAGCATGGGCAGCATGCAGCCACTTCACCCTGGGGGGCCT
CCACCCCACCATCTTCCGCCAGGTGTGCCTGGCCTCCCGGGCATCCCACCACCGGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGG
ACTCCAGCACCAGGTGGAAGTCCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCA
CATCCAGCTGGACCCCCTGTCATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAG
GCCTACCTGAAATACATTGAAGGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTC
CATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGC
CTTCGAGATTTGATGCTCCGGGACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATA

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409114_chr3_52663051_-_4943nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATA
AGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTT
AAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGAC
AAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTAT
AATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAA
CTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCT
GTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTG
ACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTT
GTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAA
ACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCA
GTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCA
CCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTG
GAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAA
CTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAA
AAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCA
GGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCT
GCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTT
TACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTT
AGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTC
TGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGG
GATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGAC
AGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTT
GAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGA
ATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAA
ATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTC
AAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATG
AAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAG
AAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAG
ATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTAC
ACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTG
TTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGA
AATCTTGAGACAGCCAAGAAAGCAGAATATGAAGAGCGGGCAGCTAAAGTTGCTGAGCAGCAGGAGAGAGAGCGAGCAGCACAGCAACAG
CAGCCGAGTGCTTCTCCCCGAGCAGGCACCCCTGTGGGGGCTCTCATGGGGGTGGTGCCACCACCAACACCAATGGGGATGCTCAATCAG
CAGTTGACACCTGTTGCAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGTCCATATGGACAACAG
GTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTCATACAGCAGCCAACA
ACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAAGGACTCAGTGCGGAG
TCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAGAGCCGCCTACCCTCT
CACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGGGACACCCTCAACATT

>In-frame_BAP1_ENST00000296288_chr3_52438469_-_PBRM1_ENST00000409767_chr3_52663051_-_4777nt
CCTGGACATGGCGCTGAGGGGCCGCCCCGCGGGAAGATGAATAAGGGCTGGCTGGAGCTGGAGAGCGACCCAGGCCTCTTCACCCTGCTC
GTGGAAGATTTCGGTGTCAAGGGGGTGCAAGTGGAGGAGATCTACGACCTTCAGAGCAAATGTCAGGGCCCTGTATATGGATTTATCTTC
CTGTTCAAATGGATCGAAGAGCGCCGGTCCCGGCGAAAGGTCTCTACCTTGGTGGATGATACGTCCGTGATTGATGATGATATTGTGAAT
AACATGTTCTTTGCCCACCAGCTGATACCCAACTCTTGTGCAACTCATGCCTTGCTGAGCGTGCTCCTGAACTGCAGCAGCGTGGACCTG
GGACCCACCCTGAGTCGCATGAAGGACTTCACCAAGGGTTTCAGCCCTGAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCC
AAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTC
CACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAG
GACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCAT
GTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCT
CAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAG
GGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTG
AAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTAT
GCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGAT
GATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGAACAAAACTGAAGAATCAAGAATATGAA
ACTTTAGATCATTTGGAGTGTGATCTGAATTTAATGTTTGAAAATGCCAAACGCTATAATGTGCCCAATTCAGCCATCTACAAGCGAGTT
CTAAAATTGCAGCAAGTTATGCAGGCAAAGAAGAAAGAGCTTGCCAGGAGAGACGATATCGAGGACGGAGACAGCATGATCTCTTCAGCC
ACCTCTGATACTGGTAGTGCCAAAAGAAAAAGGAACACTCATGACAGTGAGATGTTGGGTCTCAGGAGGCTATCCAGTAAAAAGAACATA
AGAAAGCAGCGAATGAAAATCTTATTCAATGTTGTTCTTGAAGCTCGAGAGCCAGGTTCAGGCAGAAGACTTTGTGACCTATTTATGGTT
AAACCATCCAAAAAGGACTATCCTGATTATTATAAAATCATCTTGGAGCCAATGGACTTGAAAATAATTGAGCATAACATCCGCAATGAC
AAATATGCTGGTGAAGAGGGAATGATAGAAGACATGAAGCTGATGTTCCGGAATGCCAGGCACTATAATGAGGAGGGCTCCCAGGTTTAT
AATGATGCACATATCCTGGAGAAGTTACTCAAGGAGAAAAGGAAAGAGCTGGGCCCACTGCCTGATGATGATGACATGGCTTCTCCCAAA
CTCAAGCTGAGTAGGAAGAGTGGCATTTCTCCTAAAAAATCAAAATACATGACTCCAATGCAGCAGAAACTAAATGAGGTCTATGAAGCT
GTAAAGAACTATACTGATAAGAGGGGTCGCCGCCTCAGTGCCATATTTCTGAGGCTTCCCTCTAGATCTGAGTTGCCTGACTACTATCTG
ACTATTAAAAAGCCCATGGACATGGAAAAAATTCGAAGTCACATGATGGCCAACAAGTACCAAGATATTGACTCTATGGTTGAGGACTTT
GTCATGATGTTTAATAATGCCTGTACATACAATGAGCCGGAGTCTTTGATCTACAAAGATGCTCTTGTTCTACACAAAGTCCTGCTTGAA
ACACGCAGAGACCTGGAGGGAGATGAGGACTCTCATGTCCCAAATGTGACTTTGCTGATTCAAGAGCTTATCCACAATCTTTTTGTGTCA
GTCATGAGTCATCAGGATGATGAGGGAAGATGCTACAGCGATTCTTTAGCAGAAATTCCTGCTGTGGATCCCAACTTTCCTAACAAACCA
CCCCTTACATTTGACATAATTAGGAAGAATGTTGAAAATAATCGCTACCGTCGGCTTGATTTATTTCAAGAGCATATGTTTGAAGTATTG
GAACGAGCAAGAAGGATGAATCGGACAGATTCAGAAATATATGAAGATGCAGTAGAACTTCAGCAGTTTTTTATTAAAATTCGTGATGAA
CTCTGCAAAAATGGAGAGATTCTTCTTTCACCGGCACTCAGCTATACCACAAAACATTTGCATAATGATGTGGAGAAAGAGAGAAAGGAA
AAATTGCCAAAAGAAATAGAGGAAGATAAACTAAAACGAGAAGAAGAAAAAAGAGAAGCTGAAAAGAGTGAAGATTCCTCTGGTGCTGCA
GGCCTCTCAGGCTTACATCGCACATACAGCCAGGACTGTAGCTTTAAAAACAGCATGTACCATGTTGGAGATTACGTCTATGTGGAACCT
GCAGAGGCCAACCTACAACCACATATCGTCTGTATTGAAAGACTGTGGGAGGATTCAGCTGGTGAAAAATGGTTGTATGGCTGTTGGTTT
TACCGACCAAATGAAACATTCCACCTGGCTACACGAAAATTTCTAGAAAAAGAAGTTTTTAAGAGTGACTATTACAACAAAGTTCCAGTT
AGTAAAATTCTAGGCAAGTGTGTGGTCATGTTTGTCAAGGAATACTTTAAGTTATGCCCAGAAAACTTCCGAGATGAGGATGTTTTTGTC
TGTGAATCACGGTATTCTGCCAAAACCAAATCTTTTAAGAAAATTAAACTGTGGACCATGCCCATCAGCTCAGTCAGGTTTGTCCCTCGG
GATGTGCCTCTGCCTGTGGTTCGCGTGGCCTCTGTATTTGCAAATGCAGATAAAGGTGATGATGAGAAGAATACAGACAACTCAGAGGAC
AGTCGAGCTGAAGACAATTTTAACTTGGAAAAGGAAAAAGAAGATGTCCCTGTGGAAATGTCCAATGGTGAACCAGGTTGCCACTACTTT
GAGCAGCTCCATTACAATGACATGTGGCTGAAGGTTGGCGACTGTGTCTTCATCAAGTCCCATGGCCTGGTGCGTCCTCGTGTGGGCAGA
ATTGAAAAAGTATGGGTTCGAGATGGAGCTGCATATTTTTATGGCCCCATCTTCATTCACCCAGAAGAAACAGAGCATGAGCCCACAAAA
ATGTTCTACAAAAAAGAAGTATTTCTGAGTAATCTGGAAGAAACCTGCCCCATGACATGTATTCTCGGAAAGTGTGCTGTGTTGTCATTC
AAGGACTTCCTCTCCTGCAGGCCAACTGAAATACCAGAAAATGACATTCTGCTTTGTGAGAGCCGCTACAATGAGAGCGACAAGCAGATG
AAGAAATTCAAAGGATTGAAGAGGTTTTCACTCTCTGCTAAAGTGGTAGATGATGAAATTTACTACTTCAGAAAACCAATTGTTCCTCAG
AAGGAGCCATCACCTTTGCTGGAAAAGAAGATCCAGTTGCTAGAAGCTAAATTTGCCGAGTTAGAAGGTGGAGATGATGATATTGAAGAG
ATGGGAGAAGAAGATAGTGAGGTCATTGAACCTCCTTCTCTACCTCAGCTTCAGACCCCCCTGGCCAGTGAGCTGGACCTCATGCCCTAC
ACACCCCCACAGTCTACCCCAAAGTCTGCCAAAGGCAGTGCAAAGAAGGAAGGCTCCAAACGGAAAATCAACATGAGTGGCTACATCCTG
TTCAGCAGTGAGATGAGGGCTGTGATTAAGGCCCAACACCCAGACTACTCTTTCGGGGAGCTCAGCCGCCTGGTGGGGACAGAATGGAGA
AATCTTGAGACAGCCAAGAAAGCAGAATATGAAGGTGTGATGAACCAAGGAGTGGCCCCTATGGTAGGGACTCCAGCACCAGGTGGAAGT
CCATATGGACAACAGGTGGGAGTTTTGGGGCCTCCAGGGCAGCAGGCACCACCTCCATATCCCGGCCCACATCCAGCTGGACCCCCTGTC
ATACAGCAGCCAACAACACCCATGTTTGTAGCTCCCCCACCAAAGACCCAGCGGCTTCTTCACTCAGAGGCCTACCTGAAATACATTGAA
GGACTCAGTGCGGAGTCCAACAGCATTAGCAAGTGGGATCAGACACTGGCAGCTCGAAGACGCGACGTCCATTTGTCGAAAGAACAGGAG
AGCCGCCTACCCTCTCACTGGCTGAAAAGCAAAGGGGCCCACACCACCATGGCAGATGCCCTCTGGCGCCTTCGAGATTTGATGCTCCGG
GACACCCTCAACATTCGCCAAGCATACAACCTAGAAAATGTTTAATCACATCATTACGTTTCTTTTATATAGAAGCATAAAGAGTTGTGG


Top

FusionGenePPI for BAP1_PBRM1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BAP1HCFC1, FOXK2, IPO5, PPM1G, RBBP7, OGT, HAT1, EIF4EBP3, PSME3, CBX1, CBX3, AHCYL2, ANKRD17, ANAPC7, ASXL2, UBE2O, IPO4, ASXL1, KDM1B, FOXK1, HSPA2, PTEN, HIST2H2AC, ZC3H13, PRDM10, HSPA9, ZNF131, HSPA1A, EFNA2, ELF2, YY1, BRCA1, TRIM63, USP21, USP15, USP28, USP2, HIST2H2AA3, INO80, UBC, MAP3K1, BAG4, BCAR3, CASP8, ESR1, IGF1R, NBN, PTPRJ, RB1CC1, XRCC3, SMS, TSNAX, KIAA1107, ENTHD2, MCRS1, ASXL3, HIST1H2AB, KLF5, GOPC, CAMK2D, LINC00598PBRM1ARID1A, SMARCC2, SMARCC1, SMARCE1, HIST1H3A, HIST1H4A, HIST2H2BE, HIST2H2AC, CHD7, ARID2, SMARCD1, ACTL6A, SMARCB1, SMARCA4, SMARCAD1, HIST3H3, SIRT7, CALML5, APP, GTF3C5, TCHHL1, NOTCH1, MAML1, ZNF512B, HECW2, CDC20, ZDHHC17, OBSL1, EED, DPF3, NUP50, COPS3, BRD7, SCARNA22, IFI16, HIST1H3E, DPPA4, NANOG, POU5F1, TOP1, HDAC6, VHL, BCL7C, BCL7A, ZBTB48, UHRF2, BRD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneBAP1chr3:52438469chr3:52663051ENST00000460680-1217596_721416730BRCA1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BAP1_PBRM1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BAP1_PBRM1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBAP1C0007134Renal Cell Carcinoma4CTD_human
HgeneBAP1C0025500Mesothelioma4CTD_human
HgeneBAP1C0345967Malignant mesothelioma4CTD_human
HgeneBAP1C0220633Uveal melanoma3CTD_human;HPO
HgeneBAP1C0038356Stomach Neoplasms2CTD_human
HgeneBAP1C0151779Cutaneous Melanoma2CTD_human
HgeneBAP1C0206698Cholangiocarcinoma2CTD_human
HgeneBAP1C1458155Mammary Neoplasms2CTD_human
HgeneBAP1C0005695Bladder Neoplasm1CTD_human
HgeneBAP1C0005967Bone neoplasms1CTD_human
HgeneBAP1C0007117Basal cell carcinoma1CTD_human
HgeneBAP1C0009375Colonic Neoplasms1CTD_human
HgeneBAP1C0018671Head and Neck Neoplasms1CTD_human
HgeneBAP1C0022665Kidney Neoplasm1CTD_human
HgeneBAP1C0023418leukemia1CTD_human
HgeneBAP1C0023798Lipoma1CTD_human
HgeneBAP1C0023903Liver neoplasms1CTD_human
HgeneBAP1C0024121Lung Neoplasms1CTD_human
HgeneBAP1C0025286Meningioma1CTD_human;HPO
HgeneBAP1C0030297Pancreatic Neoplasm1CTD_human
HgeneBAP1C0030421Paraganglioma1CTD_human
HgeneBAP1C0033578Prostatic Neoplasms1CTD_human
HgeneBAP1C0039590Testicular Neoplasms1CTD_human
HgeneBAP1C0040100Thymoma1CTD_human
HgeneBAP1C0042138Uterine Neoplasms1CTD_human
HgeneBAP1C0085136Central Nervous System Neoplasms1CTD_human
HgeneBAP1C0152013Adenocarcinoma of lung (disorder)1CTD_human;HPO
HgeneBAP1C0206686Adrenocortical carcinoma1CTD_human
HgeneBAP1C0206694Mucoepidermoid Carcinoma1CTD_human
HgeneBAP1C0206739Epithelioid and spindle cell nevus1CTD_human
HgeneBAP1C0206754Neuroendocrine Tumors1CTD_human
HgeneBAP1C0206769Nevi and Melanomas1CTD_human
HgeneBAP1C0919267ovarian neoplasm1CTD_human
HgeneBAP1C2931822Nasopharyngeal carcinoma1CTD_human
TgenePBRM1C0005586Bipolar Disorder3PSYGENET
TgenePBRM1C0007134Renal Cell Carcinoma2CTD_human
TgenePBRM1C0033975Psychotic Disorders1PSYGENET
TgenePBRM1C0036341Schizophrenia1PSYGENET
TgenePBRM1C0040100Thymoma1CTD_human
TgenePBRM1C0206698Cholangiocarcinoma1CTD_human
TgenePBRM1C0349204Nonorganic psychosis1PSYGENET