FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38256

FusionGeneSummary for TM9SF4_ZNF423

check button Fusion gene summary
Fusion gene informationFusion gene name: TM9SF4_ZNF423
Fusion gene ID: 38256
HgeneTgene
Gene symbol

TM9SF4

ZNF423

Gene ID

9777

23090

Gene nametransmembrane 9 superfamily member 4zinc finger protein 423
SynonymsdJ836N17.2Ebfaz|JBTS19|NPHP14|OAZ|Roaz|ZFP423|Zfp104|hOAZ
Cytomap

20q11.21

16q12.1

Type of geneprotein-codingprotein-coding
Descriptiontransmembrane 9 superfamily member 4dinucleotide oxidase disulfide thiol exchanger 3 superfamily member 4transmembrane 9 superfamily protein member 4tumor cannibalism associated protein 1zinc finger protein 423OLF-1/EBF associated zinc fingerSmad- and Olf-interacting zinc finger proteinearly B-cell factor associated zinc finger proteinolf1/EBF-associated zinc finger protein
Modification date2018052920180523
UniProtAcc

Q92544

Q2M1K9

Ensembl transtripts involved in fusion geneENST00000398022, ENST00000217315, 
ENST00000561648, ENST00000563137, 
ENST00000562871, ENST00000262383, 
ENST00000535559, ENST00000567169, 
ENST00000562520, 
Fusion gene scores* DoF score14 X 13 X 8=14566 X 4 X 5=120
# samples 146
** MAII scorelog2(14/1456*10)=-3.37851162325373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TM9SF4 [Title/Abstract] AND ZNF423 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTM9SF4

GO:0001666

response to hypoxia

25961573

TgeneZNF423

GO:0045892

negative regulation of transcription, DNA-templated

10660046

TgeneZNF423

GO:0045893

positive regulation of transcription, DNA-templated

10660046


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-HC-A632-01ATM9SF4chr20

30723976

+ZNF423chr16

49823457

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000398022ENST00000561648TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-5UTRENST00000398022ENST00000563137TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000398022ENST00000562871TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000398022ENST00000262383TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000398022ENST00000535559TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000398022ENST00000567169TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-5UTRENST00000398022ENST00000562520TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
In-frameENST00000217315ENST00000561648TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-5UTRENST00000217315ENST00000563137TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000217315ENST00000562871TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000217315ENST00000262383TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000217315ENST00000535559TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-intronENST00000217315ENST00000567169TM9SF4chr20

30723976

+ZNF423chr16

49823457

-
5CDS-5UTRENST00000217315ENST00000562520TM9SF4chr20

30723976

+ZNF423chr16

49823457

-

Top

FusionProtFeatures for TM9SF4_ZNF423


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TM9SF4

Q92544

ZNF423

Q2M1K9

Associates with proteins harboring glycine-richtransmembrane domains and ensures their efficient localization tothe cell surface (PubMed:25999474). Regulates the assembly andactivity of V-ATPase in colon cancer cells via its interactionwith V-type proton ATPase subunit H (ATP6V1H) and contributes toV-ATPase-mediated pH alterations in cancer cells which play animportant role in drug resistance and invasiveness of colon cancercells (PubMed:25659576). Plays an important role in an atypicalphagocytic activity of metastatic melanoma cells calledcannibalism and is involved in the pH regulation of theintracellular vesicles in tumor cells (PubMed:19893578).{ECO:0000269|PubMed:19893578, ECO:0000269|PubMed:25659576,ECO:0000269|PubMed:25999474}. Transcription factor that can both act as an activatoror a repressor depending on the context. Plays a central role inBMP signaling and olfactory neurogenesis. Associates with SMADs inresponse to BMP2 leading to activate transcription of BMP targetgenes. Acts as a transcriptional repressor via its interactionwith EBF1, a transcription factor involved in terminal olfactoryreceptor neurons differentiation; this interaction preventing EBF1to bind DNA and activate olfactory-specific genes. Involved inolfactory neurogenesis by participating in a developmental switchthat regulates the transition from differentiation to maturationin olfactory receptor neurons. Controls proliferation anddifferentiation of neural precursors in cerebellar vermisformation. {ECO:0000269|PubMed:10660046}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191020_104251285Zinc fingerC2H2-type 24
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191064_108251285Zinc fingerC2H2-type 25%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191120_114351285Zinc fingerC2H2-type 26
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191168_119051285Zinc fingerC2H2-type 27
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191198_122051285Zinc fingerC2H2-type 28
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191229_125251285Zinc fingerC2H2-type 29
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-191259_128251285Zinc fingerC2H2-type 30
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19138_16051285Zinc fingerC2H2-type 2
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19166_18851285Zinc fingerC2H2-type 3
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19194_21651285Zinc fingerC2H2-type 4
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19222_24451285Zinc fingerC2H2-type 5
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19263_28651285Zinc fingerC2H2-type 6
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19295_31851285Zinc fingerC2H2-type 7
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19323_34551285Zinc fingerC2H2-type 8
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19409_43351285Zinc fingerC2H2-type 9%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19441_46451285Zinc fingerC2H2-type 10
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19480_50351285Zinc fingerC2H2-type 11
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19517_54051285Zinc fingerC2H2-type 12
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19563_58851285Zinc fingerC2H2-type 13%3B atypical
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19632_65451285Zinc fingerC2H2-type 14
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19662_68451285Zinc fingerC2H2-type 15
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-1967_9351285Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19692_71551285Zinc fingerC2H2-type 16
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19720_74351285Zinc fingerC2H2-type 17
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19750_77351285Zinc fingerC2H2-type 18
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19781_80351285Zinc fingerC2H2-type 19
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19807_83051285Zinc fingerC2H2-type 20
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19886_90851285Zinc fingerC2H2-type 21%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19930_95251285Zinc fingerC2H2-type 22
TgeneZNF423chr20:30723976chr16:49823457ENST00000262383-19959_98151285Zinc fingerC2H2-type 23
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081020_104251285Zinc fingerC2H2-type 24
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081064_108251285Zinc fingerC2H2-type 25%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081120_114351285Zinc fingerC2H2-type 26
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081168_119051285Zinc fingerC2H2-type 27
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081198_122051285Zinc fingerC2H2-type 28
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081229_125251285Zinc fingerC2H2-type 29
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-081259_128251285Zinc fingerC2H2-type 30
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08138_16051285Zinc fingerC2H2-type 2
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08166_18851285Zinc fingerC2H2-type 3
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08194_21651285Zinc fingerC2H2-type 4
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08222_24451285Zinc fingerC2H2-type 5
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08263_28651285Zinc fingerC2H2-type 6
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08295_31851285Zinc fingerC2H2-type 7
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08323_34551285Zinc fingerC2H2-type 8
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08409_43351285Zinc fingerC2H2-type 9%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08441_46451285Zinc fingerC2H2-type 10
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08480_50351285Zinc fingerC2H2-type 11
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08517_54051285Zinc fingerC2H2-type 12
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08563_58851285Zinc fingerC2H2-type 13%3B atypical
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08632_65451285Zinc fingerC2H2-type 14
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08662_68451285Zinc fingerC2H2-type 15
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-0867_9351285Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08692_71551285Zinc fingerC2H2-type 16
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08720_74351285Zinc fingerC2H2-type 17
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08750_77351285Zinc fingerC2H2-type 18
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08781_80351285Zinc fingerC2H2-type 19
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08807_83051285Zinc fingerC2H2-type 20
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08886_90851285Zinc fingerC2H2-type 21%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08930_95251285Zinc fingerC2H2-type 22
TgeneZNF423chr20:30723976chr16:49823457ENST00000561648-08959_98151285Zinc fingerC2H2-type 23
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081020_1042-551225Zinc fingerC2H2-type 24
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081064_1082-551225Zinc fingerC2H2-type 25%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081120_1143-551225Zinc fingerC2H2-type 26
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081168_1190-551225Zinc fingerC2H2-type 27
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081198_1220-551225Zinc fingerC2H2-type 28
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081229_1252-551225Zinc fingerC2H2-type 29
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-081259_1282-551225Zinc fingerC2H2-type 30
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08138_160-551225Zinc fingerC2H2-type 2
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08166_188-551225Zinc fingerC2H2-type 3
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08194_216-551225Zinc fingerC2H2-type 4
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08222_244-551225Zinc fingerC2H2-type 5
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08263_286-551225Zinc fingerC2H2-type 6
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08295_318-551225Zinc fingerC2H2-type 7
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08323_345-551225Zinc fingerC2H2-type 8
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08409_433-551225Zinc fingerC2H2-type 9%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08441_464-551225Zinc fingerC2H2-type 10
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08480_503-551225Zinc fingerC2H2-type 11
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08517_540-551225Zinc fingerC2H2-type 12
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08563_588-551225Zinc fingerC2H2-type 13%3B atypical
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08632_654-551225Zinc fingerC2H2-type 14
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08662_684-551225Zinc fingerC2H2-type 15
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-0867_93-551225Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08692_715-551225Zinc fingerC2H2-type 16
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08720_743-551225Zinc fingerC2H2-type 17
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08750_773-551225Zinc fingerC2H2-type 18
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08781_803-551225Zinc fingerC2H2-type 19
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08807_830-551225Zinc fingerC2H2-type 20
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08886_908-551225Zinc fingerC2H2-type 21%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08930_952-551225Zinc fingerC2H2-type 22
TgeneZNF423chr20:30723976chr16:49823457ENST00000562520-08959_981-551225Zinc fingerC2H2-type 23
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071020_1042-571225Zinc fingerC2H2-type 24
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071064_1082-571225Zinc fingerC2H2-type 25%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071120_1143-571225Zinc fingerC2H2-type 26
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071168_1190-571225Zinc fingerC2H2-type 27
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071198_1220-571225Zinc fingerC2H2-type 28
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071229_1252-571225Zinc fingerC2H2-type 29
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-071259_1282-571225Zinc fingerC2H2-type 30
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07138_160-571225Zinc fingerC2H2-type 2
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07166_188-571225Zinc fingerC2H2-type 3
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07194_216-571225Zinc fingerC2H2-type 4
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07222_244-571225Zinc fingerC2H2-type 5
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07263_286-571225Zinc fingerC2H2-type 6
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07295_318-571225Zinc fingerC2H2-type 7
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07323_345-571225Zinc fingerC2H2-type 8
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07409_433-571225Zinc fingerC2H2-type 9%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07441_464-571225Zinc fingerC2H2-type 10
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07480_503-571225Zinc fingerC2H2-type 11
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07517_540-571225Zinc fingerC2H2-type 12
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07563_588-571225Zinc fingerC2H2-type 13%3B atypical
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07632_654-571225Zinc fingerC2H2-type 14
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07662_684-571225Zinc fingerC2H2-type 15
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-0767_93-571225Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07692_715-571225Zinc fingerC2H2-type 16
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07720_743-571225Zinc fingerC2H2-type 17
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07750_773-571225Zinc fingerC2H2-type 18
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07781_803-571225Zinc fingerC2H2-type 19
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07807_830-571225Zinc fingerC2H2-type 20
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07886_908-571225Zinc fingerC2H2-type 21%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07930_952-571225Zinc fingerC2H2-type 22
TgeneZNF423chr20:30723976chr16:49823457ENST00000562871-07959_981-571225Zinc fingerC2H2-type 23
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081020_1042-551225Zinc fingerC2H2-type 24
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081064_1082-551225Zinc fingerC2H2-type 25%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081120_1143-551225Zinc fingerC2H2-type 26
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081168_1190-551225Zinc fingerC2H2-type 27
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081198_1220-551225Zinc fingerC2H2-type 28
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081229_1252-551225Zinc fingerC2H2-type 29
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-081259_1282-551225Zinc fingerC2H2-type 30
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08138_160-551225Zinc fingerC2H2-type 2
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08166_188-551225Zinc fingerC2H2-type 3
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08194_216-551225Zinc fingerC2H2-type 4
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08222_244-551225Zinc fingerC2H2-type 5
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08263_286-551225Zinc fingerC2H2-type 6
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08295_318-551225Zinc fingerC2H2-type 7
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08323_345-551225Zinc fingerC2H2-type 8
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08409_433-551225Zinc fingerC2H2-type 9%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08441_464-551225Zinc fingerC2H2-type 10
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08480_503-551225Zinc fingerC2H2-type 11
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08517_540-551225Zinc fingerC2H2-type 12
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08563_588-551225Zinc fingerC2H2-type 13%3B atypical
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08632_654-551225Zinc fingerC2H2-type 14
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08662_684-551225Zinc fingerC2H2-type 15
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-0867_93-551225Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08692_715-551225Zinc fingerC2H2-type 16
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08720_743-551225Zinc fingerC2H2-type 17
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08750_773-551225Zinc fingerC2H2-type 18
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08781_803-551225Zinc fingerC2H2-type 19
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08807_830-551225Zinc fingerC2H2-type 20
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08886_908-551225Zinc fingerC2H2-type 21%3B degenerate
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08930_952-551225Zinc fingerC2H2-type 22
TgeneZNF423chr20:30723976chr16:49823457ENST00000563137-08959_981-551225Zinc fingerC2H2-type 23

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+31824_28159626Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318303_34659626Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318368_37659626Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318398_41659626Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318438_44959626Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318471_50159626Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318523_53559626Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318557_57059626Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318592_59859626Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318620_64259626Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+31824_28176643Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318303_34676643Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318368_37676643Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318398_41676643Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318438_44976643Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318471_50176643Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318523_53576643Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318557_57076643Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318592_59876643Topological domainExtracellular
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318620_64276643Topological domainCytoplasmic
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318282_30259626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318347_36759626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318377_39759626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318417_43759626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318450_47059626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318502_52259626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318536_55659626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318571_59159626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000217315+318599_61959626TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318282_30276643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318347_36776643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318377_39776643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318417_43776643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318450_47076643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318502_52276643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318536_55676643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318571_59176643TransmembraneHelical
HgeneTM9SF4chr20:30723976chr16:49823457ENST00000398022+318599_61976643TransmembraneHelical


Top

FusionGeneSequence for TM9SF4_ZNF423


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TM9SF4_ENST00000398022_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_1356aa
MATAMDWLPWSLLLFSLMCETSAFTVPGVAPINFHQNDPVEIKAVKLTSSRTQLPTEYTSLPFCQPSKITYKAENLVEEGEASDFSLAWD
SSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSS
KDVASPTQMIGDGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKTHCHEC
EAAFSRSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQL
SEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVE
RGSTPDSTLKPLRGQKKMRDDGQGWTKVVTSCPTCSKRDFNSLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAY
PVMQFGNISAFHCNYCPEMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSF
MEVTSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNGETPCNQCDLKFSNFESFQT
HLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHTVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHL
AVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKTNCKFCSKAFHAIILLEKHLREK
HCVFDAATENGTANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHNIRPGEDDGS
RKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQM
HPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARS
ANGQVGGLAPPEPADRPCAGLRCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVAN
HMIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTM

>In-frame_TM9SF4_ENST00000217315_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_1339aa
MCETSAFTVPGVAPINFHQNDPVEIKAVKLTSSRTQLPTEYTSLPFCQPSKITYKAENLVEEGEASDFSLAWDSSVTAAGGLEGEPECDQ
KTSRALEDRNSVTSQEERNEDDEDMEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLG
LGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKTHCHECEAAFSRSDHLKIHLKTH
SSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHCPEVFVD
ENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKK
MRDDGQGWTKVVTSCPTCSKRDFNSLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAFHCNYCP
EMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSFMEVTSCPYCTNSPIFGS
ILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNGETPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQ
CKEDFDSQESLLQHLTVHYMTTSTHTVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACN
WDFRKEADLQVHVKHSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKTNCKFCSKAFHAIILLEKHLREKHCVFDAATENGTANGVP
PMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCS
RTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCM
QTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRP
CAGLRCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHECKLCNQM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TM9SF4_ENST00000398022_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_4068nt
ATGGCGACGGCGATGGATTGGTTGCCGTGGTCTTTACTGCTTTTCTCCCTGATGTGTGAAACAAGCGCCTTCTATGTGCCTGGGGTCGCG
CCTATCAACTTCCACCAGAACGATCCCGTAGAAATCAAGGCTGTGAAGCTCACCAGCTCTCGAACCCAGCTACCTTATGAATACTATTCA
CTGCCCTTCTGCCAGCCCAGCAAGATAACCTACAAGGCAGAGAATCTGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGAT
TCCTCCGTGACAGCAGCAGGAGGCCTAGAAGGAGAGCCAGAGTGCGATCAGAAAACCAGCCGTGCGCTGGAAGACAGGAACAGCGTGACA
AGTCAAGAGGAGAGAAATGAGGATGATGAAGACATGGAGGATGAATCAATTTACACCTGCGATCACTGTCAGCAGGACTTCGAGTCTCTG
GCAGACCTGACGGACCACCGGGCCCACCGCTGTCCTGGAGATGGTGATGACGACCCACAACTCTCCTGGGTGGCCTCGTCTCCCTCCAGC
AAGGATGTTGCGTCACCCACGCAGATGATCGGAGATGGTTGTGACCTCGGCCTCGGCGAGGAGGAAGGGGGCACGGGCCTGCCATACCCT
TGCCAGTTCTGCGACAAGTCCTTCATCCGCTTGAGCTACTTGAAGAGGCACGAGCAGATCCACAGCGACAAGCTGCCGTTCAAGTGCACC
TACTGCAGCCGCCTCTTCAAGCACAAGAGGAGCCGTGACCGGCACATCAAGCTGCATACGGGCGACAAGAAGTATCACTGCCACGAGTGC
GAGGCAGCCTTCTCCCGCAGCGACCACCTCAAGATCCACCTGAAGACCCACAGCTCCAGCAAGCCCTTCAAGTGCACTGTGTGCAAGCGC
GGCTTCTCCTCCACCAGCTCGCTGCAGAGCCACATGCAGGCCCACAAAAAGAACAAGGAGCATCTGGCCAAGTCGGAGAAGGAAGCCAAG
AAGGACGACTTCATGTGCGACTACTGCGAGGACACCTTCAGCCAGACGGAGGAGCTGGAGAAGCACGTGCTCACCCGCCACCCGCAGCTG
TCCGAGAAGGCGGACCTGCAGTGCATTCACTGCCCTGAGGTCTTCGTCGACGAGAACACACTGCTCGCCCATATCCACCAAGCCCACGCC
AACCAGAAACACAAGTGCCCCATGTGCCCTGAGCAGTTCTCCTCAGTGGAAGGTGTCTACTGCCACCTGGACAGCCACCGGCAGCCCGAC
TCCAGCAACCACAGTGTCAGTCCCGACCCTGTACTGGGCAGCGTGGCCTCCATGAGCAGCGCCACACCCGACTCCAGCGCCTCTGTGGAG
CGTGGCTCCACCCCGGACTCCACCTTGAAGCCGCTGCGGGGGCAGAAGAAGATGCGGGATGACGGGCAGGGCTGGACCAAGGTGGTCTAT
AGCTGCCCCTATTGTTCCAAGCGGGACTTTAACAGCCTGGCCGTGCTGGAGATCCACCTGAAGACCATCCACGCGGACAAGCCCCAGCAG
AGCCACACATGTCAGATCTGCCTGGACTCCATGCCCACCCTCTACAACCTCAACGAGCACGTTCGCAAGCTGCACAAGAACCATGCCTAC
CCTGTGATGCAGTTTGGCAACATCTCTGCCTTCCACTGCAACTACTGCCCCGAGATGTTCGCCGACATCAATAGCCTGCAGGAGCACATC
CGCGTCTCCCACTGCGGCCCCAACGCCAACCCCTCTGACGGTAATAATGCTTTCTTCTGCAACCAGTGCTCCATGGGTTTCCTTACTGAG
TCCTCCCTCACCGAGCACATCCAGCAGGCCCACTGCAGTGTGGGCAGTGCCAAACTAGAGTCTCCGGTGGTGCAGCCCACGCAGTCCTTC
ATGGAGGTCTATTCCTGCCCCTACTGCACCAACTCCCCCATCTTTGGCTCCATCCTGAAACTCACCAAGCACATCAAGGAGAACCACAAG
AACATTCCACTGGCCCACAGCAAGAAGTCCAAGGCCGAGCAGAGCCCAGTCTCGTCCGATGTGGAGGTGTCTTCCCCGAAGCGGCAGCGG
CTCTCAGCAAGCGCCAACTCCATCTCCAATGGGGAGTATCCTTGCAATCAATGCGACCTCAAGTTCTCCAACTTTGAGAGCTTCCAGACC
CACCTGAAGCTGCACCTGGAGCTGCTGCTGCGGAAGCAAGCGTGCCCCCAGTGCAAAGAGGACTTTGACTCCCAGGAGTCCCTCCTGCAG
CACCTGACAGTGCATTACATGACCACGTCGACCCACTATGTGTGCGAGAGCTGCGACAAGCAATTTTCCTCGGTGGATGACCTGCAGAAG
CACCTGCTGGACATGCACACCTTTGTGTTGTACCACTGCACCCTGTGTCAGGAGGTCTTCGACTCCAAGGTGTCCATCCAGGTGCACCTG
GCGGTGAAGCACAGCAATGAGAAGAAGATGTACCGCTGCACGGCCTGCAACTGGGACTTCCGCAAGGAGGCTGACCTGCAGGTGCACGTC
AAACACAGCCACCTGGGCAACCCGGCCAAGGCTCACAAGTGCATCTTCTGTGGGGAGACCTTCAGCACCGAGGTGGAGCTGCAGTGCCAC
ATCACCACACACAGCAAGAAGTATAACTGTAAGTTCTGCAGCAAGGCCTTCCACGCCATCATCCTGCTGGAGAAGCACCTGCGGGAGAAG
CACTGTGTGTTTGATGCTGCGACCGAGAACGGCACGGCCAATGGGGTACCCCCAATGGCCACCAAGAAAGCTGAGCCTGCTGACCTGCAG
GGCATGCTGCTTAAGAACCCTGAGGCACCTAACAGCCATGAGGCCAGCGAGGATGACGTGGACGCGTCGGAGCCCATGTACGGCTGTGAC
ATCTGTGGGGCGGCCTACACCATGGAGGTGCTGCTGCAGAATCACCGGCTGCGGGACCACAATATCCGGCCGGGCGAGGATGATGGCTCA
CGCAAGAAGGCTGAGTTTATCAAGGGCAGTCACAAGTGCAACGTTTGTTCACGGACTTTCTTCTCGGAGAACGGGCTACGGGAGCACCTG
CAGACGCACCGGGGCCCTGCCAAGCACTACATGTGTCCCATCTGTGGTGAGCGCTTCCCTTCGCTGCTGACGCTCACCGAACACAAGGTG
ACCCACAGCAAGAGCCTGGACACGGGCACCTGTCGCATCTGCAAGATGCCCCTGCAGAGCGAGGAGGAGTTTATTGAGCACTGCCAGATG
CACCCTGACCTGCGCAACTCACTCACGGGCTTCCGCTGTGTGGTCTGCATGCAGACAGTCACTTCCACGCTTGAGCTCAAGATCCATGGC
ACCTTCCACATGCAGAAGCTGGCGGGCAGCTCAGCGGCGTCCTCCCCCAATGGCCAGGGGCTGCAGAAGCTCTACAAGTGCGCCCTGTGC
CTCAAGGAGTTCCGCAGCAAGCAGGACCTGGTGAAGCTTGACGTCAATGGGCTGCCCTACGGCCTCTGCGCCGGCTGCATGGCCCGCAGC
GCCAACGGACAGGTGGGTGGCCTGGCCCCGCCCGAGCCCGCCGACCGGCCCTGTGCCGGCCTCCGTTGCCCCGAGTGCAGTGTCAAGTTT
GAGAGTGCCGAAGACCTGGAGAGCCACATGCAGGTGGACCACCGTGACCTCACGCCGGAGACCAGTGGGCCCCGGAAAGGCACCCAGACA
TCGCCAGTGCCCCGGAAAAAGACATACCAGTGCATCAAGTGCCAGATGACCTTCGAGAACGAGAGAGAGATCCAAATCCACGTTGCCAAC
CACATGATTGAGGAAGGCATCAACCACGAGTGTAAGCTGTGCAACCAGATGTTCGACTCCCCGGCCAAGCTCCTCTGTCACCTCATTGAG
CACAGCTTCGAGGGCATGGGCGGCACCTTCAAATGCCCCGTGTGTTTCACAGTCTTCGTCCAGGCCAACAAGTTGCAGCAGCACATCTTT
GCCGTGCACGGGCAGGAGGACAAGATCTACGACTGCTCACAGTGCCCTCAGAAGTTCTTCTTCCAGACCGAGCTGCAGAACCACACGATG

>In-frame_TM9SF4_ENST00000217315_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_4017nt
ATGTGTGAAACAAGCGCCTTCTATGTGCCTGGGGTCGCGCCTATCAACTTCCACCAGAACGATCCCGTAGAAATCAAGGCTGTGAAGCTC
ACCAGCTCTCGAACCCAGCTACCTTATGAATACTATTCACTGCCCTTCTGCCAGCCCAGCAAGATAACCTACAAGGCAGAGAATCTGGTT
GAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGGAGGCCTAGAAGGAGAGCCAGAGTGCGATCAG
AAAACCAGCCGTGCGCTGGAAGACAGGAACAGCGTGACAAGTCAAGAGGAGAGAAATGAGGATGATGAAGACATGGAGGATGAATCAATT
TACACCTGCGATCACTGTCAGCAGGACTTCGAGTCTCTGGCAGACCTGACGGACCACCGGGCCCACCGCTGTCCTGGAGATGGTGATGAC
GACCCACAACTCTCCTGGGTGGCCTCGTCTCCCTCCAGCAAGGATGTTGCGTCACCCACGCAGATGATCGGAGATGGTTGTGACCTCGGC
CTCGGCGAGGAGGAAGGGGGCACGGGCCTGCCATACCCTTGCCAGTTCTGCGACAAGTCCTTCATCCGCTTGAGCTACTTGAAGAGGCAC
GAGCAGATCCACAGCGACAAGCTGCCGTTCAAGTGCACCTACTGCAGCCGCCTCTTCAAGCACAAGAGGAGCCGTGACCGGCACATCAAG
CTGCATACGGGCGACAAGAAGTATCACTGCCACGAGTGCGAGGCAGCCTTCTCCCGCAGCGACCACCTCAAGATCCACCTGAAGACCCAC
AGCTCCAGCAAGCCCTTCAAGTGCACTGTGTGCAAGCGCGGCTTCTCCTCCACCAGCTCGCTGCAGAGCCACATGCAGGCCCACAAAAAG
AACAAGGAGCATCTGGCCAAGTCGGAGAAGGAAGCCAAGAAGGACGACTTCATGTGCGACTACTGCGAGGACACCTTCAGCCAGACGGAG
GAGCTGGAGAAGCACGTGCTCACCCGCCACCCGCAGCTGTCCGAGAAGGCGGACCTGCAGTGCATTCACTGCCCTGAGGTCTTCGTCGAC
GAGAACACACTGCTCGCCCATATCCACCAAGCCCACGCCAACCAGAAACACAAGTGCCCCATGTGCCCTGAGCAGTTCTCCTCAGTGGAA
GGTGTCTACTGCCACCTGGACAGCCACCGGCAGCCCGACTCCAGCAACCACAGTGTCAGTCCCGACCCTGTACTGGGCAGCGTGGCCTCC
ATGAGCAGCGCCACACCCGACTCCAGCGCCTCTGTGGAGCGTGGCTCCACCCCGGACTCCACCTTGAAGCCGCTGCGGGGGCAGAAGAAG
ATGCGGGATGACGGGCAGGGCTGGACCAAGGTGGTCTATAGCTGCCCCTATTGTTCCAAGCGGGACTTTAACAGCCTGGCCGTGCTGGAG
ATCCACCTGAAGACCATCCACGCGGACAAGCCCCAGCAGAGCCACACATGTCAGATCTGCCTGGACTCCATGCCCACCCTCTACAACCTC
AACGAGCACGTTCGCAAGCTGCACAAGAACCATGCCTACCCTGTGATGCAGTTTGGCAACATCTCTGCCTTCCACTGCAACTACTGCCCC
GAGATGTTCGCCGACATCAATAGCCTGCAGGAGCACATCCGCGTCTCCCACTGCGGCCCCAACGCCAACCCCTCTGACGGTAATAATGCT
TTCTTCTGCAACCAGTGCTCCATGGGTTTCCTTACTGAGTCCTCCCTCACCGAGCACATCCAGCAGGCCCACTGCAGTGTGGGCAGTGCC
AAACTAGAGTCTCCGGTGGTGCAGCCCACGCAGTCCTTCATGGAGGTCTATTCCTGCCCCTACTGCACCAACTCCCCCATCTTTGGCTCC
ATCCTGAAACTCACCAAGCACATCAAGGAGAACCACAAGAACATTCCACTGGCCCACAGCAAGAAGTCCAAGGCCGAGCAGAGCCCAGTC
TCGTCCGATGTGGAGGTGTCTTCCCCGAAGCGGCAGCGGCTCTCAGCAAGCGCCAACTCCATCTCCAATGGGGAGTATCCTTGCAATCAA
TGCGACCTCAAGTTCTCCAACTTTGAGAGCTTCCAGACCCACCTGAAGCTGCACCTGGAGCTGCTGCTGCGGAAGCAAGCGTGCCCCCAG
TGCAAAGAGGACTTTGACTCCCAGGAGTCCCTCCTGCAGCACCTGACAGTGCATTACATGACCACGTCGACCCACTATGTGTGCGAGAGC
TGCGACAAGCAATTTTCCTCGGTGGATGACCTGCAGAAGCACCTGCTGGACATGCACACCTTTGTGTTGTACCACTGCACCCTGTGTCAG
GAGGTCTTCGACTCCAAGGTGTCCATCCAGGTGCACCTGGCGGTGAAGCACAGCAATGAGAAGAAGATGTACCGCTGCACGGCCTGCAAC
TGGGACTTCCGCAAGGAGGCTGACCTGCAGGTGCACGTCAAACACAGCCACCTGGGCAACCCGGCCAAGGCTCACAAGTGCATCTTCTGT
GGGGAGACCTTCAGCACCGAGGTGGAGCTGCAGTGCCACATCACCACACACAGCAAGAAGTATAACTGTAAGTTCTGCAGCAAGGCCTTC
CACGCCATCATCCTGCTGGAGAAGCACCTGCGGGAGAAGCACTGTGTGTTTGATGCTGCGACCGAGAACGGCACGGCCAATGGGGTACCC
CCAATGGCCACCAAGAAAGCTGAGCCTGCTGACCTGCAGGGCATGCTGCTTAAGAACCCTGAGGCACCTAACAGCCATGAGGCCAGCGAG
GATGACGTGGACGCGTCGGAGCCCATGTACGGCTGTGACATCTGTGGGGCGGCCTACACCATGGAGGTGCTGCTGCAGAATCACCGGCTG
CGGGACCACAATATCCGGCCGGGCGAGGATGATGGCTCACGCAAGAAGGCTGAGTTTATCAAGGGCAGTCACAAGTGCAACGTTTGTTCA
CGGACTTTCTTCTCGGAGAACGGGCTACGGGAGCACCTGCAGACGCACCGGGGCCCTGCCAAGCACTACATGTGTCCCATCTGTGGTGAG
CGCTTCCCTTCGCTGCTGACGCTCACCGAACACAAGGTGACCCACAGCAAGAGCCTGGACACGGGCACCTGTCGCATCTGCAAGATGCCC
CTGCAGAGCGAGGAGGAGTTTATTGAGCACTGCCAGATGCACCCTGACCTGCGCAACTCACTCACGGGCTTCCGCTGTGTGGTCTGCATG
CAGACAGTCACTTCCACGCTTGAGCTCAAGATCCATGGCACCTTCCACATGCAGAAGCTGGCGGGCAGCTCAGCGGCGTCCTCCCCCAAT
GGCCAGGGGCTGCAGAAGCTCTACAAGTGCGCCCTGTGCCTCAAGGAGTTCCGCAGCAAGCAGGACCTGGTGAAGCTTGACGTCAATGGG
CTGCCCTACGGCCTCTGCGCCGGCTGCATGGCCCGCAGCGCCAACGGACAGGTGGGTGGCCTGGCCCCGCCCGAGCCCGCCGACCGGCCC
TGTGCCGGCCTCCGTTGCCCCGAGTGCAGTGTCAAGTTTGAGAGTGCCGAAGACCTGGAGAGCCACATGCAGGTGGACCACCGTGACCTC
ACGCCGGAGACCAGTGGGCCCCGGAAAGGCACCCAGACATCGCCAGTGCCCCGGAAAAAGACATACCAGTGCATCAAGTGCCAGATGACC
TTCGAGAACGAGAGAGAGATCCAAATCCACGTTGCCAACCACATGATTGAGGAAGGCATCAACCACGAGTGTAAGCTGTGCAACCAGATG
TTCGACTCCCCGGCCAAGCTCCTCTGTCACCTCATTGAGCACAGCTTCGAGGGCATGGGCGGCACCTTCAAATGCCCCGTGTGTTTCACA
GTCTTCGTCCAGGCCAACAAGTTGCAGCAGCACATCTTTGCCGTGCACGGGCAGGAGGACAAGATCTACGACTGCTCACAGTGCCCTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TM9SF4_ENST00000398022_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_8054nt
AGTTTCTGCCAGGAGCTAATATGGCTTCCTTAGTTACACCGTTCTCTCTCTTCACCTAATCAGCGACCTTACTTTCCCAGACCAGACTGT
CGAGCAGGAGCTAAGACTCCTTTTCCCCTCTGCTGACCGCCACTACAGGAGCGGTTGAAGCCAGACGACCACCTTGTGGAGTTAAACTCC
GTAACCAGGGAGCACCACTTCCGCTGACGTCATTACGGCGACACGTGGATCCAAGATGGCGACGGCGATGGATTGGTTGCCGTGGTCTTT
ACTGCTTTTCTCCCTGATGTGTGAAACAAGCGCCTTCTATGTGCCTGGGGTCGCGCCTATCAACTTCCACCAGAACGATCCCGTAGAAAT
CAAGGCTGTGAAGCTCACCAGCTCTCGAACCCAGCTACCTTATGAATACTATTCACTGCCCTTCTGCCAGCCCAGCAAGATAACCTACAA
GGCAGAGAATCTGGTTGAAGAGGGGGAGGCCTCAGACTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGGAGGCCTAGAAGGAGA
GCCAGAGTGCGATCAGAAAACCAGCCGTGCGCTGGAAGACAGGAACAGCGTGACAAGTCAAGAGGAGAGAAATGAGGATGATGAAGACAT
GGAGGATGAATCAATTTACACCTGCGATCACTGTCAGCAGGACTTCGAGTCTCTGGCAGACCTGACGGACCACCGGGCCCACCGCTGTCC
TGGAGATGGTGATGACGACCCACAACTCTCCTGGGTGGCCTCGTCTCCCTCCAGCAAGGATGTTGCGTCACCCACGCAGATGATCGGAGA
TGGTTGTGACCTCGGCCTCGGCGAGGAGGAAGGGGGCACGGGCCTGCCATACCCTTGCCAGTTCTGCGACAAGTCCTTCATCCGCTTGAG
CTACTTGAAGAGGCACGAGCAGATCCACAGCGACAAGCTGCCGTTCAAGTGCACCTACTGCAGCCGCCTCTTCAAGCACAAGAGGAGCCG
TGACCGGCACATCAAGCTGCATACGGGCGACAAGAAGTATCACTGCCACGAGTGCGAGGCAGCCTTCTCCCGCAGCGACCACCTCAAGAT
CCACCTGAAGACCCACAGCTCCAGCAAGCCCTTCAAGTGCACTGTGTGCAAGCGCGGCTTCTCCTCCACCAGCTCGCTGCAGAGCCACAT
GCAGGCCCACAAAAAGAACAAGGAGCATCTGGCCAAGTCGGAGAAGGAAGCCAAGAAGGACGACTTCATGTGCGACTACTGCGAGGACAC
CTTCAGCCAGACGGAGGAGCTGGAGAAGCACGTGCTCACCCGCCACCCGCAGCTGTCCGAGAAGGCGGACCTGCAGTGCATTCACTGCCC
TGAGGTCTTCGTCGACGAGAACACACTGCTCGCCCATATCCACCAAGCCCACGCCAACCAGAAACACAAGTGCCCCATGTGCCCTGAGCA
GTTCTCCTCAGTGGAAGGTGTCTACTGCCACCTGGACAGCCACCGGCAGCCCGACTCCAGCAACCACAGTGTCAGTCCCGACCCTGTACT
GGGCAGCGTGGCCTCCATGAGCAGCGCCACACCCGACTCCAGCGCCTCTGTGGAGCGTGGCTCCACCCCGGACTCCACCTTGAAGCCGCT
GCGGGGGCAGAAGAAGATGCGGGATGACGGGCAGGGCTGGACCAAGGTGGTCTATAGCTGCCCCTATTGTTCCAAGCGGGACTTTAACAG
CCTGGCCGTGCTGGAGATCCACCTGAAGACCATCCACGCGGACAAGCCCCAGCAGAGCCACACATGTCAGATCTGCCTGGACTCCATGCC
CACCCTCTACAACCTCAACGAGCACGTTCGCAAGCTGCACAAGAACCATGCCTACCCTGTGATGCAGTTTGGCAACATCTCTGCCTTCCA
CTGCAACTACTGCCCCGAGATGTTCGCCGACATCAATAGCCTGCAGGAGCACATCCGCGTCTCCCACTGCGGCCCCAACGCCAACCCCTC
TGACGGTAATAATGCTTTCTTCTGCAACCAGTGCTCCATGGGTTTCCTTACTGAGTCCTCCCTCACCGAGCACATCCAGCAGGCCCACTG
CAGTGTGGGCAGTGCCAAACTAGAGTCTCCGGTGGTGCAGCCCACGCAGTCCTTCATGGAGGTCTATTCCTGCCCCTACTGCACCAACTC
CCCCATCTTTGGCTCCATCCTGAAACTCACCAAGCACATCAAGGAGAACCACAAGAACATTCCACTGGCCCACAGCAAGAAGTCCAAGGC
CGAGCAGAGCCCAGTCTCGTCCGATGTGGAGGTGTCTTCCCCGAAGCGGCAGCGGCTCTCAGCAAGCGCCAACTCCATCTCCAATGGGGA
GTATCCTTGCAATCAATGCGACCTCAAGTTCTCCAACTTTGAGAGCTTCCAGACCCACCTGAAGCTGCACCTGGAGCTGCTGCTGCGGAA
GCAAGCGTGCCCCCAGTGCAAAGAGGACTTTGACTCCCAGGAGTCCCTCCTGCAGCACCTGACAGTGCATTACATGACCACGTCGACCCA
CTATGTGTGCGAGAGCTGCGACAAGCAATTTTCCTCGGTGGATGACCTGCAGAAGCACCTGCTGGACATGCACACCTTTGTGTTGTACCA
CTGCACCCTGTGTCAGGAGGTCTTCGACTCCAAGGTGTCCATCCAGGTGCACCTGGCGGTGAAGCACAGCAATGAGAAGAAGATGTACCG
CTGCACGGCCTGCAACTGGGACTTCCGCAAGGAGGCTGACCTGCAGGTGCACGTCAAACACAGCCACCTGGGCAACCCGGCCAAGGCTCA
CAAGTGCATCTTCTGTGGGGAGACCTTCAGCACCGAGGTGGAGCTGCAGTGCCACATCACCACACACAGCAAGAAGTATAACTGTAAGTT
CTGCAGCAAGGCCTTCCACGCCATCATCCTGCTGGAGAAGCACCTGCGGGAGAAGCACTGTGTGTTTGATGCTGCGACCGAGAACGGCAC
GGCCAATGGGGTACCCCCAATGGCCACCAAGAAAGCTGAGCCTGCTGACCTGCAGGGCATGCTGCTTAAGAACCCTGAGGCACCTAACAG
CCATGAGGCCAGCGAGGATGACGTGGACGCGTCGGAGCCCATGTACGGCTGTGACATCTGTGGGGCGGCCTACACCATGGAGGTGCTGCT
GCAGAATCACCGGCTGCGGGACCACAATATCCGGCCGGGCGAGGATGATGGCTCACGCAAGAAGGCTGAGTTTATCAAGGGCAGTCACAA
GTGCAACGTTTGTTCACGGACTTTCTTCTCGGAGAACGGGCTACGGGAGCACCTGCAGACGCACCGGGGCCCTGCCAAGCACTACATGTG
TCCCATCTGTGGTGAGCGCTTCCCTTCGCTGCTGACGCTCACCGAACACAAGGTGACCCACAGCAAGAGCCTGGACACGGGCACCTGTCG
CATCTGCAAGATGCCCCTGCAGAGCGAGGAGGAGTTTATTGAGCACTGCCAGATGCACCCTGACCTGCGCAACTCACTCACGGGCTTCCG
CTGTGTGGTCTGCATGCAGACAGTCACTTCCACGCTTGAGCTCAAGATCCATGGCACCTTCCACATGCAGAAGCTGGCGGGCAGCTCAGC
GGCGTCCTCCCCCAATGGCCAGGGGCTGCAGAAGCTCTACAAGTGCGCCCTGTGCCTCAAGGAGTTCCGCAGCAAGCAGGACCTGGTGAA
GCTTGACGTCAATGGGCTGCCCTACGGCCTCTGCGCCGGCTGCATGGCCCGCAGCGCCAACGGACAGGTGGGTGGCCTGGCCCCGCCCGA
GCCCGCCGACCGGCCCTGTGCCGGCCTCCGTTGCCCCGAGTGCAGTGTCAAGTTTGAGAGTGCCGAAGACCTGGAGAGCCACATGCAGGT
GGACCACCGTGACCTCACGCCGGAGACCAGTGGGCCCCGGAAAGGCACCCAGACATCGCCAGTGCCCCGGAAAAAGACATACCAGTGCAT
CAAGTGCCAGATGACCTTCGAGAACGAGAGAGAGATCCAAATCCACGTTGCCAACCACATGATTGAGGAAGGCATCAACCACGAGTGTAA
GCTGTGCAACCAGATGTTCGACTCCCCGGCCAAGCTCCTCTGTCACCTCATTGAGCACAGCTTCGAGGGCATGGGCGGCACCTTCAAATG
CCCCGTGTGTTTCACAGTCTTCGTCCAGGCCAACAAGTTGCAGCAGCACATCTTTGCCGTGCACGGGCAGGAGGACAAGATCTACGACTG
CTCACAGTGCCCTCAGAAGTTCTTCTTCCAGACCGAGCTGCAGAACCACACGATGAGCCAGCACGCACAGTGAGGGATCGCTCAACAGGA
CACCTCTCCGCAGAAGGCTTGCCGGAGACGCCGTGGGGAGGGCCATTTGAACATTACATCCAATCAAAGTGTCATTTGCAACCCAGATGT
AAAACTCTAATGATTTGGCCATGAGGCGCTGCTATTATAAGCAGCTGGAAATGAATATTAATGGCAGAGATTAAAAGTATTCCATGCTCA
GTATTTTTTATTGTCCTGCTACAGCTAGTGTGCTTTTAGACTTTCCGCCGCAGACTACATTTCTAGAGTTAGAGAAACCTGCTTTTTAAG
GCTATTGTCCTTTGTTCCTTCATGTATTATATTGATAGTTTTTAAAAAAGAATTAGTGTGATTTTTTTTCTTTGCTTCTTTTTTTTCTTT
CTTGTTTTTCTTCCCCCCCACCCCCCACCCCCTTCGGTTAACTACTTTTTAATTGCAATTCTAGGTAATTGTGCATCGTGATGTGATTGC
TTGGCTATTGTCTGAATATTTCCTTTTAATTTTTTAATTAAAGACTAATGCTTTGATTGGATTTGCCAGTTCACCGGACAGTGATTAAAA
CTATGTAATGAATATAATCGGTTTCAGTGCAACTGGATGGTCTGCTTTTAAATGTGACTTAATCTGACTGCAGTAACTAGTACAGTTCAA
TAAAGGGAATCCATGCGATTAGCATCCGGCTGCCTGGTTCTCTCCTCCCCAGCCTAGGGCCGCGTGGGGGGCTGTCAGCTCCTGTAAGGT
GTGTTCCCCTACAAGTTCCTGTGGGCTTGCACACGCCCTTGGGGACCTGCACACAATAGACCCTGCTCCCCTTGGAAAAGAATCGTAGTA
ACCTAATGCATGCAGACTGGACAGGCTGGCAGTGGCCACAGGAGTCAAAGCAGAAGACCCCTTAATGATGGAATACCCTGATCTTCCCAC
TCTTGGATGGGGAAACAGAGGCCCAAGGGTAACGTGCAGCTTTCCCAAGGCCACGCAGCAGGTTGGTCACCATGCTGATTGTGAAGTCTT
CTTGGCTTTCCCTTCAGGGTTGGCTTTCCCCTTTGTTGGATACAGGCAGGCAAGTGGGTAGCCCTTCCCTTGCCAGGACTCCAGGTGGCA
CTTGGGTTCTGAGGCACGGAGATGTGTGACTGGGGACTGCAGAGCAGAGCCAGGTAGGAGCCGCAGGTTCCCAGTCATAGAGATCAGTAG
GATGTGAGAGCATTGAGACTGGTGGCGGGGGCCAGGTCTGGAGTGAGGCAGGCAGGGGCCTGGGGTACATTATTTCAGGGGGCACTCGCT
CTCAGGGCCCCCCTACACCTGCAAGTGCTGGGAATGGGTGTCCTCTTGCATTTTACACTCTAGGCACCTTGCTTATTTCACCTACTCCTG
GCCCTGCTGGCCTCCCAGGGCCCACCCAGCAGCCTTGGTCTCCAGGCCTCCTCCATGTTACCTCCCACACCTCCATCATGCTGGTGCTCA
GCTGACTTGCCAATCAGAGGCCAGAACTTGCACGGGGAAACCCTTCCTTGCTAACTTTTCACAAGGGGCAAGGAAATTGGTTATTACCCT
CTGCAGAGCGGAAATGAAACAGGCAGACAGATTGCACCTAATTATAATGTAATACTAAGTCACGGGTGTGGAATTTGGAGCAATTATACC
CATCATCTTCTAGAAGACTCCCATATCAAGGGGCTTCTGGTGACCTATAAGAGTTCCCCTTTCTTTCTGTCACCTCATGTAATGTTCTCA
CGCGGGTGGGGCTTTCAGTTTTTCAAAAGGCATCTTACATATGTGAATCATAGAGCAGACCCTGCCAGTAGTGGGCTGTTGCCTCCTGGA
AACTGAAGGCTGTGAATGCCAATTTTCAGCCTCCTGGAGACCTGGCAGTTTTGGGGGAAGACCCCAGGGTAGACACCAGTGTTCCTCTAA
GTGTGCCCACCCGTGGACTGGGGCTTGGGGCCTGGGGCTGGGGCTATGTCTGAGTGAGGCTGCCACACATCCACAGCCAGGCCTACCTTT
TGGGCAGTGCTGGGACTGTCGATGGGACCAGTATGTCCCGGGGCCTGCCACATCTCCGTCTCAGGGCCCTCTCCAGCTCTGGATTTATCC
CAAACCCCATGGAGCCCAGGTGAGCCCTCAGTAACTACCAATAGAAGATTCGATTTGACGGTTGGTGGCGTAGGGCTAAATTAGTCACTG
CCCCCATTAAAAATACAGCGGGGGGTTTAAGAGCTTTTCACGCCATGTGGGAATCAGCAGCGAAGCCGGCTGATGCCTTGGGTAAGGAGA
GAGGCGGCCTAGGGGACCGTGAGGTAATGAGGTTTATGGCGGTGACAAGGCAGCCAGGGAACCCCACCGACTCCCCCCTCACCCCGGCCG
CATTGTTCTCCGGCTGGCTCTGTCCCTGCTGCTACGGCTGAGAGCCCCTCGTGACTTTGTGTGGGGAGGGGGCTGGCAGTGGGGACCCTG
AGGCCCTTCCTGGGACTGGCATTCTTTACCATCAGGTGGTATTAGGGTTGGGGAGCAGTGTAGGGTTATAAACCTGTGCCTCGGAGAACT
CACTAACCCCTTCCAGAGGAAAGGTCTGGAGCTGGGATGAGACACTTGCCTTTCAACTGTGAGGGGCCTTAGAGGGTCTCTGGGAGGCTT
GTATGAAGTGATGCCTGACAAAGGGCTGCACACAGAGACCTGTAAGCAGCATGGTCATCAATGATGGTGCCAGGCATCCTGCAGGAGGGC
ACCTTTTCAGCCAGGAGGGCGCGATGGAATCAGCCTCTCATTTGGATTTGGCTTTGGGGAGTGGGCGAGGTGACTGAAAGCCTAAGGTTC
ATTGCTGCTGTATTTAGATGTACAAATTGTCAGTTTCTAGCGGCTCTCTGGGCAGAGGAATTTTGCCCAGGCTGGGAAATGGACCAGGAC
CCTTGGGCCACAGGCCCCTGTCATGGAACACCTGCCCAGAGTGCCCAGAAGCAGGCAGGTAAGGGTTTCAGTCTCAGTGGAGAAACTGTC
ATGGGAGAAATCTTCTCGAGTTCCCCAGCCTTAAAGAACGCTCCTTTTAAATTCACAGTTGTGTAATATTGAACTTTTCACCTGTTTTTC
TTCCCTCCTAAGGTGTGTGTTCCTAGGGATGGAACCTGTACCTATAAATATTCAGTAAATAGGACCAAAACTCAAATCCATCCCTTCCTC
TACTCATCCATTCAGCAAGTATTTACTGAGCTGCCCCCAGGTGCCAGGCACTGCACAGGGCACTGGGGATAAGGAGATGACCAGCAGATG
TGGTCCCTGGCCTCATGGAGGCCACAGTGGCACAGGCAAGCATGCCAGTAAATGCATAGCCACACCTGGTCATGAGTGCCGTGATGGCAA
AGCCAGAAGCTGCCAGGGATTAATGGAGGGACCCGTGTATGAGACACAGGGGTGCATTAAGGAAGGCCTTGCTGAGGCAGGGGCTTGAGA
CCTGAAGAAATAAGGGAGGTGGGCAGTCCAAGAGCAGTGGGAAGAGAACACTGCAAATGCAGAAGCCGTGAGCTGGAAACGAGCCAGAAG
TACCCTTAGAGAGCTGTATTCCTATGGAGTTTCAATTCTAGGTGGCTTAAAACAATCCCAGAGAAGTTCAGAATCTTGTCCAAGATCATA
CCATTCAGGATAGACTTGCGACTATAACTTGGGTGCCTCACCTTCCAGCCTGGGGTGTCTGACTCCATTGTTAATTTTATTATAACAATC

>In-frame_TM9SF4_ENST00000217315_chr20_30723976_+_ZNF423_ENST00000561648_chr16_49823457_-_8108nt
CCAAGATGGCGACGGCGATGGTGAGTGAAGGAGACTCCGGGAGCGGGAGCTGGAGCGGGGCCCTCCGGGGTATCCCAGGATCTTCCAGCA
CCCCATGCCTGGCCCTGAGCCACCTCCGGGACCCCTGACTCAGGCCTGAGGGCTACCTCTGACTGGGCTTGTCTTCCCCGAAATCCACCT
CCCTGGCCCTGCCCCTGCACTCAGGCTTGTGAAGGCCCCGAGTTTTGGGGGAGGCGCCGTTTCGGAGGAAGACCTCGGCTGCTGCCTTCG
CCGGTTCCCATTCTACTTTTGGTCTCCGCCCACTGATTGGTTGCCGTGGTCTTTACTGCTTTTCTCCCTGATGTGTGAAACAAGCGCCTT
CTATGTGCCTGGGGTCGCGCCTATCAACTTCCACCAGAACGATCCCGTAGAAATCAAGGCTGTGAAGCTCACCAGCTCTCGAACCCAGCT
ACCTTATGAATACTATTCACTGCCCTTCTGCCAGCCCAGCAAGATAACCTACAAGGCAGAGAATCTGGTTGAAGAGGGGGAGGCCTCAGA
CTTCTCGCTGGCCTGGGATTCCTCCGTGACAGCAGCAGGAGGCCTAGAAGGAGAGCCAGAGTGCGATCAGAAAACCAGCCGTGCGCTGGA
AGACAGGAACAGCGTGACAAGTCAAGAGGAGAGAAATGAGGATGATGAAGACATGGAGGATGAATCAATTTACACCTGCGATCACTGTCA
GCAGGACTTCGAGTCTCTGGCAGACCTGACGGACCACCGGGCCCACCGCTGTCCTGGAGATGGTGATGACGACCCACAACTCTCCTGGGT
GGCCTCGTCTCCCTCCAGCAAGGATGTTGCGTCACCCACGCAGATGATCGGAGATGGTTGTGACCTCGGCCTCGGCGAGGAGGAAGGGGG
CACGGGCCTGCCATACCCTTGCCAGTTCTGCGACAAGTCCTTCATCCGCTTGAGCTACTTGAAGAGGCACGAGCAGATCCACAGCGACAA
GCTGCCGTTCAAGTGCACCTACTGCAGCCGCCTCTTCAAGCACAAGAGGAGCCGTGACCGGCACATCAAGCTGCATACGGGCGACAAGAA
GTATCACTGCCACGAGTGCGAGGCAGCCTTCTCCCGCAGCGACCACCTCAAGATCCACCTGAAGACCCACAGCTCCAGCAAGCCCTTCAA
GTGCACTGTGTGCAAGCGCGGCTTCTCCTCCACCAGCTCGCTGCAGAGCCACATGCAGGCCCACAAAAAGAACAAGGAGCATCTGGCCAA
GTCGGAGAAGGAAGCCAAGAAGGACGACTTCATGTGCGACTACTGCGAGGACACCTTCAGCCAGACGGAGGAGCTGGAGAAGCACGTGCT
CACCCGCCACCCGCAGCTGTCCGAGAAGGCGGACCTGCAGTGCATTCACTGCCCTGAGGTCTTCGTCGACGAGAACACACTGCTCGCCCA
TATCCACCAAGCCCACGCCAACCAGAAACACAAGTGCCCCATGTGCCCTGAGCAGTTCTCCTCAGTGGAAGGTGTCTACTGCCACCTGGA
CAGCCACCGGCAGCCCGACTCCAGCAACCACAGTGTCAGTCCCGACCCTGTACTGGGCAGCGTGGCCTCCATGAGCAGCGCCACACCCGA
CTCCAGCGCCTCTGTGGAGCGTGGCTCCACCCCGGACTCCACCTTGAAGCCGCTGCGGGGGCAGAAGAAGATGCGGGATGACGGGCAGGG
CTGGACCAAGGTGGTCTATAGCTGCCCCTATTGTTCCAAGCGGGACTTTAACAGCCTGGCCGTGCTGGAGATCCACCTGAAGACCATCCA
CGCGGACAAGCCCCAGCAGAGCCACACATGTCAGATCTGCCTGGACTCCATGCCCACCCTCTACAACCTCAACGAGCACGTTCGCAAGCT
GCACAAGAACCATGCCTACCCTGTGATGCAGTTTGGCAACATCTCTGCCTTCCACTGCAACTACTGCCCCGAGATGTTCGCCGACATCAA
TAGCCTGCAGGAGCACATCCGCGTCTCCCACTGCGGCCCCAACGCCAACCCCTCTGACGGTAATAATGCTTTCTTCTGCAACCAGTGCTC
CATGGGTTTCCTTACTGAGTCCTCCCTCACCGAGCACATCCAGCAGGCCCACTGCAGTGTGGGCAGTGCCAAACTAGAGTCTCCGGTGGT
GCAGCCCACGCAGTCCTTCATGGAGGTCTATTCCTGCCCCTACTGCACCAACTCCCCCATCTTTGGCTCCATCCTGAAACTCACCAAGCA
CATCAAGGAGAACCACAAGAACATTCCACTGGCCCACAGCAAGAAGTCCAAGGCCGAGCAGAGCCCAGTCTCGTCCGATGTGGAGGTGTC
TTCCCCGAAGCGGCAGCGGCTCTCAGCAAGCGCCAACTCCATCTCCAATGGGGAGTATCCTTGCAATCAATGCGACCTCAAGTTCTCCAA
CTTTGAGAGCTTCCAGACCCACCTGAAGCTGCACCTGGAGCTGCTGCTGCGGAAGCAAGCGTGCCCCCAGTGCAAAGAGGACTTTGACTC
CCAGGAGTCCCTCCTGCAGCACCTGACAGTGCATTACATGACCACGTCGACCCACTATGTGTGCGAGAGCTGCGACAAGCAATTTTCCTC
GGTGGATGACCTGCAGAAGCACCTGCTGGACATGCACACCTTTGTGTTGTACCACTGCACCCTGTGTCAGGAGGTCTTCGACTCCAAGGT
GTCCATCCAGGTGCACCTGGCGGTGAAGCACAGCAATGAGAAGAAGATGTACCGCTGCACGGCCTGCAACTGGGACTTCCGCAAGGAGGC
TGACCTGCAGGTGCACGTCAAACACAGCCACCTGGGCAACCCGGCCAAGGCTCACAAGTGCATCTTCTGTGGGGAGACCTTCAGCACCGA
GGTGGAGCTGCAGTGCCACATCACCACACACAGCAAGAAGTATAACTGTAAGTTCTGCAGCAAGGCCTTCCACGCCATCATCCTGCTGGA
GAAGCACCTGCGGGAGAAGCACTGTGTGTTTGATGCTGCGACCGAGAACGGCACGGCCAATGGGGTACCCCCAATGGCCACCAAGAAAGC
TGAGCCTGCTGACCTGCAGGGCATGCTGCTTAAGAACCCTGAGGCACCTAACAGCCATGAGGCCAGCGAGGATGACGTGGACGCGTCGGA
GCCCATGTACGGCTGTGACATCTGTGGGGCGGCCTACACCATGGAGGTGCTGCTGCAGAATCACCGGCTGCGGGACCACAATATCCGGCC
GGGCGAGGATGATGGCTCACGCAAGAAGGCTGAGTTTATCAAGGGCAGTCACAAGTGCAACGTTTGTTCACGGACTTTCTTCTCGGAGAA
CGGGCTACGGGAGCACCTGCAGACGCACCGGGGCCCTGCCAAGCACTACATGTGTCCCATCTGTGGTGAGCGCTTCCCTTCGCTGCTGAC
GCTCACCGAACACAAGGTGACCCACAGCAAGAGCCTGGACACGGGCACCTGTCGCATCTGCAAGATGCCCCTGCAGAGCGAGGAGGAGTT
TATTGAGCACTGCCAGATGCACCCTGACCTGCGCAACTCACTCACGGGCTTCCGCTGTGTGGTCTGCATGCAGACAGTCACTTCCACGCT
TGAGCTCAAGATCCATGGCACCTTCCACATGCAGAAGCTGGCGGGCAGCTCAGCGGCGTCCTCCCCCAATGGCCAGGGGCTGCAGAAGCT
CTACAAGTGCGCCCTGTGCCTCAAGGAGTTCCGCAGCAAGCAGGACCTGGTGAAGCTTGACGTCAATGGGCTGCCCTACGGCCTCTGCGC
CGGCTGCATGGCCCGCAGCGCCAACGGACAGGTGGGTGGCCTGGCCCCGCCCGAGCCCGCCGACCGGCCCTGTGCCGGCCTCCGTTGCCC
CGAGTGCAGTGTCAAGTTTGAGAGTGCCGAAGACCTGGAGAGCCACATGCAGGTGGACCACCGTGACCTCACGCCGGAGACCAGTGGGCC
CCGGAAAGGCACCCAGACATCGCCAGTGCCCCGGAAAAAGACATACCAGTGCATCAAGTGCCAGATGACCTTCGAGAACGAGAGAGAGAT
CCAAATCCACGTTGCCAACCACATGATTGAGGAAGGCATCAACCACGAGTGTAAGCTGTGCAACCAGATGTTCGACTCCCCGGCCAAGCT
CCTCTGTCACCTCATTGAGCACAGCTTCGAGGGCATGGGCGGCACCTTCAAATGCCCCGTGTGTTTCACAGTCTTCGTCCAGGCCAACAA
GTTGCAGCAGCACATCTTTGCCGTGCACGGGCAGGAGGACAAGATCTACGACTGCTCACAGTGCCCTCAGAAGTTCTTCTTCCAGACCGA
GCTGCAGAACCACACGATGAGCCAGCACGCACAGTGAGGGATCGCTCAACAGGACACCTCTCCGCAGAAGGCTTGCCGGAGACGCCGTGG
GGAGGGCCATTTGAACATTACATCCAATCAAAGTGTCATTTGCAACCCAGATGTAAAACTCTAATGATTTGGCCATGAGGCGCTGCTATT
ATAAGCAGCTGGAAATGAATATTAATGGCAGAGATTAAAAGTATTCCATGCTCAGTATTTTTTATTGTCCTGCTACAGCTAGTGTGCTTT
TAGACTTTCCGCCGCAGACTACATTTCTAGAGTTAGAGAAACCTGCTTTTTAAGGCTATTGTCCTTTGTTCCTTCATGTATTATATTGAT
AGTTTTTAAAAAAGAATTAGTGTGATTTTTTTTCTTTGCTTCTTTTTTTTCTTTCTTGTTTTTCTTCCCCCCCACCCCCCACCCCCTTCG
GTTAACTACTTTTTAATTGCAATTCTAGGTAATTGTGCATCGTGATGTGATTGCTTGGCTATTGTCTGAATATTTCCTTTTAATTTTTTA
ATTAAAGACTAATGCTTTGATTGGATTTGCCAGTTCACCGGACAGTGATTAAAACTATGTAATGAATATAATCGGTTTCAGTGCAACTGG
ATGGTCTGCTTTTAAATGTGACTTAATCTGACTGCAGTAACTAGTACAGTTCAATAAAGGGAATCCATGCGATTAGCATCCGGCTGCCTG
GTTCTCTCCTCCCCAGCCTAGGGCCGCGTGGGGGGCTGTCAGCTCCTGTAAGGTGTGTTCCCCTACAAGTTCCTGTGGGCTTGCACACGC
CCTTGGGGACCTGCACACAATAGACCCTGCTCCCCTTGGAAAAGAATCGTAGTAACCTAATGCATGCAGACTGGACAGGCTGGCAGTGGC
CACAGGAGTCAAAGCAGAAGACCCCTTAATGATGGAATACCCTGATCTTCCCACTCTTGGATGGGGAAACAGAGGCCCAAGGGTAACGTG
CAGCTTTCCCAAGGCCACGCAGCAGGTTGGTCACCATGCTGATTGTGAAGTCTTCTTGGCTTTCCCTTCAGGGTTGGCTTTCCCCTTTGT
TGGATACAGGCAGGCAAGTGGGTAGCCCTTCCCTTGCCAGGACTCCAGGTGGCACTTGGGTTCTGAGGCACGGAGATGTGTGACTGGGGA
CTGCAGAGCAGAGCCAGGTAGGAGCCGCAGGTTCCCAGTCATAGAGATCAGTAGGATGTGAGAGCATTGAGACTGGTGGCGGGGGCCAGG
TCTGGAGTGAGGCAGGCAGGGGCCTGGGGTACATTATTTCAGGGGGCACTCGCTCTCAGGGCCCCCCTACACCTGCAAGTGCTGGGAATG
GGTGTCCTCTTGCATTTTACACTCTAGGCACCTTGCTTATTTCACCTACTCCTGGCCCTGCTGGCCTCCCAGGGCCCACCCAGCAGCCTT
GGTCTCCAGGCCTCCTCCATGTTACCTCCCACACCTCCATCATGCTGGTGCTCAGCTGACTTGCCAATCAGAGGCCAGAACTTGCACGGG
GAAACCCTTCCTTGCTAACTTTTCACAAGGGGCAAGGAAATTGGTTATTACCCTCTGCAGAGCGGAAATGAAACAGGCAGACAGATTGCA
CCTAATTATAATGTAATACTAAGTCACGGGTGTGGAATTTGGAGCAATTATACCCATCATCTTCTAGAAGACTCCCATATCAAGGGGCTT
CTGGTGACCTATAAGAGTTCCCCTTTCTTTCTGTCACCTCATGTAATGTTCTCACGCGGGTGGGGCTTTCAGTTTTTCAAAAGGCATCTT
ACATATGTGAATCATAGAGCAGACCCTGCCAGTAGTGGGCTGTTGCCTCCTGGAAACTGAAGGCTGTGAATGCCAATTTTCAGCCTCCTG
GAGACCTGGCAGTTTTGGGGGAAGACCCCAGGGTAGACACCAGTGTTCCTCTAAGTGTGCCCACCCGTGGACTGGGGCTTGGGGCCTGGG
GCTGGGGCTATGTCTGAGTGAGGCTGCCACACATCCACAGCCAGGCCTACCTTTTGGGCAGTGCTGGGACTGTCGATGGGACCAGTATGT
CCCGGGGCCTGCCACATCTCCGTCTCAGGGCCCTCTCCAGCTCTGGATTTATCCCAAACCCCATGGAGCCCAGGTGAGCCCTCAGTAACT
ACCAATAGAAGATTCGATTTGACGGTTGGTGGCGTAGGGCTAAATTAGTCACTGCCCCCATTAAAAATACAGCGGGGGGTTTAAGAGCTT
TTCACGCCATGTGGGAATCAGCAGCGAAGCCGGCTGATGCCTTGGGTAAGGAGAGAGGCGGCCTAGGGGACCGTGAGGTAATGAGGTTTA
TGGCGGTGACAAGGCAGCCAGGGAACCCCACCGACTCCCCCCTCACCCCGGCCGCATTGTTCTCCGGCTGGCTCTGTCCCTGCTGCTACG
GCTGAGAGCCCCTCGTGACTTTGTGTGGGGAGGGGGCTGGCAGTGGGGACCCTGAGGCCCTTCCTGGGACTGGCATTCTTTACCATCAGG
TGGTATTAGGGTTGGGGAGCAGTGTAGGGTTATAAACCTGTGCCTCGGAGAACTCACTAACCCCTTCCAGAGGAAAGGTCTGGAGCTGGG
ATGAGACACTTGCCTTTCAACTGTGAGGGGCCTTAGAGGGTCTCTGGGAGGCTTGTATGAAGTGATGCCTGACAAAGGGCTGCACACAGA
GACCTGTAAGCAGCATGGTCATCAATGATGGTGCCAGGCATCCTGCAGGAGGGCACCTTTTCAGCCAGGAGGGCGCGATGGAATCAGCCT
CTCATTTGGATTTGGCTTTGGGGAGTGGGCGAGGTGACTGAAAGCCTAAGGTTCATTGCTGCTGTATTTAGATGTACAAATTGTCAGTTT
CTAGCGGCTCTCTGGGCAGAGGAATTTTGCCCAGGCTGGGAAATGGACCAGGACCCTTGGGCCACAGGCCCCTGTCATGGAACACCTGCC
CAGAGTGCCCAGAAGCAGGCAGGTAAGGGTTTCAGTCTCAGTGGAGAAACTGTCATGGGAGAAATCTTCTCGAGTTCCCCAGCCTTAAAG
AACGCTCCTTTTAAATTCACAGTTGTGTAATATTGAACTTTTCACCTGTTTTTCTTCCCTCCTAAGGTGTGTGTTCCTAGGGATGGAACC
TGTACCTATAAATATTCAGTAAATAGGACCAAAACTCAAATCCATCCCTTCCTCTACTCATCCATTCAGCAAGTATTTACTGAGCTGCCC
CCAGGTGCCAGGCACTGCACAGGGCACTGGGGATAAGGAGATGACCAGCAGATGTGGTCCCTGGCCTCATGGAGGCCACAGTGGCACAGG
CAAGCATGCCAGTAAATGCATAGCCACACCTGGTCATGAGTGCCGTGATGGCAAAGCCAGAAGCTGCCAGGGATTAATGGAGGGACCCGT
GTATGAGACACAGGGGTGCATTAAGGAAGGCCTTGCTGAGGCAGGGGCTTGAGACCTGAAGAAATAAGGGAGGTGGGCAGTCCAAGAGCA
GTGGGAAGAGAACACTGCAAATGCAGAAGCCGTGAGCTGGAAACGAGCCAGAAGTACCCTTAGAGAGCTGTATTCCTATGGAGTTTCAAT
TCTAGGTGGCTTAAAACAATCCCAGAGAAGTTCAGAATCTTGTCCAAGATCATACCATTCAGGATAGACTTGCGACTATAACTTGGGTGC
CTCACCTTCCAGCCTGGGGTGTCTGACTCCATTGTTAATTTTATTATAACAATCATGATGACAACGATGAATAAAGTGAAATTGTACTGT


Top

FusionGenePPI for TM9SF4_ZNF423


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TM9SF4ELAVL1, IGF2R, SPCS2, TMX2, FAM162A, LAMP1, UQCRFS1, ATP1B3, F3, ERMP1, LMAN2, RAB1A, STX12, STX7, SGPL1, TMED2, CALD1, HIST1H1B, KDM5A, RPN2, S100A6, SLC25A12, OASL, RIOK3, H1FX, PHF14, ABCF2, SCAMP3, ATP5H, SACM1L, MKRN2, ITSN2, FCF1, SIRT6, TMEM161A, CDCA7L, ZC3H15, RPAP3, CEP44, RNF170, SP140L, H2AFV, ZNF800, NSMCE2, FAM3B, TSPAN11, TRIM25ZNF423PARP1, SMAD4, SMAD1, EBF1, EBF2, EBF3, USP7, CEP290, LYN, BRCA1, MTA1, ZNF219, RBBP7, MBD3L1, ZG16B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TM9SF4_ZNF423


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TM9SF4_ZNF423


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneZNF423C0236733Amphetamine-Related Disorders1CTD_human
TgeneZNF423C3539071NEPHRONOPHTHISIS 141UNIPROT