FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38100

FusionGeneSummary for TIMM17A_RASSF5

check button Fusion gene summary
Fusion gene informationFusion gene name: TIMM17A_RASSF5
Fusion gene ID: 38100
HgeneTgene
Gene symbol

TIMM17A

RASSF5

Gene ID

10440

283349

Gene nametranslocase of inner mitochondrial membrane 17ARas association domain family member 3
SynonymsTIM17|TIM17ARASSF5
Cytomap

1q32.1

12q14.2

Type of geneprotein-codingprotein-coding
Descriptionmitochondrial import inner membrane translocase subunit Tim17-Ainner membrane preprotein translocase Tim17amitochondrial inner membrane translocasepreprotein translocasetranslocase of inner mitochondrial membrane 17 homolog Aras association domain-containing protein 3Ras association (RalGDS/AF-6) domain family 3Ras association (RalGDS/AF-6) domain family member 3
Modification date2018052320180519
UniProtAcc

Q99595

Q8WWW0

Ensembl transtripts involved in fusion geneENST00000367287, ENST00000482943, 
ENST00000355294, ENST00000367117, 
ENST00000304534, ENST00000491368, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 4 X 2=24
# samples 24
** MAII scorelog2(2/8*10)=1.32192809488736log2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: TIMM17A [Title/Abstract] AND RASSF5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A203-01ATIMM17Achr1

201926702

+RASSF5chr1

206711501

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000367287ENST00000355294TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
In-frameENST00000367287ENST00000367117TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
5CDS-intronENST00000367287ENST00000304534TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
5CDS-intronENST00000367287ENST00000491368TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
intron-3CDSENST00000482943ENST00000355294TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
intron-3CDSENST00000482943ENST00000367117TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
intron-intronENST00000482943ENST00000304534TIMM17Achr1

201926702

+RASSF5chr1

206711501

+
intron-intronENST00000482943ENST00000491368TIMM17Achr1

201926702

+RASSF5chr1

206711501

+

Top

FusionProtFeatures for TIMM17A_RASSF5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TIMM17A

Q99595

RASSF5

Q8WWW0

Essential component of the TIM23 complex, a complex thatmediates the translocation of transit peptide-containing proteinsacross the mitochondrial inner membrane. Potential tumor suppressor. Seems to be involved inlymphocyte adhesion by linking RAP1A activation upon T-cellreceptor or chemokine stimulation to integrin activation. Isoform2 stimulates lymphocyte polarization and the patch-likedistribution of ITGAL/LFA-1, resulting in an enhanced adhesion toICAM1. Together with RAP1A may participate in regulation ofmicrotubule growth. The association of isoform 2 with activatedRAP1A is required for directional movement of endothelial cellsduring wound healing. May be involved in regulation of Rasapoptotic function. The RASSF5-STK4/MST1 complex may mediate HRASand KRAS induced apoptosis. {ECO:0000269|PubMed:12676952,ECO:0000269|PubMed:12845325, ECO:0000269|PubMed:15569673}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTIMM17Achr1:201926702chr1:206711501ENST00000367287+3617_3763172TransmembraneHelical
TgeneRASSF5chr1:201926702chr1:206711501ENST00000304534+05274_364-137266DomainRas-associating
TgeneRASSF5chr1:201926702chr1:206711501ENST00000304534+05366_413-137266DomainSARAH
TgeneRASSF5chr1:201926702chr1:206711501ENST00000355294+06274_364152419DomainRas-associating
TgeneRASSF5chr1:201926702chr1:206711501ENST00000355294+06366_413152419DomainSARAH
TgeneRASSF5chr1:201926702chr1:206711501ENST00000367117+05274_364152337DomainRas-associating
TgeneRASSF5chr1:201926702chr1:206711501ENST00000367117+05366_413152337DomainSARAH
TgeneRASSF5chr1:201926702chr1:206711501ENST00000304534+05122_170-137266Zinc fingerPhorbol-ester/DAG-type

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTIMM17Achr1:201926702chr1:206711501ENST00000367287+36113_13363172TransmembraneHelical
HgeneTIMM17Achr1:201926702chr1:206711501ENST00000367287+3663_7763172TransmembraneHelical
TgeneRASSF5chr1:201926702chr1:206711501ENST00000355294+06122_170152419Zinc fingerPhorbol-ester/DAG-type
TgeneRASSF5chr1:201926702chr1:206711501ENST00000367117+05122_170152337Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for TIMM17A_RASSF5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000355294_chr1_206711501_+_330aa
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGDCKFTCHPECRSLIQLDCSQQEGLSRD
RPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSITDAIKEVN
LAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVL

>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000367117_chr1_206711501_+_248aa
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGDCKFTCHPECRSLIQLDCSQQEGLSRD
RPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSITDAIKEVN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000355294_chr1_206711501_+_990nt
ATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGTGGGGCCTTTACGATGGGTACCATTGGTGGTGGTATC
TTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTACGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCA
CAGTTAGGAGACTGTAAATTCACCTGTCACCCAGAATGCCGCAGCCTGATCCAGTTGGACTGCAGTCAGCAGGAGGGTTTATCCCGGGAC
AGACCCTCTCCAGAAAGCACCCTCACCGTGACCTTCAGCCAGAATGTCTGTAAACCTGTGGAGGAGACACAGCGCCCGCCCACACTGCAG
GAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAGAACTGCCTGGGCATGAAACTGAGTGAAGACGGCACCTACACGGGTTTC
ATCAAAGTGCATCTGAAACTCCGGCGGCCTGTGACGGTGCCTGCTGGGATCCGGCCCCAGTCCATCTATGATGCCATCAAGGAGGTGAAC
CTGGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATCAAGCAGCTGCACATCAGCAGCACCACCACCGTCAGT
GAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGAAGTTTGCACTTTTTAAGCGGATACACAAGGACGGACAA
GTGCTCTTCCAGAAACTCTCCATTGCTGACCGCCCCCTCTACCTGCGCCTGCTTGCTGGGCCTGACACGGAGGTCCTCAGCTTTGTGCTA
AAGGAGAATGAAACTGGAGAGGTAGAGTGGGATGCCTTCTCCATCCCTGAACTTCAGAACTTCCTAACAATCCTGGAAAAAGAGGAGCAG
GACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAGGAGGCCTTAAGAGAATCCCAGGGCAAACCTGGGTAA

>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000367117_chr1_206711501_+_744nt
ATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGTGGGGCCTTTACGATGGGTACCATTGGTGGTGGTATC
TTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTACGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCA
CAGTTAGGAGACTGTAAATTCACCTGTCACCCAGAATGCCGCAGCCTGATCCAGTTGGACTGCAGTCAGCAGGAGGGTTTATCCCGGGAC
AGACCCTCTCCAGAAAGCACCCTCACCGTGACCTTCAGCCAGAATGTCTGTAAACCTGTGGAGGAGACACAGCGCCCGCCCACACTGCAG
GAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAGAACTGCCTGGGCATGAAACTGAGTGAAGACGGCACCTACACGGGTTTC
ATCAAAGTGCATCTGAAACTCCGGCGGCCTGTGACGGTGCCTGCTGGGATCCGGCCCCAGTCCATCTATGATGCCATCAAGGAGGTGAAC
CTGGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATCAAGCAGCTGCACATCAGCAGCACCACCACCGTCAGT
GAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGAAGTTTGCACTTTTTAAGCGGATACACAAGGACGGACAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000355294_chr1_206711501_+_1760nt
AGCTTGCCCGGCATCACTCGCGGCATTGGAGTCAAGATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGT
GGGGCCTTTACGATGGGTACCATTGGTGGTGGTATCTTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTA
CGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCACAGTTAGGAGACTGTAAATTCACCTGTCACCCAGAATGCCGCAGCCTGATCCAG
TTGGACTGCAGTCAGCAGGAGGGTTTATCCCGGGACAGACCCTCTCCAGAAAGCACCCTCACCGTGACCTTCAGCCAGAATGTCTGTAAA
CCTGTGGAGGAGACACAGCGCCCGCCCACACTGCAGGAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAGAACTGCCTGGGC
ATGAAACTGAGTGAAGACGGCACCTACACGGGTTTCATCAAAGTGCATCTGAAACTCCGGCGGCCTGTGACGGTGCCTGCTGGGATCCGG
CCCCAGTCCATCTATGATGCCATCAAGGAGGTGAACCTGGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATC
AAGCAGCTGCACATCAGCAGCACCACCACCGTCAGTGAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGAAG
TTTGCACTTTTTAAGCGGATACACAAGGACGGACAAGTGCTCTTCCAGAAACTCTCCATTGCTGACCGCCCCCTCTACCTGCGCCTGCTT
GCTGGGCCTGACACGGAGGTCCTCAGCTTTGTGCTAAAGGAGAATGAAACTGGAGAGGTAGAGTGGGATGCCTTCTCCATCCCTGAACTT
CAGAACTTCCTAACAATCCTGGAAAAAGAGGAGCAGGACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAG
GAGGCCTTAAGAGAATCCCAGGGCAAACCTGGGTAACCGGTCCTGCTTCCTCTCCTCCTGGTGCATTCAGATTTATTTGTATTATTAATT
ATTATTTTGCAACAGACACTTTTTCTCAGGACATCTCTGGCAGGTGCATTTGTGCCTGCCCAGCAGTTCCAGCTGTGGCAAAAGTCTCTT
CCATGGACAAGTGTTTGCATGGGGGTTCAGCTGTGCCCGCCCCCAGGCTGTGCCCCACCACAGATTCTGCCAAGGATCAGAACTCATGTG
AAACAAACAGCTGACGTCCTCTCTCGATCTGCAAGCCTTTCACCAACCAAATAGTTGCCTCTCTCGTCACCAAACTGGAACCTCACACCA
GCCGGCAAAGGAAGGAAGAAAGGTTTTAGAGCTGTGTGTTCTTTCTCTGGCTTTGATTCTTCTTTGAGTTCTCTTACTTGCCACGTACAG
GACCATTATTTATGAGTGAAAAGTTGTAGCACATTCCTTTTGCAGGTCTGAGCTAAGCCCCTGAAAGCAGGGTAATGCTCATAAAAGGAC
TGTTCCCGCGGCCCCAAGGTGCCTGTTGTTCACACTTAAGGGAAGTTTATAAAGCTACTGGCCCCAGATGCTCAGGGTAAGGAGCACCAA
AGCTGAGGCTGGCTCAGAGATCTCCAGAGAAGCTGCAGCCTGCCCTGGCCCTGGCTCTGGCCCTGGCCCACATTGCACATGGAAACCCAA

>In-frame_TIMM17A_ENST00000367287_chr1_201926702_+_RASSF5_ENST00000367117_chr1_206711501_+_1644nt
AGCTTGCCCGGCATCACTCGCGGCATTGGAGTCAAGATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGT
GGGGCCTTTACGATGGGTACCATTGGTGGTGGTATCTTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTA
CGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCACAGTTAGGAGACTGTAAATTCACCTGTCACCCAGAATGCCGCAGCCTGATCCAG
TTGGACTGCAGTCAGCAGGAGGGTTTATCCCGGGACAGACCCTCTCCAGAAAGCACCCTCACCGTGACCTTCAGCCAGAATGTCTGTAAA
CCTGTGGAGGAGACACAGCGCCCGCCCACACTGCAGGAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAGAACTGCCTGGGC
ATGAAACTGAGTGAAGACGGCACCTACACGGGTTTCATCAAAGTGCATCTGAAACTCCGGCGGCCTGTGACGGTGCCTGCTGGGATCCGG
CCCCAGTCCATCTATGATGCCATCAAGGAGGTGAACCTGGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATC
AAGCAGCTGCACATCAGCAGCACCACCACCGTCAGTGAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGAAG
TTTGCACTTTTTAAGCGGATACACAAGGACGGACAAGTGGGATGCCTTCTCCATCCCTGAACTTCAGAACTTCCTAACAATCCTGGAAAA
AGAGGAGCAGGACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAGGAGGCCTTAAGAGAATCCCAGGGCAA
ACCTGGGTAACCGGTCCTGCTTCCTCTCCTCCTGGTGCATTCAGATTTATTTGTATTATTAATTATTATTTTGCAACAGACACTTTTTCT
CAGGACATCTCTGGCAGGTGCATTTGTGCCTGCCCAGCAGTTCCAGCTGTGGCAAAAGTCTCTTCCATGGACAAGTGTTTGCATGGGGGT
TCAGCTGTGCCCGCCCCCAGGCTGTGCCCCACCACAGATTCTGCCAAGGATCAGAACTCATGTGAAACAAACAGCTGACGTCCTCTCTCG
ATCTGCAAGCCTTTCACCAACCAAATAGTTGCCTCTCTCGTCACCAAACTGGAACCTCACACCAGCCGGCAAAGGAAGGAAGAAAGGTTT
TAGAGCTGTGTGTTCTTTCTCTGGCTTTGATTCTTCTTTGAGTTCTCTTACTTGCCACGTACAGGACCATTATTTATGAGTGAAAAGTTG
TAGCACATTCCTTTTGCAGGTCTGAGCTAAGCCCCTGAAAGCAGGGTAATGCTCATAAAAGGACTGTTCCCGCGGCCCCAAGGTGCCTGT
TGTTCACACTTAAGGGAAGTTTATAAAGCTACTGGCCCCAGATGCTCAGGGTAAGGAGCACCAAAGCTGAGGCTGGCTCAGAGATCTCCA
GAGAAGCTGCAGCCTGCCCTGGCCCTGGCTCTGGCCCTGGCCCACATTGCACATGGAAACCCAAAGGCATATATCTGCGTATGTGTGGTA


Top

FusionGenePPI for TIMM17A_RASSF5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TIMM17ATIMM44, PAM16, DNAJC19, TUBA1A, SRSF3, SFXN3, DNAJC15, DUSP22, P2RX5, ELOVL5, ROMO1, TRIM25RASSF5HRAS, MRAS, RASSF1, RASSF2, KRAS, RAP2A, RRAS, RASSF5, MAP1LC3A, MAP1LC3B, MAP1S, STK4, MAP1B, STK3, FLNC, ERP44, AGL, KCTD12, HIPK1, MDM2, UBQLN1, APPBP2, ITCH, KPNB1, ADH6, LSM7, MOB1A, MOB1B, BTRC, SMAD4, RABIF, RAP1B, RAP2B, REL, TRAF1, TRAF2, MYLIP, VPS28, AMOTL2, KRTAP4-2, KRT40


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TIMM17A_RASSF5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TIMM17A_RASSF5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRASSF5C0022665Kidney Neoplasm1CTD_human
TgeneRASSF5C0027819Neuroblastoma1CTD_human