FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3806

FusionGeneSummary for BAI1_EXT1

check button Fusion gene summary
Fusion gene informationFusion gene name: BAI1_EXT1
Fusion gene ID: 3806
HgeneTgene
Gene symbol

BAI1

EXT1

Gene ID

575

2131

Gene nameadhesion G protein-coupled receptor B1exostosin glycosyltransferase 1
SynonymsBAI1|GDAIFEXT|LGCR|LGS|TRPS2|TTV
Cytomap

8q24.3

8q24.11

Type of geneprotein-codingprotein-coding
Descriptionadhesion G protein-coupled receptor B1brain-specific angiogenesis inhibitor 1exostosin-1Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferaseLanger-Giedion syndrome chromosome regionN-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferaseexostoses (multiple) 1glucuronosyl-N-acetylgluc
Modification date2018052320180522
UniProtAcc

Q16394

Ensembl transtripts involved in fusion geneENST00000517894, ENST00000323289, 
ENST00000378204, 
Fusion gene scores* DoF score1 X 1 X 1=17 X 6 X 5=210
# samples 19
** MAII scorelog2(1/1*10)=3.32192809488736log2(9/210*10)=-1.22239242133645
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BAI1 [Title/Abstract] AND EXT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBAI1

GO:0010596

negative regulation of endothelial cell migration

15782143|19176395

HgeneBAI1

GO:0016525

negative regulation of angiogenesis

15782143|19176395|22330140

TgeneEXT1

GO:0006024

glycosaminoglycan biosynthetic process

12907669

TgeneEXT1

GO:0015012

heparan sulfate proteoglycan biosynthetic process

9620772|10639137

TgeneEXT1

GO:0033692

cellular polysaccharide biosynthetic process

12907669


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HW-A5KK-01ABAI1chr8

143592434

+EXT1chr8

118834836

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000517894ENST00000378204BAI1chr8

143592434

+EXT1chr8

118834836

-
In-frameENST00000323289ENST00000378204BAI1chr8

143592434

+EXT1chr8

118834836

-

Top

FusionProtFeatures for BAI1_EXT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BAI1

EXT1

Q16394

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. Glycosyltransferase required for the biosynthesis ofheparan-sulfate. The EXT1/EXT2 complex possesses substantiallyhigher glycosyltransferase activity than EXT1 or EXT2 alone.Appears to be a tumor suppressor. Required for the exosomalrelease of SDCBP, CD63 and syndecan (PubMed:22660413).{ECO:0000269|PubMed:11518722, ECO:0000269|PubMed:22660413}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730261_3159391585DomainTSP type-1 1
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730354_4079391585DomainTSP type-1 2
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730409_4629391585DomainTSP type-1 3
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730467_5209391585DomainTSP type-1 4
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730522_5759391585DomainTSP type-1 5
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730881_9389391585DomainGPS
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831261_3159391585DomainTSP type-1 1
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831354_4079391585DomainTSP type-1 2
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831409_4629391585DomainTSP type-1 3
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831467_5209391585DomainTSP type-1 4
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831522_5759391585DomainTSP type-1 5
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831881_9389391585DomainGPS
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-311544_549428747RegionSubstrate binding
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-311565_567428747RegionSubstrate binding
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-311650_654428747RegionSubstrate binding
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-311688_701428747RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301411_14229391585Compositional biasNote=Poly-Pro
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301425_14309391585Compositional biasNote=Poly-Pro
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311411_14229391585Compositional biasNote=Poly-Pro
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311425_14309391585Compositional biasNote=Poly-Pro
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730927_9439391585RegionN-terminal stalk following vasculostatin-120 cleavage which is not required for signaling activity
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831927_9439391585RegionN-terminal stalk following vasculostatin-120 cleavage which is not required for signaling activity
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301002_10089391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301030_10529391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301074_10939391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301115_11369391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301158_11669391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301188_15849391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+173031_9489391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730970_9809391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311002_10089391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311030_10529391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311074_10939391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311115_11369391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311158_11669391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311188_15849391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+183131_9489391585Topological domainExtracellular
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831970_9809391585Topological domainCytoplasmic
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301009_10299391585TransmembraneHelical%3B Name%3D3
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301053_10739391585TransmembraneHelical%3B Name%3D4
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301094_11149391585TransmembraneHelical%3B Name%3D5
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301137_11579391585TransmembraneHelical%3B Name%3D6
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+17301167_11879391585TransmembraneHelical%3B Name%3D7
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730949_9699391585TransmembraneHelical%3B Name%3D1
HgeneBAI1chr8:143592434chr8:118834836ENST00000323289+1730981_10019391585TransmembraneHelical%3B Name%3D2
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311009_10299391585TransmembraneHelical%3B Name%3D3
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311053_10739391585TransmembraneHelical%3B Name%3D4
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311094_11149391585TransmembraneHelical%3B Name%3D5
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311137_11579391585TransmembraneHelical%3B Name%3D6
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+18311167_11879391585TransmembraneHelical%3B Name%3D7
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831949_9699391585TransmembraneHelical%3B Name%3D1
HgeneBAI1chr8:143592434chr8:118834836ENST00000517894+1831981_10019391585TransmembraneHelical%3B Name%3D2
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-3111_7428747Topological domainCytoplasmic
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-31129_746428747Topological domainLumenal
TgeneEXT1chr8:143592434chr8:118834836ENST00000378204-3118_28428747TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for BAI1_EXT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BAI1_ENST00000517894_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_1258aa
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVFPANASRCSWTLRNPDPRRYTLYMKVAKAP
VPCSGPGRVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAVAGGPENCLTSLTQDRGGHGATGGWKLWSLW
GECTRDCGGGLQTRTRTCLPAPGVEGGGCEGVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLCSSTCGRGFRDRTRTCRPPQFGGNPCEGPE
KQTKFCNIALCPGRAVDGNWNEWSSWSACSASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVAAVRCPRNATGLILRRCELDEEGIAYWEPPT
YIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKS
VFSTGLTEADEASVFVVGTVLYRNLGSFLALQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMTNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADAIIQDRIFKHISRNSLIWNKHPGGLFVLPQTSSTLGDFPYYTANLGLKPPSK
FTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTV
LSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKTTHYLYSHYLPASLKNMVDQLANCEDILMNF

>In-frame_BAI1_ENST00000323289_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_1258aa
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVFPANASRCSWTLRNPDPRRYTLYMKVAKAP
VPCSGPGRVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAVAGGPENCLTSLTQDRGGHGATGGWKLWSLW
GECTRDCGGGLQTRTRTCLPAPGVEGGGCEGVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLCSSTCGRGFRDRTRTCRPPQFGGNPCEGPE
KQTKFCNIALCPGRAVDGNWNEWSSWSACSASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVAAVRCPRNATGLILRRCELDEEGIAYWEPPT
YIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKS
VFSTGLTEADEASVFVVGTVLYRNLGSFLALQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMTNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADAIIQDRIFKHISRNSLIWNKHPGGLFVLPQTSSTLGDFPYYTANLGLKPPSK
FTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTV
LSTTEVDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKTTHYLYSHYLPASLKNMVDQLANCEDILMNF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BAI1_ENST00000517894_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_3774nt
ATGAGGGGCCAGGCCGCCGCCCCGGGCCCCGTCTGGATCCTCGCCCCGCTGCTACTGCTGCTGCTGCTGCTGGGACGCCGCGCGCGGGCG
GCCGCCGGAGCAGACGCGGGGCCCGGGCCCGAGCCGTGCGCCACGCTGGTGCAGGGAAAGTTCTTCGGCTACTTCTCCGCGGCCGCCGTG
TTCCCGGCCAACGCCTCGCGCTGCTCCTGGACGCTACGCAACCCGGACCCGCGGCGCTACACTCTCTACATGAAGGTGGCCAAGGCGCCC
GTGCCCTGCAGCGGCCCCGGCCGCGTGCGCACCTACCAGTTCGACTCCTTCCTCGAGTCCACGCGCACCTACCTGGGCGTGGAGAGCTTC
GACGAGGTGCTGCGGCTCTGCGACCCCTCCGCACCCCTGGCCTTCCTGCAGGCCAGCAAGCAGTTCCTGCAGATGCGGCGCCAGCAGCCG
CCCCAGCACGACGGGCTCCGGCCCCGGGCCGGGCCGCCGGGCCCCACCGACGACTTCTCCGTGGAGTACCTGGTGGTGGGGAACCGCAAC
CCCAGCCGTGCCGCCTGCCAGATGCTGTGCCGCTGGCTGGACGCGTGTCTGGCCGGTAGTCGCAGCTCGCACCCCTGCGGGATCATGCAG
ACCCCCTGCGCCTGCCTGGGCGGCGAGGCGGGCGGCCCTGCCGCGGGACCCCTGGCCCCCCGCGGGGATGTCTGCTTGAGAGATGCGGTG
GCTGGTGGCCCTGAAAACTGCCTCACCAGCCTGACCCAGGACCGGGGCGGGCACGGCGCCACAGGCGGCTGGAAGCTGTGGTCCCTGTGG
GGCGAATGCACGCGGGACTGCGGGGGAGGCCTCCAGACGCGGACGCGCACCTGCCTGCCCGCGCCGGGCGTGGAGGGCGGCGGCTGCGAG
GGGGTGCTGGAGGAGGGTCGCCAGTGCAACCGCGAGGCCTGCGGCCCCGCTGGGCGCACCAGCTCCCGGAGCCAGTCCCTGCGGTCCACA
GATGCCCGGCGGCGCGAGGAGCTGGGGGACGAGCTGCAGCAGTTTGGGTTCCCAGCCCCCCAGACCGGTGACCCAGCAGCCGAGGAGTGG
TCCCCGTGGAGCGTGTGCTCCAGCACCTGCGGCGAGGGCTGGCAGACCCGCACGCGCTTCTGCGTGTCCTCCTCCTACAGCACGCAGTGC
AGCGGACCCCTGCGCGAGCAGCGGCTGTGCAACAACTCTGCCGTGTGCCCAGTGCATGGTGCCTGGGATGAGTGGTCGCCCTGGAGCCTC
TGCTCCAGCACCTGTGGCCGTGGCTTTCGGGATCGCACGCGCACCTGCAGGCCCCCCCAGTTTGGGGGCAACCCCTGTGAGGGCCCTGAG
AAGCAAACCAAGTTCTGCAACATTGCCCTGTGCCCTGGCCGGGCAGTGGATGGAAACTGGAATGAGTGGTCGAGCTGGAGCGCCTGCTCC
GCCAGCTGCTCCCAGGGCCGACAGCAGCGCACGCGTGAATGCAACGGGCCTTCCTACGGGGGTGCGGAGTGCCAGGGCCACTGGGTGGAG
ACCCGAGACTGCTTCCTGCAGCAGTGCCCAGTGGATGGCAAGTGGCAGGCCTGGGCGTCATGGGGCAGTTGCAGCGTCACGTGTGGGGCT
GGCAGCCAGCGACGGGAGCGTGTCTGCTCTGGGCCCTTCTTCGGGGGAGCAGCCTGCCAGGGCCCCCAGGATGAGTACCGGCAGTGCGGC
ACCCAGCGGTGTCCCGAGCCCCATGAGATCTGTGATGAGGACAACTTTGGTGCTGTGATCTGGAAGGAGACCCCAGCGGGAGAGGTGGCT
GCTGTCCGGTGTCCCCGCAACGCCACAGGACTCATCCTGCGACGGTGTGAGCTGGACGAGGAAGGCATCGCCTACTGGGAGCCCCCCACC
TACATCCGCTGTGTTTCCATTGACTACAGAAACATCCAGATGATGACCCGGGAGCACCTGGCCAAGGCTCAGCGAGGGCTGCCTGGGGAG
GGGGTCTCGGAGGTCATCCAGACACTGGTGGAGATCTCTCAGGACGGGACCAGCTACAGTGGGGACCTGCTGTCCACCATCGATGTCCTG
AGGAACATGACAGAGATTTTCCGGAGAGCGTACTACAGCCCCACCCCTGGGGACGTACAGAACTTTGTCCAGATCCTTAGCAACCTGTTG
GCAGAGGAGAATCGGGACAAGTGGGAGGAGGCCCAGCTGGCGGGCCCCAACGCCAAGGAGCTGTTCCGGCTGGTGGAGGACTTTGTGGAC
GTCATCGGCTTCCGCATGAAGGACCTGAGGGATGCATACCAGGTGACAGACAACCTGGTTCTCAGCATCCATAAGCTCCCAGCCAGCGGA
GCCACTGACATCAGCTTCCCCATGAAGGGCTGGCGGGCCACGGGTGACTGGGCCAAGGTGCCAGAGGACAGGGTCACTGTGTCCAAGAGT
GTCTTCTCCACGGGGCTGACAGAGGCCGATGAAGCATCCGTGTTTGTGGTGGGCACCGTGCTCTACAGGAACCTGGGCAGCTTCCTGGCC
CTGCAGAGGAACACGACCGTCCTGAATTCTAAGGTGATCTCCGTGACTGTGAAACCCCCGCCTCGCTCCCTGCGCACACCCTTGGAGATC
GAGTTTGCCCACATGTATAATGGCACCACCAACCAGACCTGTATCCTGTGGGATGAGACGGATGTACCCTCCTCCTCCGCCCCCCCGCAG
CTCGGGCCCTGGTCGTGGCGCGGCTGCCGCACGGTGCCCCTCGACGCCCTCCGGACGCGCTGCCTCTGTGACCGGCTCTCCACCTTCGCC
ATCTTAGCCCAGCTCAGCGCCGACGCGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCT
GGAGGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAA
TTCACTGCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTAC
TGTGCCCAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATT
GAAGGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTG
CTTTCAACAACAGAGGTGGATTTCGCCTTCACAGTGTGGCAGAGCTTCCCTGAGAGGATTGTGGGGTACCCCGCGCGCAGCCACTTCTGG
GATAACTCTAAGGAGCGGTGGGGATACACATCAAAGTGGACGAACGACTACTCCATGGTGTTGACAGGAGCTGCTATTTACCACAAATAT
TATCACTACCTATACTCCCATTACCTGCCAGCCAGCCTGAAGAACATGGTGGACCAATTGGCCAATTGTGAGGACATTCTCATGAACTTC
CTGGTGTCTGCTGTGACAAAATTGCCTCCAATCAAAGTGACCCAGAAGAAGCAGTATAAGGAGACAATGATGGGACAGACTTCTCGGGCT
TCCCGTTGGGCTGACCCTGACCACTTTGCCCAGCGACAGAGCTGCATGAATACGTTTGCCAGCTGGTTTGGCTACATGCCGCTGATCCAC

>In-frame_BAI1_ENST00000323289_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_3774nt
ATGAGGGGCCAGGCCGCCGCCCCGGGCCCCGTCTGGATCCTCGCCCCGCTGCTACTGCTGCTGCTGCTGCTGGGACGCCGCGCGCGGGCG
GCCGCCGGAGCAGACGCGGGGCCCGGGCCCGAGCCGTGCGCCACGCTGGTGCAGGGAAAGTTCTTCGGCTACTTCTCCGCGGCCGCCGTG
TTCCCGGCCAACGCCTCGCGCTGCTCCTGGACGCTACGCAACCCGGACCCGCGGCGCTACACTCTCTACATGAAGGTGGCCAAGGCGCCC
GTGCCCTGCAGCGGCCCCGGCCGCGTGCGCACCTACCAGTTCGACTCCTTCCTCGAGTCCACGCGCACCTACCTGGGCGTGGAGAGCTTC
GACGAGGTGCTGCGGCTCTGCGACCCCTCCGCACCCCTGGCCTTCCTGCAGGCCAGCAAGCAGTTCCTGCAGATGCGGCGCCAGCAGCCG
CCCCAGCACGACGGGCTCCGGCCCCGGGCCGGGCCGCCGGGCCCCACCGACGACTTCTCCGTGGAGTACCTGGTGGTGGGGAACCGCAAC
CCCAGCCGTGCCGCCTGCCAGATGCTGTGCCGCTGGCTGGACGCGTGTCTGGCCGGTAGTCGCAGCTCGCACCCCTGCGGGATCATGCAG
ACCCCCTGCGCCTGCCTGGGCGGCGAGGCGGGCGGCCCTGCCGCGGGACCCCTGGCCCCCCGCGGGGATGTCTGCTTGAGAGATGCGGTG
GCTGGTGGCCCTGAAAACTGCCTCACCAGCCTGACCCAGGACCGGGGCGGGCACGGCGCCACAGGCGGCTGGAAGCTGTGGTCCCTGTGG
GGCGAATGCACGCGGGACTGCGGGGGAGGCCTCCAGACGCGGACGCGCACCTGCCTGCCCGCGCCGGGCGTGGAGGGCGGCGGCTGCGAG
GGGGTGCTGGAGGAGGGTCGCCAGTGCAACCGCGAGGCCTGCGGCCCCGCTGGGCGCACCAGCTCCCGGAGCCAGTCCCTGCGGTCCACA
GATGCCCGGCGGCGCGAGGAGCTGGGGGACGAGCTGCAGCAGTTTGGGTTCCCAGCCCCCCAGACCGGTGACCCAGCAGCCGAGGAGTGG
TCCCCGTGGAGCGTGTGCTCCAGCACCTGCGGCGAGGGCTGGCAGACCCGCACGCGCTTCTGCGTGTCCTCCTCCTACAGCACGCAGTGC
AGCGGACCCCTGCGCGAGCAGCGGCTGTGCAACAACTCTGCCGTGTGCCCAGTGCATGGTGCCTGGGATGAGTGGTCGCCCTGGAGCCTC
TGCTCCAGCACCTGTGGCCGTGGCTTTCGGGATCGCACGCGCACCTGCAGGCCCCCCCAGTTTGGGGGCAACCCCTGTGAGGGCCCTGAG
AAGCAAACCAAGTTCTGCAACATTGCCCTGTGCCCTGGCCGGGCAGTGGATGGAAACTGGAATGAGTGGTCGAGCTGGAGCGCCTGCTCC
GCCAGCTGCTCCCAGGGCCGACAGCAGCGCACGCGTGAATGCAACGGGCCTTCCTACGGGGGTGCGGAGTGCCAGGGCCACTGGGTGGAG
ACCCGAGACTGCTTCCTGCAGCAGTGCCCAGTGGATGGCAAGTGGCAGGCCTGGGCGTCATGGGGCAGTTGCAGCGTCACGTGTGGGGCT
GGCAGCCAGCGACGGGAGCGTGTCTGCTCTGGGCCCTTCTTCGGGGGAGCAGCCTGCCAGGGCCCCCAGGATGAGTACCGGCAGTGCGGC
ACCCAGCGGTGTCCCGAGCCCCATGAGATCTGTGATGAGGACAACTTTGGTGCTGTGATCTGGAAGGAGACCCCAGCGGGAGAGGTGGCT
GCTGTCCGGTGTCCCCGCAACGCCACAGGACTCATCCTGCGACGGTGTGAGCTGGACGAGGAAGGCATCGCCTACTGGGAGCCCCCCACC
TACATCCGCTGTGTTTCCATTGACTACAGAAACATCCAGATGATGACCCGGGAGCACCTGGCCAAGGCTCAGCGAGGGCTGCCTGGGGAG
GGGGTCTCGGAGGTCATCCAGACACTGGTGGAGATCTCTCAGGACGGGACCAGCTACAGTGGGGACCTGCTGTCCACCATCGATGTCCTG
AGGAACATGACAGAGATTTTCCGGAGAGCGTACTACAGCCCCACCCCTGGGGACGTACAGAACTTTGTCCAGATCCTTAGCAACCTGTTG
GCAGAGGAGAATCGGGACAAGTGGGAGGAGGCCCAGCTGGCGGGCCCCAACGCCAAGGAGCTGTTCCGGCTGGTGGAGGACTTTGTGGAC
GTCATCGGCTTCCGCATGAAGGACCTGAGGGATGCATACCAGGTGACAGACAACCTGGTTCTCAGCATCCATAAGCTCCCAGCCAGCGGA
GCCACTGACATCAGCTTCCCCATGAAGGGCTGGCGGGCCACGGGTGACTGGGCCAAGGTGCCAGAGGACAGGGTCACTGTGTCCAAGAGT
GTCTTCTCCACGGGGCTGACAGAGGCCGATGAAGCATCCGTGTTTGTGGTGGGCACCGTGCTCTACAGGAACCTGGGCAGCTTCCTGGCC
CTGCAGAGGAACACGACCGTCCTGAATTCTAAGGTGATCTCCGTGACTGTGAAACCCCCGCCTCGCTCCCTGCGCACACCCTTGGAGATC
GAGTTTGCCCACATGTATAATGGCACCACCAACCAGACCTGTATCCTGTGGGATGAGACGGATGTACCCTCCTCCTCCGCCCCCCCGCAG
CTCGGGCCCTGGTCGTGGCGCGGCTGCCGCACGGTGCCCCTCGACGCCCTCCGGACGCGCTGCCTCTGTGACCGGCTCTCCACCTTCGCC
ATCTTAGCCCAGCTCAGCGCCGACGCGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCT
GGAGGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAA
TTCACTGCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTAC
TGTGCCCAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATT
GAAGGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTG
CTTTCAACAACAGAGGTGGATTTCGCCTTCACAGTGTGGCAGAGCTTCCCTGAGAGGATTGTGGGGTACCCCGCGCGCAGCCACTTCTGG
GATAACTCTAAGGAGCGGTGGGGATACACATCAAAGTGGACGAACGACTACTCCATGGTGTTGACAGGAGCTGCTATTTACCACAAATAT
TATCACTACCTATACTCCCATTACCTGCCAGCCAGCCTGAAGAACATGGTGGACCAATTGGCCAATTGTGAGGACATTCTCATGAACTTC
CTGGTGTCTGCTGTGACAAAATTGCCTCCAATCAAAGTGACCCAGAAGAAGCAGTATAAGGAGACAATGATGGGACAGACTTCTCGGGCT
TCCCGTTGGGCTGACCCTGACCACTTTGCCCAGCGACAGAGCTGCATGAATACGTTTGCCAGCTGGTTTGGCTACATGCCGCTGATCCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BAI1_ENST00000517894_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_9890nt
GATGTAATCCGTAATGCAGTCTCTGGCTCCCGATTCGGGATCCAGTTTCAGAGAGCGAGAGATTGGGGAGCGCCGGCAGCCGGGTGGGGG
GAAGCAGCTCTCGCCTCTCTCCTCCTCCTTCTCCTCGTCCTCGGCCTCCTCCTCCTCCCCGCGCCGCCCCGCCCCCGGCTCGGCTTGGCT
CGCCCCCCCCCCCCCCTCGCCAGGAAGGGGAAAAAAGGCGAGAAGAGCCGGGCAGGCGAGAGGAGCGGAGCGGCGGCGGCGGCCGGAGAG
GGAGCGGCGGGCGCAGGCGGCGGCGGCGGGCGCGGCGTTGGCGGCGGCCCCGGCGGAGCGAGCGCGGAGCCGGAGAGCCGGGAGCACAGG
CGGCCGCGCCGCGTCCTGGCCCGGCCCGGGCCCGCGCGCCAGCATCGTCCGCAGCGCGGGCATCCGGACCCTCCGGGCGCCCGGGGGGCT
CCAGCAGGCGCGGGGGAACGGGAGGGGGCCTGCGTGCGCCGGCGGGTGCTCTCCAGGGGGCGTCCCGGCGAGGCCCAGAGCGGGCCGGGG
GCGGCGGCGGCTGGAGGAGCCCCCCCCACCTCCGGTCGGGCGCCCGGCTCAGCCGCCGGCGACGCGAGGCGCTCGCGGGGATTTGCAACT
CGCCGGATCGAGTCCTCGCCGGCGGGGCCGCTGCTGCTGGGGAAGCTGCTGCTGGTGGCCACAGGCTGGCACCAGGGCCCTGGACTTTAG
AAGCCGTTGCTGCCCTCTCTGTCACCTGAAGCGGGGCCCTCTCCCATCCCACCCTTGCCCCGCCTCCCTGCCCCCACCGGGCCGGCCCTG
CCCGCCGCCGGACCCTGGCATGTCAAGACCTGGTCCGCGCCTGCCTGCCCAGCCCGCGGAACCCCGGCGGCCCCGCGAGCTAGGATGAGG
GGCCAGGCCGCCGCCCCGGGCCCCGTCTGGATCCTCGCCCCGCTGCTACTGCTGCTGCTGCTGCTGGGACGCCGCGCGCGGGCGGCCGCC
GGAGCAGACGCGGGGCCCGGGCCCGAGCCGTGCGCCACGCTGGTGCAGGGAAAGTTCTTCGGCTACTTCTCCGCGGCCGCCGTGTTCCCG
GCCAACGCCTCGCGCTGCTCCTGGACGCTACGCAACCCGGACCCGCGGCGCTACACTCTCTACATGAAGGTGGCCAAGGCGCCCGTGCCC
TGCAGCGGCCCCGGCCGCGTGCGCACCTACCAGTTCGACTCCTTCCTCGAGTCCACGCGCACCTACCTGGGCGTGGAGAGCTTCGACGAG
GTGCTGCGGCTCTGCGACCCCTCCGCACCCCTGGCCTTCCTGCAGGCCAGCAAGCAGTTCCTGCAGATGCGGCGCCAGCAGCCGCCCCAG
CACGACGGGCTCCGGCCCCGGGCCGGGCCGCCGGGCCCCACCGACGACTTCTCCGTGGAGTACCTGGTGGTGGGGAACCGCAACCCCAGC
CGTGCCGCCTGCCAGATGCTGTGCCGCTGGCTGGACGCGTGTCTGGCCGGTAGTCGCAGCTCGCACCCCTGCGGGATCATGCAGACCCCC
TGCGCCTGCCTGGGCGGCGAGGCGGGCGGCCCTGCCGCGGGACCCCTGGCCCCCCGCGGGGATGTCTGCTTGAGAGATGCGGTGGCTGGT
GGCCCTGAAAACTGCCTCACCAGCCTGACCCAGGACCGGGGCGGGCACGGCGCCACAGGCGGCTGGAAGCTGTGGTCCCTGTGGGGCGAA
TGCACGCGGGACTGCGGGGGAGGCCTCCAGACGCGGACGCGCACCTGCCTGCCCGCGCCGGGCGTGGAGGGCGGCGGCTGCGAGGGGGTG
CTGGAGGAGGGTCGCCAGTGCAACCGCGAGGCCTGCGGCCCCGCTGGGCGCACCAGCTCCCGGAGCCAGTCCCTGCGGTCCACAGATGCC
CGGCGGCGCGAGGAGCTGGGGGACGAGCTGCAGCAGTTTGGGTTCCCAGCCCCCCAGACCGGTGACCCAGCAGCCGAGGAGTGGTCCCCG
TGGAGCGTGTGCTCCAGCACCTGCGGCGAGGGCTGGCAGACCCGCACGCGCTTCTGCGTGTCCTCCTCCTACAGCACGCAGTGCAGCGGA
CCCCTGCGCGAGCAGCGGCTGTGCAACAACTCTGCCGTGTGCCCAGTGCATGGTGCCTGGGATGAGTGGTCGCCCTGGAGCCTCTGCTCC
AGCACCTGTGGCCGTGGCTTTCGGGATCGCACGCGCACCTGCAGGCCCCCCCAGTTTGGGGGCAACCCCTGTGAGGGCCCTGAGAAGCAA
ACCAAGTTCTGCAACATTGCCCTGTGCCCTGGCCGGGCAGTGGATGGAAACTGGAATGAGTGGTCGAGCTGGAGCGCCTGCTCCGCCAGC
TGCTCCCAGGGCCGACAGCAGCGCACGCGTGAATGCAACGGGCCTTCCTACGGGGGTGCGGAGTGCCAGGGCCACTGGGTGGAGACCCGA
GACTGCTTCCTGCAGCAGTGCCCAGTGGATGGCAAGTGGCAGGCCTGGGCGTCATGGGGCAGTTGCAGCGTCACGTGTGGGGCTGGCAGC
CAGCGACGGGAGCGTGTCTGCTCTGGGCCCTTCTTCGGGGGAGCAGCCTGCCAGGGCCCCCAGGATGAGTACCGGCAGTGCGGCACCCAG
CGGTGTCCCGAGCCCCATGAGATCTGTGATGAGGACAACTTTGGTGCTGTGATCTGGAAGGAGACCCCAGCGGGAGAGGTGGCTGCTGTC
CGGTGTCCCCGCAACGCCACAGGACTCATCCTGCGACGGTGTGAGCTGGACGAGGAAGGCATCGCCTACTGGGAGCCCCCCACCTACATC
CGCTGTGTTTCCATTGACTACAGAAACATCCAGATGATGACCCGGGAGCACCTGGCCAAGGCTCAGCGAGGGCTGCCTGGGGAGGGGGTC
TCGGAGGTCATCCAGACACTGGTGGAGATCTCTCAGGACGGGACCAGCTACAGTGGGGACCTGCTGTCCACCATCGATGTCCTGAGGAAC
ATGACAGAGATTTTCCGGAGAGCGTACTACAGCCCCACCCCTGGGGACGTACAGAACTTTGTCCAGATCCTTAGCAACCTGTTGGCAGAG
GAGAATCGGGACAAGTGGGAGGAGGCCCAGCTGGCGGGCCCCAACGCCAAGGAGCTGTTCCGGCTGGTGGAGGACTTTGTGGACGTCATC
GGCTTCCGCATGAAGGACCTGAGGGATGCATACCAGGTGACAGACAACCTGGTTCTCAGCATCCATAAGCTCCCAGCCAGCGGAGCCACT
GACATCAGCTTCCCCATGAAGGGCTGGCGGGCCACGGGTGACTGGGCCAAGGTGCCAGAGGACAGGGTCACTGTGTCCAAGAGTGTCTTC
TCCACGGGGCTGACAGAGGCCGATGAAGCATCCGTGTTTGTGGTGGGCACCGTGCTCTACAGGAACCTGGGCAGCTTCCTGGCCCTGCAG
AGGAACACGACCGTCCTGAATTCTAAGGTGATCTCCGTGACTGTGAAACCCCCGCCTCGCTCCCTGCGCACACCCTTGGAGATCGAGTTT
GCCCACATGTATAATGGCACCACCAACCAGACCTGTATCCTGTGGGATGAGACGGATGTACCCTCCTCCTCCGCCCCCCCGCAGCTCGGG
CCCTGGTCGTGGCGCGGCTGCCGCACGGTGCCCCTCGACGCCCTCCGGACGCGCTGCCTCTGTGACCGGCTCTCCACCTTCGCCATCTTA
GCCCAGCTCAGCGCCGACGCGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACATCCTGGAGGA
TTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCCAAATTCACT
GCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAGTACTGTGCC
CAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTCATTGAAGGA
GAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACGGTGCTTTCA
ACAACAGAGGTGGATTTCGCCTTCACAGTGTGGCAGAGCTTCCCTGAGAGGATTGTGGGGTACCCCGCGCGCAGCCACTTCTGGGATAAC
TCTAAGGAGCGGTGGGGATACACATCAAAGTGGACGAACGACTACTCCATGGTGTTGACAGGAGCTGCTATTTACCACAAATATTATCAC
TACCTATACTCCCATTACCTGCCAGCCAGCCTGAAGAACATGGTGGACCAATTGGCCAATTGTGAGGACATTCTCATGAACTTCCTGGTG
TCTGCTGTGACAAAATTGCCTCCAATCAAAGTGACCCAGAAGAAGCAGTATAAGGAGACAATGATGGGACAGACTTCTCGGGCTTCCCGT
TGGGCTGACCCTGACCACTTTGCCCAGCGACAGAGCTGCATGAATACGTTTGCCAGCTGGTTTGGCTACATGCCGCTGATCCACTCTCAG
ATGAGGCTCGACCCCGTCCTCTTTAAAGACCAGGTCTCTATTTTGAGGAAGAAATACCGAGACATTGAGCGACTTTGAGGAATCCGGCTG
AGTGGGGGAGGGGAAGCAAGAAGGGATGGGGGTCAAGCTGCTCTCTCTTCCCAGTGCAGATCCACTCATCAGCAGAGCCAGATTGTGCCA
ACTATCCAAAAACTTAGATGAGCAGAATGACAAAAAAAAAAAGGCCAATGAGAACTCAACTCCTGGCTCCTGGGACTGCACCAGACTGCT
CCAAACTCACCTCACTGGCTTCTGTGTCCCAAGACTAGGTTGTGTACAGTTTAATTATGGAACATTAAATAATTATTTTTGAAATGATTG
CTATGCAGGTTTAAACTTTTTTAATGATCAAAACTATTAAAAACCAGAGTTCTTTGTTTAATCAAAATTGTGTTGGTTGTGAATATTTCA
AAGCTGCTATTCCTTTTCCCACAGACATCATTGTCATGGCCATGTAGGGTGCCCTGCAGTTTCAAAAGCTCAAACTTCGTGGAAAACACA
ATAAGTCACTCTACCCATTATCAAGAAATAACTGAGCATAAGTTGTAACTTCATTATTCAACTTTGCCAGTGCAAATTGTTTTCCACTTC
GAATCTTCAAATCCACTTGAACTTTTATCTCTAAAATGTCGCTGCATGAAAGAAAGTATTACGACTTCCAGGTAGGCAGTTCTAACTGAA
ATCTCTATGTTTGAGATAGATATATATGATAATCGTTTTTCATTGGGGGGGTGGGGGGAATTAGTACCAAGAAAACACTAGTATAATTAA
GAAATGTTCAGTTTGCACAAAGAACTATCCAGATAACCCACCAGCATGTTAGTGAGATGGAAATACAGACCCACAACAGTAACCCAATAC
TTGCAGGGGTTGGGGGCACGGTTATAGATTCAACCATTGACCTAAGTCTGCGTAGCACTGGGAAGAGGCTTTGGTTTAGAAGCCAAGGAA
TAATGAGTATATTGGGGAGAACAGATTATTTACAAGATGAACTCTTTAATGTTTGTGAGAATCTCAAGTTTCAGAGTTTCTCTTTTGAGA
AAGAAAAAGGGGTAATAAGGTAGAAATTCACACCAATGAACAAGAGGATTGCTGCAAAGTAACTGAGGAGATGTCTCGCCATTGGGACCC
TAATGCCATTTTTGGTCAAACATTGTTTTGAGCAAGAATCTGGCAAACAAAATAATCAACAACAAATGTGAATATAGTTTCATTTACTTT
TAATTTTTAAATCTGTGGAAAAGTTTAGTTGTGCTTCTTGTTAAAAAGAACATTTCTATCCCTGAAAATGCTATCTTGGGCTTATGATTA
TTGTTAAACTCCAAGTATAAACTGAAAAAAAAAACATATCCCTAACTCTGTTATGAAAAATGGAGACTTCTGATATTAAATGCTTTCTTC
TACTTGGAAGAGGCCAGAGAAAACAGGGAAGAGAAAGACATTATTGAGTTTGACCATGTATTATGCTGAATAAACAATAAGCACTTTAGA
GTCCCTCCCTCAAACTCTCATACATTTCATATTTCTTTTCCATTTATTTTCAGTTTTGTTTTAGAAGAAAAGTTCATCAGAGAATTTTGT
TCTGATAATTTCAAGTGGCCATCTTAGGTCAGTGGAAACCGTAAGTCCATTGGACTTTACCTCATCCTTTCTTTGTAGACATCTGGGAGA
GGAAGAGGAGCTTGTAATGATAGCACGGGGATGGTGCTGTAAACAGGAGTGAAAGTGTTTGTGGAAGTCCAGAGAAGTGACTCAACAGGC
TACCTAGCTGCAGAACAAGGAGTAGAGCCCACATATCCAGATGGTGTTTTGAGAGGTGCGTAGACAGTGAAATTCAATTAAAGAGAGGAT
TTTCTCCTCAGCCTCATGACTCAGAACAGCTCCCTAAATACCTCTCTCATCTAATTGGACCCATCCATAGTCCATTCTCAAACATGTGAC
ATTTTCCCCTAAGTAGATGTGATTATCTCTTAGGCATTTGTTGAAAAATAATTCTTAGGTCCATGGTGCTTGCACTTGTGTCTTTTCTAT
AAAATGTTTGGTCTTACAGGTTTCATGTCATTTAAGCTGCACTTCTCAGCAAGTTAAAAGATTAGCAGTTAATCTTTATTCATTTGGCCT
TTGTGAATTTGTATTTAAATTATTTTTTTCAGGATTGGCAAATTATTCTTGTTTCTCCTTTACCAAAAAATAAATGCGATATTTTGTTCA
ATGACCCCAAAACCAACTTGAAACTTAGGTGGTCATATTGGCTTGCAAAGCAATGTCCCTAATTGTACCAGTCAGTCACACAAGTGGATT
CAAGGACCTGCTTTGCCAGATTGACCTGTCACCAAGCTCACAACACATATCCTCCACAAACAACATGTGTTATGTGAAGAAAAATGGTAA
TTATAAATAAGAACAGGATATAACACACCTTTCATCCACTTTAAATCTCCACAGTTTCATTTTATGTCATTCTCTGAGCAAATCTCTTTG
GGATGTGAGCTAGCGTGTTCTTCTCCCATTTGGAATATAAGGCTGGGAATAGAACAATGCTTAACAAATCAGTGAAGCTCGACAGTAATA
TGTAATTTTAATTCAGTTAGGAAAGAGTTGTATTGCATTGCAACAAGTTGACAAATCATAGCCATCTCTGTAGGGTGTCAGGAATTATCT
CCTGGTCAACTTTAATGATAACTAGGGGTCCCTAAGTGGGCTAACATGTGCTGCATTGGAGAGAAGCCAAGGGCTGAGAGTACAGTGCCA
ACCACGTAATGAATTGCTTGCAGAAATTCCAAAGAGGACTCAGCCACTTATGGATTTCCACACAGCATCTTTTCCCAGCTCCACATTAAG
ACACAGGATCTTAAAAGTAATTTTTTAAAAGCTGGCTGTGTATTTATTTATATGAAAGTGTTATAAATATCAAAGCTTACAAATACATTA
ATACATATCACCTTTGTTGAAGCTAGCAAAATGGCTCAAAATTGAGACTGTAGAGAAAAATCCATGAAATAATCACGATAGTCATACCAC
AAAAGATAGCATAGCTAGGTGGGCCTACCTGGTCGTATCAACACACTTTCAGATAGATGCTTCAAAAAAAAAGGGAAAGCTTGTTACTGG
AATCTTATGTGCATTACAGTTTAATTTCTTCTTGTGACAAATGGTGCTCAAAGAAGGATCAATCCGGTTGCATCCTTCAATTTCCCTTTT
AGAATGACTTTTGGTTTTCATTACAGTAGGCTATGTTAGCCTTTATTTTGGTGGTTCTCAAATACCTGGTGACTTGAAAGAGTATTATGC
TGGTGGCCTTTCATAAAGGTTACTGAACTTTAATCAGGGGTGAGATGAATGAATGTGAATAGGCCTATATACTATTTTTTTTAATTAAAA
AAAAAAAAAACAGGGCACTTGATTTAAGAACAAACCTGTTTAAAGGGCAGGATCAGGGGGAAGACAGCCTTACTAGGTTGGAATCTGAAT
GAGATTCTTGCTGGACAAGGCTGAATTATGGATGCAAAAGCCAAGCAAACTTCCCAGACCTGGAAGTGTCTTGTGTTCCCTTGGGTCTCT
TGAGATCTCCAGTATTTAAAAGTAGCAGTTATTGCCATGAACTCTCAAATAAAAATGCTCCTGCCTCTTACTTGTGAATATAATCAACAT
GCAGCCAGTACATCAGGACCGCAGTTGCTGAATTCATTTACCTAGTTCCCCTTTACAGCGACTATGGACAAGAACCTTTCAGTTGGTTTT
GTCATTCTTGGCCAGATTTAACCAAGAAATTTCTTTCACTATCAGCCTCATTTTCTCAGGCATGCTTACAGGGACAAAGTTGTTTTGAGT
TGAGTTCTCAGCAAATAAGCATTAATATCAAACTGTGCTAAACTTGTCTCACTTGGTATAAGAACTTCAGCATAAAGAGATTAGTTTATC
CTTTGACACCAAGTCTTTTTTTTTTCTTTGAGACAGAGTCTTGCCCTGTCACCCAGGCTGGAATGCATTGGTGTGATCTCAGCTCAGTCA
CTGCAACCTCCGCCTCCCCGGTTCAAGCAATTCTCCTGCCTCACCCTGCTTAGTAGTTGGGATTACAGGCATGTGCTACCACACTGGGCT
AATTTTTGTATATTTATTAGAGACAGGGTTTTGCTATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCACCTGCCTCTGC
CTCCCAAAGTGCTGAGATTACAGGTGTAAGCCACTGCGCCTGGCCCCCCTTTTTTTTTTCTTTAAAAAAAAAAAAAAGCTTGGGGGATTA
AGTACCCTAAGATAGTGGTCTCTCCCATCAGTTCAATAATGCTGTACAGAACCTCTGGATAAAAAAGCTGTTATTTACACCATAATTGTG
ATGATGGATTTGACTCCTCAAAACCATCTCTCCCCTTTTTGCCCTTTCCAAAAATCAAAGGCTTTTGTCTCCATGAGTTTTACCTAGTAG
GGATTGTAGTTGTCACTGGTCTAGAGTTCCAATACATTTTATATCAGGAACCTCAGTGAGCTACCCAGAATTGGAACTTAACATGGCCCA
GCAACTAGGAGAAGAAGGCAAACCTTGAGAAAGCTGAGCCCTCAGGATAGCACAGTCTCACCCTTGTTTAAAATCAAGTCAGGCTAGCCT
TTCAGTCACTCTGGTTTTGTAATGATTTGCCTTTTAGGCCTCAGGCCATTTGATTTCTGCAATAGTTTTCTGTTCTTCTCCTACAGGAAT
ACATCCCTGTCCTTTCGGTTGTAACTATTACTAAAACTAGGGCTATGCAAATGACCTGGTTACCATGTAATGAACCTTGTGTACTTATTT
TGAGAGAACAATATGTATAGGATATGTTGAGGGGCAGAAAGAAAGACATCAAAAACTGGAACTATTTTAGGTGGCAAATTGTAACGCAAA
AAACAAAAGTATACCTTATTTTGTATACGATGTACACTTGGGACAGAGTTTTCTAATATGTTGCCAATGTTTTTGTAGTGTCACCACAGG
TCTTTTCTGAAGTGTTTTTCCCATTTGTTATAGAGTATTAATGACTTAGCGTAATTAAGCCCTCAAGTATGTGTGAGAGAGCGCGTGTGA
GAAAATACAAAGCCATAGATATTGATTTACTTCACTGACCTGTGTAACTTTATGTCTGGGTTTCGCCATCCAAGATAGATTGTTTTATAG

>In-frame_BAI1_ENST00000323289_chr8_143592434_+_EXT1_ENST00000378204_chr8_118834836_-_9179nt
GGACTTTAGAAGCCGTTGCTGCCCTCTCTGTCACCTGAAGCGGGGCCCTCTCCCATCCCACCCTTGCCCCGCCTCCCTGCCCCCACCGGG
CCGGCCCTGCCCGCCGCCGGACCCTGGCATGTCAAGACCTGGTCCGCGCCTGCCTGCCCAGCCCGCGGAACCCCGGCGGCCCCGCGAGCT
AGGATGAGGGGCCAGGCCGCCGCCCCGGGCCCCGTCTGGATCCTCGCCCCGCTGCTACTGCTGCTGCTGCTGCTGGGACGCCGCGCGCGG
GCGGCCGCCGGAGCAGACGCGGGGCCCGGGCCCGAGCCGTGCGCCACGCTGGTGCAGGGAAAGTTCTTCGGCTACTTCTCCGCGGCCGCC
GTGTTCCCGGCCAACGCCTCGCGCTGCTCCTGGACGCTACGCAACCCGGACCCGCGGCGCTACACTCTCTACATGAAGGTGGCCAAGGCG
CCCGTGCCCTGCAGCGGCCCCGGCCGCGTGCGCACCTACCAGTTCGACTCCTTCCTCGAGTCCACGCGCACCTACCTGGGCGTGGAGAGC
TTCGACGAGGTGCTGCGGCTCTGCGACCCCTCCGCACCCCTGGCCTTCCTGCAGGCCAGCAAGCAGTTCCTGCAGATGCGGCGCCAGCAG
CCGCCCCAGCACGACGGGCTCCGGCCCCGGGCCGGGCCGCCGGGCCCCACCGACGACTTCTCCGTGGAGTACCTGGTGGTGGGGAACCGC
AACCCCAGCCGTGCCGCCTGCCAGATGCTGTGCCGCTGGCTGGACGCGTGTCTGGCCGGTAGTCGCAGCTCGCACCCCTGCGGGATCATG
CAGACCCCCTGCGCCTGCCTGGGCGGCGAGGCGGGCGGCCCTGCCGCGGGACCCCTGGCCCCCCGCGGGGATGTCTGCTTGAGAGATGCG
GTGGCTGGTGGCCCTGAAAACTGCCTCACCAGCCTGACCCAGGACCGGGGCGGGCACGGCGCCACAGGCGGCTGGAAGCTGTGGTCCCTG
TGGGGCGAATGCACGCGGGACTGCGGGGGAGGCCTCCAGACGCGGACGCGCACCTGCCTGCCCGCGCCGGGCGTGGAGGGCGGCGGCTGC
GAGGGGGTGCTGGAGGAGGGTCGCCAGTGCAACCGCGAGGCCTGCGGCCCCGCTGGGCGCACCAGCTCCCGGAGCCAGTCCCTGCGGTCC
ACAGATGCCCGGCGGCGCGAGGAGCTGGGGGACGAGCTGCAGCAGTTTGGGTTCCCAGCCCCCCAGACCGGTGACCCAGCAGCCGAGGAG
TGGTCCCCGTGGAGCGTGTGCTCCAGCACCTGCGGCGAGGGCTGGCAGACCCGCACGCGCTTCTGCGTGTCCTCCTCCTACAGCACGCAG
TGCAGCGGACCCCTGCGCGAGCAGCGGCTGTGCAACAACTCTGCCGTGTGCCCAGTGCATGGTGCCTGGGATGAGTGGTCGCCCTGGAGC
CTCTGCTCCAGCACCTGTGGCCGTGGCTTTCGGGATCGCACGCGCACCTGCAGGCCCCCCCAGTTTGGGGGCAACCCCTGTGAGGGCCCT
GAGAAGCAAACCAAGTTCTGCAACATTGCCCTGTGCCCTGGCCGGGCAGTGGATGGAAACTGGAATGAGTGGTCGAGCTGGAGCGCCTGC
TCCGCCAGCTGCTCCCAGGGCCGACAGCAGCGCACGCGTGAATGCAACGGGCCTTCCTACGGGGGTGCGGAGTGCCAGGGCCACTGGGTG
GAGACCCGAGACTGCTTCCTGCAGCAGTGCCCAGTGGATGGCAAGTGGCAGGCCTGGGCGTCATGGGGCAGTTGCAGCGTCACGTGTGGG
GCTGGCAGCCAGCGACGGGAGCGTGTCTGCTCTGGGCCCTTCTTCGGGGGAGCAGCCTGCCAGGGCCCCCAGGATGAGTACCGGCAGTGC
GGCACCCAGCGGTGTCCCGAGCCCCATGAGATCTGTGATGAGGACAACTTTGGTGCTGTGATCTGGAAGGAGACCCCAGCGGGAGAGGTG
GCTGCTGTCCGGTGTCCCCGCAACGCCACAGGACTCATCCTGCGACGGTGTGAGCTGGACGAGGAAGGCATCGCCTACTGGGAGCCCCCC
ACCTACATCCGCTGTGTTTCCATTGACTACAGAAACATCCAGATGATGACCCGGGAGCACCTGGCCAAGGCTCAGCGAGGGCTGCCTGGG
GAGGGGGTCTCGGAGGTCATCCAGACACTGGTGGAGATCTCTCAGGACGGGACCAGCTACAGTGGGGACCTGCTGTCCACCATCGATGTC
CTGAGGAACATGACAGAGATTTTCCGGAGAGCGTACTACAGCCCCACCCCTGGGGACGTACAGAACTTTGTCCAGATCCTTAGCAACCTG
TTGGCAGAGGAGAATCGGGACAAGTGGGAGGAGGCCCAGCTGGCGGGCCCCAACGCCAAGGAGCTGTTCCGGCTGGTGGAGGACTTTGTG
GACGTCATCGGCTTCCGCATGAAGGACCTGAGGGATGCATACCAGGTGACAGACAACCTGGTTCTCAGCATCCATAAGCTCCCAGCCAGC
GGAGCCACTGACATCAGCTTCCCCATGAAGGGCTGGCGGGCCACGGGTGACTGGGCCAAGGTGCCAGAGGACAGGGTCACTGTGTCCAAG
AGTGTCTTCTCCACGGGGCTGACAGAGGCCGATGAAGCATCCGTGTTTGTGGTGGGCACCGTGCTCTACAGGAACCTGGGCAGCTTCCTG
GCCCTGCAGAGGAACACGACCGTCCTGAATTCTAAGGTGATCTCCGTGACTGTGAAACCCCCGCCTCGCTCCCTGCGCACACCCTTGGAG
ATCGAGTTTGCCCACATGTATAATGGCACCACCAACCAGACCTGTATCCTGTGGGATGAGACGGATGTACCCTCCTCCTCCGCCCCCCCG
CAGCTCGGGCCCTGGTCGTGGCGCGGCTGCCGCACGGTGCCCCTCGACGCCCTCCGGACGCGCTGCCTCTGTGACCGGCTCTCCACCTTC
GCCATCTTAGCCCAGCTCAGCGCCGACGCGATTATTCAGGACAGAATATTCAAGCACATATCACGTAACAGTTTAATATGGAACAAACAT
CCTGGAGGATTGTTCGTACTACCACAGTATTCATCTTATCTGGGAGATTTTCCTTACTACTATGCTAATTTAGGTTTAAAGCCCCCCTCC
AAATTCACTGCAGTCATCCATGCGGTGACCCCCCTGGTCTCTCAGTCCCAGCCAGTGTTGAAGCTTCTCGTGGCTGCAGCCAAGTCCCAG
TACTGTGCCCAGATCATAGTTCTATGGAATTGTGACAAGCCCCTACCAGCCAAACACCGCTGGCCTGCCACTGCTGTGCCTGTCGTCGTC
ATTGAAGGAGAGAGCAAGGTTATGAGCAGCCGTTTTCTGCCCTACGACAACATCATCACAGACGCCGTGCTCAGCCTTGACGAGGACACG
GTGCTTTCAACAACAGAGGTGGATTTCGCCTTCACAGTGTGGCAGAGCTTCCCTGAGAGGATTGTGGGGTACCCCGCGCGCAGCCACTTC
TGGGATAACTCTAAGGAGCGGTGGGGATACACATCAAAGTGGACGAACGACTACTCCATGGTGTTGACAGGAGCTGCTATTTACCACAAA
TATTATCACTACCTATACTCCCATTACCTGCCAGCCAGCCTGAAGAACATGGTGGACCAATTGGCCAATTGTGAGGACATTCTCATGAAC
TTCCTGGTGTCTGCTGTGACAAAATTGCCTCCAATCAAAGTGACCCAGAAGAAGCAGTATAAGGAGACAATGATGGGACAGACTTCTCGG
GCTTCCCGTTGGGCTGACCCTGACCACTTTGCCCAGCGACAGAGCTGCATGAATACGTTTGCCAGCTGGTTTGGCTACATGCCGCTGATC
CACTCTCAGATGAGGCTCGACCCCGTCCTCTTTAAAGACCAGGTCTCTATTTTGAGGAAGAAATACCGAGACATTGAGCGACTTTGAGGA
ATCCGGCTGAGTGGGGGAGGGGAAGCAAGAAGGGATGGGGGTCAAGCTGCTCTCTCTTCCCAGTGCAGATCCACTCATCAGCAGAGCCAG
ATTGTGCCAACTATCCAAAAACTTAGATGAGCAGAATGACAAAAAAAAAAAGGCCAATGAGAACTCAACTCCTGGCTCCTGGGACTGCAC
CAGACTGCTCCAAACTCACCTCACTGGCTTCTGTGTCCCAAGACTAGGTTGTGTACAGTTTAATTATGGAACATTAAATAATTATTTTTG
AAATGATTGCTATGCAGGTTTAAACTTTTTTAATGATCAAAACTATTAAAAACCAGAGTTCTTTGTTTAATCAAAATTGTGTTGGTTGTG
AATATTTCAAAGCTGCTATTCCTTTTCCCACAGACATCATTGTCATGGCCATGTAGGGTGCCCTGCAGTTTCAAAAGCTCAAACTTCGTG
GAAAACACAATAAGTCACTCTACCCATTATCAAGAAATAACTGAGCATAAGTTGTAACTTCATTATTCAACTTTGCCAGTGCAAATTGTT
TTCCACTTCGAATCTTCAAATCCACTTGAACTTTTATCTCTAAAATGTCGCTGCATGAAAGAAAGTATTACGACTTCCAGGTAGGCAGTT
CTAACTGAAATCTCTATGTTTGAGATAGATATATATGATAATCGTTTTTCATTGGGGGGGTGGGGGGAATTAGTACCAAGAAAACACTAG
TATAATTAAGAAATGTTCAGTTTGCACAAAGAACTATCCAGATAACCCACCAGCATGTTAGTGAGATGGAAATACAGACCCACAACAGTA
ACCCAATACTTGCAGGGGTTGGGGGCACGGTTATAGATTCAACCATTGACCTAAGTCTGCGTAGCACTGGGAAGAGGCTTTGGTTTAGAA
GCCAAGGAATAATGAGTATATTGGGGAGAACAGATTATTTACAAGATGAACTCTTTAATGTTTGTGAGAATCTCAAGTTTCAGAGTTTCT
CTTTTGAGAAAGAAAAAGGGGTAATAAGGTAGAAATTCACACCAATGAACAAGAGGATTGCTGCAAAGTAACTGAGGAGATGTCTCGCCA
TTGGGACCCTAATGCCATTTTTGGTCAAACATTGTTTTGAGCAAGAATCTGGCAAACAAAATAATCAACAACAAATGTGAATATAGTTTC
ATTTACTTTTAATTTTTAAATCTGTGGAAAAGTTTAGTTGTGCTTCTTGTTAAAAAGAACATTTCTATCCCTGAAAATGCTATCTTGGGC
TTATGATTATTGTTAAACTCCAAGTATAAACTGAAAAAAAAAACATATCCCTAACTCTGTTATGAAAAATGGAGACTTCTGATATTAAAT
GCTTTCTTCTACTTGGAAGAGGCCAGAGAAAACAGGGAAGAGAAAGACATTATTGAGTTTGACCATGTATTATGCTGAATAAACAATAAG
CACTTTAGAGTCCCTCCCTCAAACTCTCATACATTTCATATTTCTTTTCCATTTATTTTCAGTTTTGTTTTAGAAGAAAAGTTCATCAGA
GAATTTTGTTCTGATAATTTCAAGTGGCCATCTTAGGTCAGTGGAAACCGTAAGTCCATTGGACTTTACCTCATCCTTTCTTTGTAGACA
TCTGGGAGAGGAAGAGGAGCTTGTAATGATAGCACGGGGATGGTGCTGTAAACAGGAGTGAAAGTGTTTGTGGAAGTCCAGAGAAGTGAC
TCAACAGGCTACCTAGCTGCAGAACAAGGAGTAGAGCCCACATATCCAGATGGTGTTTTGAGAGGTGCGTAGACAGTGAAATTCAATTAA
AGAGAGGATTTTCTCCTCAGCCTCATGACTCAGAACAGCTCCCTAAATACCTCTCTCATCTAATTGGACCCATCCATAGTCCATTCTCAA
ACATGTGACATTTTCCCCTAAGTAGATGTGATTATCTCTTAGGCATTTGTTGAAAAATAATTCTTAGGTCCATGGTGCTTGCACTTGTGT
CTTTTCTATAAAATGTTTGGTCTTACAGGTTTCATGTCATTTAAGCTGCACTTCTCAGCAAGTTAAAAGATTAGCAGTTAATCTTTATTC
ATTTGGCCTTTGTGAATTTGTATTTAAATTATTTTTTTCAGGATTGGCAAATTATTCTTGTTTCTCCTTTACCAAAAAATAAATGCGATA
TTTTGTTCAATGACCCCAAAACCAACTTGAAACTTAGGTGGTCATATTGGCTTGCAAAGCAATGTCCCTAATTGTACCAGTCAGTCACAC
AAGTGGATTCAAGGACCTGCTTTGCCAGATTGACCTGTCACCAAGCTCACAACACATATCCTCCACAAACAACATGTGTTATGTGAAGAA
AAATGGTAATTATAAATAAGAACAGGATATAACACACCTTTCATCCACTTTAAATCTCCACAGTTTCATTTTATGTCATTCTCTGAGCAA
ATCTCTTTGGGATGTGAGCTAGCGTGTTCTTCTCCCATTTGGAATATAAGGCTGGGAATAGAACAATGCTTAACAAATCAGTGAAGCTCG
ACAGTAATATGTAATTTTAATTCAGTTAGGAAAGAGTTGTATTGCATTGCAACAAGTTGACAAATCATAGCCATCTCTGTAGGGTGTCAG
GAATTATCTCCTGGTCAACTTTAATGATAACTAGGGGTCCCTAAGTGGGCTAACATGTGCTGCATTGGAGAGAAGCCAAGGGCTGAGAGT
ACAGTGCCAACCACGTAATGAATTGCTTGCAGAAATTCCAAAGAGGACTCAGCCACTTATGGATTTCCACACAGCATCTTTTCCCAGCTC
CACATTAAGACACAGGATCTTAAAAGTAATTTTTTAAAAGCTGGCTGTGTATTTATTTATATGAAAGTGTTATAAATATCAAAGCTTACA
AATACATTAATACATATCACCTTTGTTGAAGCTAGCAAAATGGCTCAAAATTGAGACTGTAGAGAAAAATCCATGAAATAATCACGATAG
TCATACCACAAAAGATAGCATAGCTAGGTGGGCCTACCTGGTCGTATCAACACACTTTCAGATAGATGCTTCAAAAAAAAAGGGAAAGCT
TGTTACTGGAATCTTATGTGCATTACAGTTTAATTTCTTCTTGTGACAAATGGTGCTCAAAGAAGGATCAATCCGGTTGCATCCTTCAAT
TTCCCTTTTAGAATGACTTTTGGTTTTCATTACAGTAGGCTATGTTAGCCTTTATTTTGGTGGTTCTCAAATACCTGGTGACTTGAAAGA
GTATTATGCTGGTGGCCTTTCATAAAGGTTACTGAACTTTAATCAGGGGTGAGATGAATGAATGTGAATAGGCCTATATACTATTTTTTT
TAATTAAAAAAAAAAAAAACAGGGCACTTGATTTAAGAACAAACCTGTTTAAAGGGCAGGATCAGGGGGAAGACAGCCTTACTAGGTTGG
AATCTGAATGAGATTCTTGCTGGACAAGGCTGAATTATGGATGCAAAAGCCAAGCAAACTTCCCAGACCTGGAAGTGTCTTGTGTTCCCT
TGGGTCTCTTGAGATCTCCAGTATTTAAAAGTAGCAGTTATTGCCATGAACTCTCAAATAAAAATGCTCCTGCCTCTTACTTGTGAATAT
AATCAACATGCAGCCAGTACATCAGGACCGCAGTTGCTGAATTCATTTACCTAGTTCCCCTTTACAGCGACTATGGACAAGAACCTTTCA
GTTGGTTTTGTCATTCTTGGCCAGATTTAACCAAGAAATTTCTTTCACTATCAGCCTCATTTTCTCAGGCATGCTTACAGGGACAAAGTT
GTTTTGAGTTGAGTTCTCAGCAAATAAGCATTAATATCAAACTGTGCTAAACTTGTCTCACTTGGTATAAGAACTTCAGCATAAAGAGAT
TAGTTTATCCTTTGACACCAAGTCTTTTTTTTTTCTTTGAGACAGAGTCTTGCCCTGTCACCCAGGCTGGAATGCATTGGTGTGATCTCA
GCTCAGTCACTGCAACCTCCGCCTCCCCGGTTCAAGCAATTCTCCTGCCTCACCCTGCTTAGTAGTTGGGATTACAGGCATGTGCTACCA
CACTGGGCTAATTTTTGTATATTTATTAGAGACAGGGTTTTGCTATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCACC
TGCCTCTGCCTCCCAAAGTGCTGAGATTACAGGTGTAAGCCACTGCGCCTGGCCCCCCTTTTTTTTTTCTTTAAAAAAAAAAAAAAGCTT
GGGGGATTAAGTACCCTAAGATAGTGGTCTCTCCCATCAGTTCAATAATGCTGTACAGAACCTCTGGATAAAAAAGCTGTTATTTACACC
ATAATTGTGATGATGGATTTGACTCCTCAAAACCATCTCTCCCCTTTTTGCCCTTTCCAAAAATCAAAGGCTTTTGTCTCCATGAGTTTT
ACCTAGTAGGGATTGTAGTTGTCACTGGTCTAGAGTTCCAATACATTTTATATCAGGAACCTCAGTGAGCTACCCAGAATTGGAACTTAA
CATGGCCCAGCAACTAGGAGAAGAAGGCAAACCTTGAGAAAGCTGAGCCCTCAGGATAGCACAGTCTCACCCTTGTTTAAAATCAAGTCA
GGCTAGCCTTTCAGTCACTCTGGTTTTGTAATGATTTGCCTTTTAGGCCTCAGGCCATTTGATTTCTGCAATAGTTTTCTGTTCTTCTCC
TACAGGAATACATCCCTGTCCTTTCGGTTGTAACTATTACTAAAACTAGGGCTATGCAAATGACCTGGTTACCATGTAATGAACCTTGTG
TACTTATTTTGAGAGAACAATATGTATAGGATATGTTGAGGGGCAGAAAGAAAGACATCAAAAACTGGAACTATTTTAGGTGGCAAATTG
TAACGCAAAAAACAAAAGTATACCTTATTTTGTATACGATGTACACTTGGGACAGAGTTTTCTAATATGTTGCCAATGTTTTTGTAGTGT
CACCACAGGTCTTTTCTGAAGTGTTTTTCCCATTTGTTATAGAGTATTAATGACTTAGCGTAATTAAGCCCTCAAGTATGTGTGAGAGAG
CGCGTGTGAGAAAATACAAAGCCATAGATATTGATTTACTTCACTGACCTGTGTAACTTTATGTCTGGGTTTCGCCATCCAAGATAGATT


Top

FusionGenePPI for BAI1_EXT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BAI1MAGI3, DLG4, MAGI1, BAIAP3, EIF3H, BAI1, MAGI2, INADL, DLG1, LIN7A, LRRC7, SNTA1, SNTB1, SNTB2, SNTG2, PDZD2, ARRB2, ERBB2, ELMO1, BAIAP2EXT1CNTF, OSTF1, EXT1, EXT2, TRAP1, PEX19, SYNE4, PLAUR, PTCH1, ERGIC3, NAAA, SCGB2A2, B4GAT1, MPPE1, CRP, SYP, GAA, SLC39A5, TFR2, NRROS, TOR1AIP2, CD79B, FBXW7, NOTCH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BAI1_EXT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BAI1_EXT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneEXT1C0015306Hereditary Multiple Exostoses8CTD_human;HPO;ORPHANET;UNIPROT
TgeneEXT1C0004352Autistic Disorder1CTD_human
TgeneEXT1C0008479Chondrosarcoma1CTD_human;HPO;ORPHANET;UNIPROT