FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 38025

FusionGeneSummary for THRA_B4GALNT2

check button Fusion gene summary
Fusion gene informationFusion gene name: THRA_B4GALNT2
Fusion gene ID: 38025
HgeneTgene
Gene symbol

THRA

B4GALNT2

Gene ID

7067

124872

Gene namethyroid hormone receptor alphabeta-1,4-N-acetyl-galactosaminyltransferase 2
SynonymsAR7|CHNG6|EAR7|ERB-T-1|ERBA|ERBA1|NR1A1|THRA1|THRA2|c-ERBA-1B4GALT|GALGT2
Cytomap

17q21.1

17q21.32

Type of geneprotein-codingprotein-coding
Descriptionthyroid hormone receptor alphaEAR-7ERBA-related 7V-erbA-related protein 7c-erbA-alphanuclear receptor subfamily 1 group A member 1thyroid hormone receptor alpha 1thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homobeta-1,4 N-acetylgalactosaminyltransferase 2UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferaseUDP-GalNAc:Neu5Acalpha2-3Galbeta-R beta1,4-N-acetylgalactosaminyltransferasebeta 1,4 N-acetylgalactosaminyltransferase/betal,4 GalNAcT/Sda-Gal
Modification date2018052320180429
UniProtAcc

P10827

Q8NHY0

Ensembl transtripts involved in fusion geneENST00000394121, ENST00000264637, 
ENST00000584985, ENST00000450525, 
ENST00000546243, 
ENST00000504681, 
ENST00000393354, ENST00000300404, 
Fusion gene scores* DoF score11 X 8 X 9=7929 X 3 X 2=54
# samples 1510
** MAII scorelog2(15/792*10)=-2.40053792958373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/54*10)=0.888968687611256
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: THRA [Title/Abstract] AND B4GALNT2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTHRA

GO:0006357

regulation of transcription by RNA polymerase II

18052923

HgeneTHRA

GO:0006366

transcription by RNA polymerase II

8710870|9653119

HgeneTHRA

GO:0009755

hormone-mediated signaling pathway

18052923

HgeneTHRA

GO:0017055

negative regulation of RNA polymerase II transcriptional preinitiation complex assembly

8524305

HgeneTHRA

GO:0045892

negative regulation of transcription, DNA-templated

8710870

HgeneTHRA

GO:2000143

negative regulation of DNA-templated transcription, initiation

8524305

TgeneB4GALNT2

GO:0019276

UDP-N-acetylgalactosamine metabolic process

12678917|14688233

TgeneB4GALNT2

GO:0022408

negative regulation of cell-cell adhesion

16024623


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A0AW-01ATHRAchr17

38233861

+B4GALNT2chr17

47236399

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394121ENST00000504681THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000394121ENST00000393354THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000394121ENST00000300404THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000264637ENST00000504681THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000264637ENST00000393354THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000264637ENST00000300404THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000584985ENST00000504681THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000584985ENST00000393354THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000584985ENST00000300404THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000450525ENST00000504681THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000450525ENST00000393354THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000450525ENST00000300404THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000546243ENST00000504681THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000546243ENST00000393354THRAchr17

38233861

+B4GALNT2chr17

47236399

+
In-frameENST00000546243ENST00000300404THRAchr17

38233861

+B4GALNT2chr17

47236399

+

Top

FusionProtFeatures for THRA_B4GALNT2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
THRA

P10827

B4GALNT2

Q8NHY0

Isoform Alpha-1: Nuclear hormone receptor that can actas a repressor or activator of transcription. High affinityreceptor for thyroid hormones, including triiodothyronine andthyroxine. {ECO:0000269|PubMed:12699376,ECO:0000269|PubMed:14673100, ECO:0000269|PubMed:18237438,ECO:0000269|PubMed:19926848}. Isoform Alpha-2: Does not bind thyroid hormone andfunctions as a weak dominant negative inhibitor of thyroid hormoneaction. {ECO:0000269|PubMed:8910441}. Involved in the synthesis of the Sd(a) antigen (Sia-alpha2,3-[GalNAc-beta1,4]Gal-beta1,4-GlcNAc), a carbohydratedeterminant expressed on erythrocytes, the colonic mucosa andother tissues. Transfers a beta-1,4-linked GalNAc to the galactoseresidue of an alpha-2,3-sialylated chain.{ECO:0000269|PubMed:12678917, ECO:0000269|PubMed:14688233}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTHRAchr17:38233861chr17:47236399ENST00000264637+4101_5274491RegionNote=Modulating
HgeneTHRAchr17:38233861chr17:47236399ENST00000394121+4101_5274491RegionNote=Modulating
HgeneTHRAchr17:38233861chr17:47236399ENST00000450525+491_5274411RegionNote=Modulating
HgeneTHRAchr17:38233861chr17:47236399ENST00000546243+491_5274411RegionNote=Modulating
HgeneTHRAchr17:38233861chr17:47236399ENST00000584985+4101_5274452RegionNote=Modulating
HgeneTHRAchr17:38233861chr17:47236399ENST00000264637+41053_7374491Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000394121+41053_7374491Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000450525+4953_7374411Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000546243+4953_7374411Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000584985+41053_7374452Zinc fingerNR C4-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTHRAchr17:38233861chr17:47236399ENST00000264637+41053_12774491DNA bindingNuclear receptor
HgeneTHRAchr17:38233861chr17:47236399ENST00000394121+41053_12774491DNA bindingNuclear receptor
HgeneTHRAchr17:38233861chr17:47236399ENST00000450525+4953_12774411DNA bindingNuclear receptor
HgeneTHRAchr17:38233861chr17:47236399ENST00000546243+4953_12774411DNA bindingNuclear receptor
HgeneTHRAchr17:38233861chr17:47236399ENST00000584985+41053_12774452DNA bindingNuclear receptor
HgeneTHRAchr17:38233861chr17:47236399ENST00000264637+410163_40774491DomainNR LBD
HgeneTHRAchr17:38233861chr17:47236399ENST00000394121+410163_40774491DomainNR LBD
HgeneTHRAchr17:38233861chr17:47236399ENST00000450525+49163_40774411DomainNR LBD
HgeneTHRAchr17:38233861chr17:47236399ENST00000546243+49163_40774411DomainNR LBD
HgeneTHRAchr17:38233861chr17:47236399ENST00000584985+410163_40774452DomainNR LBD
HgeneTHRAchr17:38233861chr17:47236399ENST00000264637+41091_11574491Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000394121+41091_11574491Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000450525+4991_11574411Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000546243+4991_11574411Zinc fingerNR C4-type
HgeneTHRAchr17:38233861chr17:47236399ENST00000584985+41091_11574452Zinc fingerNR C4-type
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000300404+4111_67226567Topological domainCytoplasmic
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000300404+41189_566226567Topological domainLumenal
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000393354+4111_67166507Topological domainCytoplasmic
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000393354+41189_566166507Topological domainLumenal
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000504681+4111_67140481Topological domainCytoplasmic
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000504681+41189_566140481Topological domainLumenal
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000300404+41168_88226567TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000393354+41168_88166507TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneB4GALNT2chr17:38233861chr17:47236399ENST00000504681+41168_88140481TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for THRA_B4GALNT2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_415aa
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKVTLTASLGTLNTLADV
PDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPVTIRHPVIPKLYDPGPERKLRNLVTIATKTFLR
PHKLMIMLRSIREYYPDLTVIVADDSQKPLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEKTE
LDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTSGVVNFFLAHTERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1245nt
ATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAAC
GGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCA
ACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTC
CCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTG
ACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATC
CGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGC
CCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTG
GAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACC
ACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAA
CTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAG
AGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGA
CTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCA
TGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_2062nt
AGCAGATTGTTGGGGGAAATGGCTGGTGACAGAGAATAGAAAGAGCCTATATGGAGAAGGGTGACGTTGGAAAAGGGAGGCAGTGGATCG
GTATTGATGTTAGAAATGAGAGGGGAGGGAGGTAACAGGGAATGAACCCCCACAAGGATGAAAAACGTAAGATGATTGAAGTTAAAAGGA
CATCAGGGGTCACCTGCCCAGCCCTCGCAGCTGAAGCTTGAGGAAGCTCTGCCCCCGACAGCAGTGGCGATTTGTCAAGGGATCTCTGGA
CAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCCAGCCCTCCCACCTGCCACTCCCTG
GCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGGGTATCATGGGTGCTGTGCCCTAGG
GCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCTCTTGGCGTGCTGGAGGGCATCCTG
GATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAA
GCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGT
GTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAA
CACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTT
CATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAA
GTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTAC
CAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGA
CAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGC
CATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGT
CCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGG
GGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCT
GGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGAC
CCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGAC
CTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAAGAACCATCTCCAATGTGCCGCATA
AAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAAACTGGACTCCTGATAGGTGAACGT
TGTACCAAACCAGCTGGTGGGTAGGGAAAAGGGAAATGGCTCAGTTACTGGAAGTACCAATCAAAGGTGAAGGGTCACTGGAAATGAACC

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1947nt
AGCAGATTGTTGGGGGAAATGGCTGGTGACAGAGAATAGAAAGAGCCTATATGGAGAAGGGTGACGTTGGAAAAGGGAGGCAGTGGATCG
GTATTGATGTTAGAAATGAGAGGGGAGGGAGGTAACAGGGAATGAACCCCCACAAGGATGAAAAACGTAAGATGATTGAAGTTAAAAGGA
CATCAGGGGTCACCTGCCCAGCCCTCGCAGCTGAAGCTTGAGGAAGCTCTGCCCCCGACAGCAGTGGCGATTTGTCAAGGGATCTCTGGA
CAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCCAGCCCTCCCACCTGCCACTCCCTG
GCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGGGTATCATGGGTGCTGTGCCCTAGG
GCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCTCTTGGCGTGCTGGAGGGCATCCTG
GATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAA
GCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGT
GTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAA
CACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTT
CATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAA
GTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTAC
CAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGA
CAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGC
CATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGT
CCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGG
GGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCT
GGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGAC
CCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGAC
CTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAAGAACCATCTCCAATGTGCCGCATA
AAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAAACTGGACTCCTGATAGGTGAACGT

>In-frame_THRA_ENST00000394121_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1947nt
AGCAGATTGTTGGGGGAAATGGCTGGTGACAGAGAATAGAAAGAGCCTATATGGAGAAGGGTGACGTTGGAAAAGGGAGGCAGTGGATCG
GTATTGATGTTAGAAATGAGAGGGGAGGGAGGTAACAGGGAATGAACCCCCACAAGGATGAAAAACGTAAGATGATTGAAGTTAAAAGGA
CATCAGGGGTCACCTGCCCAGCCCTCGCAGCTGAAGCTTGAGGAAGCTCTGCCCCCGACAGCAGTGGCGATTTGTCAAGGGATCTCTGGA
CAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCCAGCCCTCCCACCTGCCACTCCCTG
GCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGGGTATCATGGGTGCTGTGCCCTAGG
GCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCTCTTGGCGTGCTGGAGGGCATCCTG
GATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAACAGTGCCAGGTCACCAGATGGAAA
GCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCTGGACAAAGACGAGCAGTGTGTCGT
GTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCTGACAGCTTCTCTGGGGACACTGAA
CACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTACCAGTGACCGGAAGCTGTTGAAGTT
CATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCTGGAGTCCAGGTCCTCAGTGGCCAA
GTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCTCAGAAACCTGGTTACCATTGCTAC
CAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGACTTGACCGTAATAGTGGCTGATGA
CAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGGTTGGTTTGCTGGTAGGAACCTGGC
CATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGACCAAGATTGAGGTGCTGGTGGATGT
CCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTTGTTGCTGGAACAGAGTGAGAATGG
GGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGACCAGTGGCGTGGTCAACTTCTTCCT
GGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGAATTCTTCATTGATGGGCTAGGGAC
CCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTCAGAACTGGCTGCCCTAGAGAAGAC
CTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAAGAACCATCTCCAATGTGCCGCATA
AAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAAACTGGACTCCTGATAGGTGAACGT

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_2086nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA
ACTGGACTCCTGATAGGTGAACGTTGTACCAAACCAGCTGGTGGGTAGGGAAAAGGGAAATGGCTCAGTTACTGGAAGTACCAATCAAAG
GTGAAGGGTCACTGGAAATGAACCAGTCACTGACCAGGGCAATGGAGACTGTATTAATAGCAATGATGATTTGTACAATGCCCTGCCTTT

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1971nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA

>In-frame_THRA_ENST00000264637_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1971nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_2086nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA
ACTGGACTCCTGATAGGTGAACGTTGTACCAAACCAGCTGGTGGGTAGGGAAAAGGGAAATGGCTCAGTTACTGGAAGTACCAATCAAAG
GTGAAGGGTCACTGGAAATGAACCAGTCACTGACCAGGGCAATGGAGACTGTATTAATAGCAATGATGATTTGTACAATGCCCTGCCTTT

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1971nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA

>In-frame_THRA_ENST00000584985_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1971nt
GAGGCGGCCTGCAGGGAGCAGCCGCGAGCCGGCCGGGCGCGCCGAGCCCGAGCCCCAGCCGGAGCGGGGCGGGGGAGGGAGGAGCCAGAG
CGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAGG
AGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGGC
GCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCCC
AGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCGG
GTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTCT
CTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGAA
CAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACCT
GGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCCT
GACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTAC
CAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTCT
GGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGCT
CAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAGA
CTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGGG
TTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGAC
CAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGTT
GTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGAC
CAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAGA
ATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACTC
AGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCAA
GAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAAA

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1997nt
GCGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAG
GAGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGG
CGCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCC
CAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCG
GGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTC
TCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGA
ACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACC
TGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCC
TGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTA
CCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTC
TGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGC
TCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAG
ACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGG
GTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGA
CCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGT
TGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGA
CCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAG
AATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACT
CAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCA
AGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAA
AACTGGACTCCTGATAGGTGAACGTTGTACCAAACCAGCTGGTGGGTAGGGAAAAGGGAAATGGCTCAGTTACTGGAAGTACCAATCAAA
GGTGAAGGGTCACTGGAAATGAACCAGTCACTGACCAGGGCAATGGAGACTGTATTAATAGCAATGATGATTTGTACAATGCCCTGCCTT

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1882nt
GCGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAG
GAGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGG
CGCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCC
CAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCG
GGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTC
TCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGA
ACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACC
TGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCC
TGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTA
CCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTC
TGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGC
TCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAG
ACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGG
GTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGA
CCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGT
TGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGA
CCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAG
AATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACT
CAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCA
AGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAA

>In-frame_THRA_ENST00000450525_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1882nt
GCGGCCGCCGCCTCTGCCGGAGGAGCCGCGGGGCCGCCACACTCGCCCCCCGCCCCCCCCGCGCTCACTCGCACTCACACCCGGGCGCAG
GAGGCGGGCGGCCCGGGCCCCACCGGCCCCCCATGGACGCCCCCAGCACGGGGCGCTGAGACCCCCGCGTCGCTGCCCAGCCCGGTCCGG
CGCGCCACGCCGAGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCCC
CAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGCG
GGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGTC
TCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAGA
ACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTACC
TGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACCC
TGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCTA
CCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGTC
TGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAGC
TCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCAG
ACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAGG
GTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAGA
CCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAGT
TGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTGA
CCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCAG
AATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGACT
CAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTCA
AGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAAA

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000504681_chr17_47236399_+_1908nt
GTGCACGCATCCATGTGAGAGTGTTTTTGTGCATGTGTGGGCTGGGGAGGGCTCTGAATATCTCCTGGAACGGTACCCAGAGCCCTGTGG
CTCTGCGCATGCGGGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCC
CCAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGC
GGGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGT
CTCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAG
AACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTAC
CTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACC
CTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCT
ACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGT
CTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAG
CTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCA
GACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAG
GGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAG
ACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAG
TTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTG
ACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCA
GAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGAC
TCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTC
AAGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAA
AAACTGGACTCCTGATAGGTGAACGTTGTACCAAACCAGCTGGTGGGTAGGGAAAAGGGAAATGGCTCAGTTACTGGAAGTACCAATCAA
AGGTGAAGGGTCACTGGAAATGAACCAGTCACTGACCAGGGCAATGGAGACTGTATTAATAGCAATGATGATTTGTACAATGCCCTGCCT

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000393354_chr17_47236399_+_1793nt
GTGCACGCATCCATGTGAGAGTGTTTTTGTGCATGTGTGGGCTGGGGAGGGCTCTGAATATCTCCTGGAACGGTACCCAGAGCCCTGTGG
CTCTGCGCATGCGGGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCC
CCAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGC
GGGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGT
CTCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAG
AACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTAC
CTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACC
CTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCT
ACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGT
CTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAG
CTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCA
GACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAG
GGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAG
ACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAG
TTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTG
ACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCA
GAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGAC
TCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTC
AAGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAA

>In-frame_THRA_ENST00000546243_chr17_38233861_+_B4GALNT2_ENST00000300404_chr17_47236399_+_1793nt
GTGCACGCATCCATGTGAGAGTGTTTTTGTGCATGTGTGGGCTGGGGAGGGCTCTGAATATCTCCTGGAACGGTACCCAGAGCCCTGTGG
CTCTGCGCATGCGGGGGATCTCTGGACAGGACAAGACTCCGAAGCTACTCCCCCAGCACACAGCCCGGGACCCACAAACCCAGCTTGCCC
CCAGCCCTCCCACCTGCCACTCCCTGGCCCCTCCCACCGCCCGCCCCCCTTGGGGCGCAGGGCATGGTGTGAAAGGCCAAGTGCTGAGGC
GGGTATCATGGGTGCTGTGCCCTAGGGCCTGGGTGGCAGGGGGTGGGTGGCCTGTGGGTGTGCCGGGGGGGCCAGTGTGCCCACCCCAGT
CTCTTGGCGTGCTGGAGGGCATCCTGGATGGAATTGAAGTGAATGGAACAGAAGCCAAGCAAGGTGGAGTGTGGGTCAGACCCAGAGGAG
AACAGTGCCAGGTCACCAGATGGAAAGCGAAAAAGAAAGAACGGCCAATGTTCCCTGAAAACCAGCATGTCAGGGTATATCCCTAGTTAC
CTGGACAAAGACGAGCAGTGTGTCGTGTGTGGGGACAAGGCAACTGGTTATCACTACCGCTGTATCACTTGTGAGGGCTGCAAGGTCACC
CTGACAGCTTCTCTGGGGACACTGAACACCCTTGCTGATGTCCCAGACAGTGTGGTGCAGGGCAGAGGCCAGAAGCAGCTGATCATTTCT
ACCAGTGACCGGAAGCTGTTGAAGTTCATTCTTCAGCACGTGACATACACCAGCACGGGGTACCAGCACCAGAAGGTAGACATAGTGAGT
CTGGAGTCCAGGTCCTCAGTGGCCAAGTTTCCAGTGACCATCCGCCATCCTGTCATACCCAAGCTATACGACCCTGGACCAGAGAGGAAG
CTCAGAAACCTGGTTACCATTGCTACCAAGACTTTCCTCCGCCCCCACAAGCTCATGATCATGCTCCGGAGTATTCGAGAGTATTACCCA
GACTTGACCGTAATAGTGGCTGATGACAGCCAGAAGCCCCTGGAAATTAAAGACAATCACGTGGAGTATTACACTATGCCCTTTGGGAAG
GGTTGGTTTGCTGGTAGGAACCTGGCCATATCTCAGGTCACCACCAAATACGTTCTCTGGGTGGACGATGATTTTCTCTTCAACGAGGAG
ACCAAGATTGAGGTGCTGGTGGATGTCCTGGAGAAAACAGAACTGGACGTGGTAGGCGGCAGTGTGCTGGGAAATGTGTTCCAGTTTAAG
TTGTTGCTGGAACAGAGTGAGAATGGGGCCTGCCTTCACAAGAGGATGGGATTTTTCCAACCCCTGGATGGCTTCCCCAGCTGCGTGGTG
ACCAGTGGCGTGGTCAACTTCTTCCTGGCCCACACGGAGCGACTCCAAAGAGTTGGCTTTGATCCCCGCCTGCAACGAGTGGCTCACTCA
GAATTCTTCATTGATGGGCTAGGGACCCTACTCGTGGGGTCATGCCCAGAAGTGATTATAGGTCACCAGTCTCGGTCTCCAGTGGTGGAC
TCAGAACTGGCTGCCCTAGAGAAGACCTACAATACATACCGGTCCAACACCCTCACCCGGGTCCAGTTCAAGCTGGCCCTCCACTACTTC
AAGAACCATCTCCAATGTGCCGCATAAAGGTGTGAGGGCATAGGAGAAACACTAGGCTGGCTGGTTATGGTATCTATAGCAGGCCACCAA


Top

FusionGenePPI for THRA_B4GALNT2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
THRANCOA6, TDG, CCND1, MEF2A, EP300, YWHAQ, ITGB3BP, POU2F1, DAP3, NR0B2, NRIP1, HR, AKAP13, MED12, MED16, MED6, MED24, CDK8, MED21, TRIM24, COPS2, TRIP11, RXRA, MED1, FUS, HDAC3, NCOR1, ZBTB3, SUV39H1, PARP1, NCOA1, NCOA2, NCOA3, TAF11, TAF7, GRIP1, NCOR2, EMD, PRKDC, SMC1A, LIG3, XRCC5, XRCC6, HSPA4, TBL1XR1, GPS2, TBL1X, CUL1, RGN, SEPP1, CDK7, MED25, ARID5A, GTF2B, C1D, THRA, CLIC1, FOXJ1, BUB3, PTGES3, RANBP9, AMOTL2, L3MBTL3, ENO1, MOV10, NXF1, UBE2I, CEP76, TRIM63, A2ML1, HAL, CST6, MTNR1BB4GALNT2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for THRA_B4GALNT2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneTHRAP10827DB00451LevothyroxineThyroid hormone receptor alphasmall moleculeapproved
HgeneTHRAP10827DB00509DextrothyroxineThyroid hormone receptor alphasmall moleculeapproved|investigational
HgeneTHRAP10827DB01118AmiodaroneThyroid hormone receptor alphasmall moleculeapproved|investigational
HgeneTHRAP10827DB00279LiothyronineThyroid hormone receptor alphasmall moleculeapproved|vet_approved

Top

RelatedDiseases for THRA_B4GALNT2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTHRAC3280817HYPOTHYROIDISM, CONGENITAL, NONGOITROUS, 62UNIPROT
HgeneTHRAC0014175Endometriosis1CTD_human
HgeneTHRAC0019284Diaphragmatic Hernia1CTD_human