FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37951

FusionGeneSummary for THADA_IGF2BP3

check button Fusion gene summary
Fusion gene informationFusion gene name: THADA_IGF2BP3
Fusion gene ID: 37951
HgeneTgene
Gene symbol

THADA

IGF2BP3

Gene ID

63892

10643

Gene nameTHADA, armadillo repeat containinginsulin like growth factor 2 mRNA binding protein 3
SynonymsARMC13|GITACT98|IMP-3|IMP3|KOC|KOC1|VICKZ3
Cytomap

2p21

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionthyroid adenoma-associated proteindeath receptor-interacting proteingene inducing thyroid adenomas proteininsulin-like growth factor 2 mRNA-binding protein 3IGF-II mRNA-binding protein 3IGF2 mRNA-binding protein 3KH domain containing protein overexpressed in cancerVICKZ family member 3cancer/testis antigen 98
Modification date2018052320180519
UniProtAcc

Q6YHU6

O00425

Ensembl transtripts involved in fusion geneENST00000330266, ENST00000405975, 
ENST00000415080, ENST00000405006, 
ENST00000485353, ENST00000402360, 
ENST00000404790, ENST00000403856, 
ENST00000258729, ENST00000491719, 
Fusion gene scores* DoF score6 X 6 X 5=1803 X 3 X 3=27
# samples 63
** MAII scorelog2(6/180*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: THADA [Title/Abstract] AND IGF2BP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHCATCGA-BJ-A28V-01ATHADAchr2

43625110

-IGF2BP3chr7

23458443

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000330266ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-5UTRENST00000330266ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
In-frameENST00000405975ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
5CDS-5UTRENST00000405975ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
In-frameENST00000415080ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
5CDS-5UTRENST00000415080ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
Frame-shitENST00000405006ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
5CDS-5UTRENST00000405006ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
5UTR-3CDSENST00000485353ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
5UTR-5UTRENST00000485353ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-3CDSENST00000402360ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-5UTRENST00000402360ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-3CDSENST00000404790ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-5UTRENST00000404790ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-3CDSENST00000403856ENST00000258729THADAchr2

43625110

-IGF2BP3chr7

23458443

-
intron-5UTRENST00000403856ENST00000491719THADAchr2

43625110

-IGF2BP3chr7

23458443

-

Top

FusionProtFeatures for THADA_IGF2BP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
THADA

Q6YHU6

IGF2BP3

O00425

RNA-binding factor that may recruit target transcriptsto cytoplasmic protein-RNA complexes (mRNPs). This transcript'caging' into mRNPs allows mRNA transport and transient storage.It also modulates the rate and location at which targettranscripts encounter the translational apparatus and shields themfrom endonuclease attacks or microRNA-mediated degradation. Bindsto the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes celladhesion and invadopodia formation in cancer cells. Binds to beta-actin/ACTB and MYC transcripts. Binds to the 5'-UTR of theinsulin-like growth factor 2 (IGF2) mRNAs.{ECO:0000269|PubMed:16541107, ECO:0000269|PubMed:23640942}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for THADA_IGF2BP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_THADA_ENST00000405975_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_1910aa
MGVKKKKEMQVAALTICHQDLETLKSFADVEGKNLASLLLHCVQLTDGVSQIHTIKQIVPLLEKADKNGMCDPTIQSCLDILAGITLSLS
LKNPLKKVLASSLNSLPDFFLPEAMHRFTSRLQEELNTTDLYSYRKVTDNISSCMENFNLGRASVNNLLKNVLHFLQKSLIEILEENRKC
AGNHIIQTQLMNDLLVGIRVSMMLVQKVQDFQGNLWKTSDSPIWQNMCGLLSIFTKVLSDDDLLQTVQSTSGLAIILFIKTMFHPSEKIP
HLISSVLLRSVDCTSVPEWFMSSCRSLCCGDISQSAVLFLCQGTLAMLDWQNGSMGRSGEALLLDTAHVLFTLSSQIKEPTLEMFLSRIL
ASWTNSAIQVLESSSPSLTDSLNGNSSIVGRLLETVTTHWEHPLDALRHQTKIMFKNLLQMHRLTVEGADFVPDPFFVELTESLLRLEWH
IKGKYTCLGCLVECIGVEHILAIDKTIPSQILEVMGDQSLVPTASDLLETMFRNHKSHLKSQTAESSWIDQWHETWVSPLLFILCEGNLD
QKSYVIDTYLPKLLSYSPESLQYMVKILQTSIDAKTGQEQSFPSLGSCNSRGALGALMACLRIARAHGHLQSATDTWENLVSDARIKQGL
IHQHCQVRIDTLGLLCESNRSTEIVSMEEMQWIQFFITYNLNSQSPGVRQQICSLLKKLFCRIQESSQVLTKLEQSKSKREPENELTKQH
PSVSLQQTKNFMSSICNSLFEALFPGSSYSTRFSALTILGSIAEVFHVPEGRITTVTQLSHDIDVGRFQTLMECFTSTFEDVKILAFDLL
MKLSKTAVHFQDSGKLQGLFQAALELSTSTKPYDCVTASYLLNFLIWQDALPSSLSAYLTQQVACDNGDRPAAVVERNTLMVIKCLMENL
EEEVSQAENSLLQAAAAFPMTGRVHCITGALQKLSLNSLQLVSEWRPVVEKLLLMSYRLSTVVSPVIQSSSPEGLIPMDTDSESASRLQM
ILNEIQPRDTNDTFNQAKILKEHDSFDMKDLNASVVNIDTSTEIKGKEVKTCDVTAQMVLVCCWRSMKEVALLLGMLCQLLPMQPVPESS
DGLLTVEQVKEIGDYFKQHLLQSRHRGAFELATTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATRRSAGIPFYIQA
LLASEPKKGRMDLLKITMKELISLAGPTDDIQSTVPQVHALNILRALFRDTRLGENIIPTVADGAKAAILGFTSPVWAVRNSSTLLFSAL
ITRIFGVKRAKDEHSKTNRMTGREFFSRFPELTPFLLKQLETVANTVDSDMGEPNRHPSMFLLLLVLERLYASPMDGTSSALSMGPFVPF
IMRCGHSPVYHSREMAARALVPFVMIDHIPNTIRTLLSTLPSCTDQCFRQNHIHGTLLQDSETSDTKTPASFTVGGAG_FTSPVWSGGEL
_ASEH_LGNCSCKCNLFQ_GPS_TSTRQTEWISVREFHLESSLTP__NGRPAKPLAAAPRSPGAWAEGLLKAGVSRIRIQAETM_FASAP
AGSHPICWSHHRKRRCHHSEHHQTDPV_NRCPP_RKCGGC_EVDYTPLYS_RHLCGL_VTSGDTA_GSSRTKIHRRDPLEDFSS__LCWT
STW_RRKKS_KN_ARHRH_NHDISIAGIDAV_SRTHTYS_RQC_DMCQS_GGDHEENQGVL_K_TCFTESSSTFNSWIKSERLGSVPTHF
RDATSHLRAPFSHDSSLPAV_AIRNGDCSSVTPSSISRCHHRQAGPAHQAAFSLCWSFN_DCSSGSTRC_SEDGDTHWTTRGSVQGSGKN
LWKN_RRKLC_S_RRGET_SSTQSAILCCWQSTWKRRQNGE_TSEFVKCRSCCPS_PDT__E_PSGCQNNWSLLCLPGCPEKNSGNSDSG

>In-frame_THADA_ENST00000415080_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_501aa
DSETSDTKTPASFTVGGAG_FTSPVWSGGEL_ASEH_LGNCSCKCNLFQ_GPS_TSTRQTEWISVREFHLESSLTP__NGRPAKPLAAAP
RSPGAWAEGLLKAGVSRIRIQAETM_FASAPAGSHPICWSHHRKRRCHHSEHHQTDPV_NRCPP_RKCGGC_EVDYTPLYS_RHLCGL_V
TSGDTA_GSSRTKIHRRDPLEDFSS__LCWTSTW_RRKKS_KN_ARHRH_NHDISIAGIDAV_SRTHTYS_RQC_DMCQS_GGDHEENQG
VL_K_TCFTESSSTFNSWIKSERLGSVPTHFRDATSHLRAPFSHDSSLPAV_AIRNGDCSSVTPSSISRCHHRQAGPAHQAAFSLCWSFN
_DCSSGSTRC_SEDGDTHWTTRGSVQGSGKNLWKN_RRKLC_S_RRGET_SSTQSAILCCWQSTWKRRQNGE_TSEFVKCRSCCPS_PDT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_THADA_ENST00000405975_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_5731nt
ATGGGTGTAAAGAAGAAGAAAGAAATGCAAGTTGCTGCGCTGACCATTTGCCATCAGGACCTTGAAACTTTGAAATCTTTTGCTGATGTG
GAAGGGAAAAATCTAGCTTCTTTGCTGTTACATTGTGTGCAACTCACGGATGGAGTGTCACAAATCCATTATATTAAACAGATTGTGCCT
CTGCTGGAGAAAGCAGATAAAAATGGCATGTGTGATCCCACTATTCAAAGTTGTTTGGATATCTTAGCAGGCATTTATCTTTCTTTGAGT
CTAAAGAATCCCTTGAAGAAAGTATTGGCAAGCTCACTAAATAGCCTGCCTGATTTTTTTCTACCTGAGGCTATGCACCGTTTTACTTCT
CGTCTTCAGGAAGAATTGAATACTACTGACTTATACTCTTACAGGAAAGTTACTGACAATATTTCTTCCTGTATGGAGAACTTTAACTTG
GGTAGAGCAAGTGTTAATAATCTGCTTAAAAATGTGCTTCATTTTCTGCAGAAGAGTTTAATTGAAATCCTGGAAGAAAATAGAAAATGT
GCTGGAAATCATATTATTCAAACACAGTTGATGAATGACTTACTGGTAGGCATTAGAGTTTCAATGATGTTAGTACAGAAAGTACAAGAT
TTCCAGGGAAATCTTTGGAAGACTTCCGATTCTCCCATATGGCAAAATATGTGTGGATTGCTGAGTATTTTTACCAAGGTTTTAAGCGAT
GATGATCTGTTACAGACTGTACAGAGCACATCTGGATTAGCTATTATTCTTTTTATTAAGACTATGTTTCACCCGTCTGAAAAGATTCCT
CATTTGATTAGCAGTGTGCTGCTTCGTTCAGTGGACTGCACCAGTGTCCCCGAGTGGTTTATGAGCAGCTGCAGGAGCCTCTGTTGTGGT
GACATCTCTCAGTCAGCTGTCTTATTCCTCTGTCAGGGGACACTTGCCATGTTGGACTGGCAGAACGGAAGCATGGGTCGGAGTGGGGAG
GCCCTGCTCTTGGATACTGCACATGTTTTGTTCACCTTGAGTTCACAGATTAAAGAGCCAACGCTGGAAATGTTTCTGTCTAGAATCTTA
GCATCCTGGACTAATTCAGCCATACAAGTCCTTGAATCAAGTTCCCCGAGCCTAACGGACAGCCTGAATGGGAATTCAAGTATAGTTGGG
AGACTTTTGGAATATGTCTATACCCATTGGGAACATCCATTGGATGCTCTGAGACACCAAACCAAAATCATGTTCAAAAACCTTCTCCAA
ATGCACCGGCTCACTGTGGAAGGTGCAGATTTCGTCCCTGATCCTTTCTTTGTGGAATTGACTGAGAGTCTTTTACGATTGGAATGGCAT
ATTAAAGGAAAGTACACGTGCCTTGGTTGTTTGGTAGAGTGCATAGGAGTTGAACATATTTTGGCTATAGATAAAACTATTCCATCTCAA
ATCTTAGAGGTGATGGGAGACCAGTCATTGGTACCTTATGCAAGTGACCTCTTGGAAACCATGTTTAGAAATCATAAGAGTCATTTGAAA
TCCCAGACTGCTGAGAGTTCTTGGATTGACCAGTGGCATGAGACTTGGGTTTCTCCTCTCCTTTTTATATTGTGTGAAGGAAACTTGGAT
CAAAAATCTTACGTGATTGATTATTACTTGCCAAAATTATTAAGTTACAGCCCTGAAAGCTTACAGTACATGGTAAAGATTCTTCAGACT
TCTATTGATGCTAAAACTGGACAAGAGCAATCTTTCCCATCCTTAGGGTCTTGTAATAGCAGGGGGGCTCTGGGAGCTTTGATGGCATGT
CTGCGAATAGCTAGAGCTCATGGACATCTTCAGTCTGCAACTGATACCTGGGAGAACCTCGTGTCTGATGCAAGAATAAAGCAAGGCTTA
ATTCATCAGCATTGCCAAGTAAGGATAGATACATTAGGCTTGCTTTGTGAAAGTAATCGGAGCACAGAAATTGTTTCCATGGAAGAAATG
CAGTGGATTCAGTTCTTTATTACATACAATCTTAACAGCCAGTCTCCAGGAGTGCGGCAACAGATCTGTTCTCTTCTTAAAAAGTTGTTT
TGTAGGATACAGGAAAGTTCTCAGGTACTTTATAAATTGGAGCAGAGTAAATCCAAACGTGAACCAGAGAATGAGTTAACCAAACAGCAC
CCTTCTGTTTCTTTACAGCAGTATAAGAATTTCATGTCATCCATTTGTAACAGTCTTTTTGAAGCATTGTTTCCTGGATCTTCCTACTCG
ACTAGATTTTCAGCTTTAACCATTTTAGGTTCAATAGCTGAAGTTTTTCATGTCCCAGAAGGCAGAATTTATACAGTATATCAGCTGAGT
CATGATATTGATGTTGGTCGTTTCCAAACACTAATGGAATGTTTTACCAGCACTTTTGAAGACGTGAAAATTTTAGCATTTGATCTTCTG
ATGAAGTTATCAAAAACAGCTGTACATTTTCAGGATTCGGGGAAACTGCAAGGCTTATTTCAGGCAGCATTGGAGCTCAGCACAAGCACC
AAACCATACGACTGTGTGACAGCTTCCTACCTGCTGAACTTCTTAATCTGGCAGGATGCTCTACCGTCATCCTTGTCTGCCTACTTAACT
CAGCAAGTTGCATGTGATAATGGAGATAGGCCTGCTGCTGTGGTGGAAAGGAACACATTAATGGTTATCAAATGCTTGATGGAAAATCTT
GAGGAAGAAGTATCTCAGGCTGAAAATTCTCTGCTTCAGGCAGCAGCAGCATTTCCAATGTATGGGCGAGTCCACTGTATAACAGGAGCT
TTGCAGAAGTTATCTCTAAACAGCCTGCAGTTGGTGAGCGAGTGGAGACCTGTGGTAGAGAAGCTCCTTTTGATGTCCTACAGGCTTTCC
ACTGTGGTGTCTCCAGTCATTCAGAGCTCATCCCCTGAAGGCCTCATCCCAATGGACACTGATTCAGAGTCAGCAAGCCGCTTACAGATG
ATTCTGAATGAGATTCAGCCTCGAGATACTAATGATTATTTTAACCAAGCCAAAATATTGAAAGAACATGATAGCTTTGATATGAAGGAC
TTGAATGCTAGTGTGGTGAATATTGATACTTCTACAGAAATCAAAGGTAAAGAAGTAAAAACATGTGATGTAACTGCGCAGATGGTGCTG
GTATGTTGTTGGAGAAGTATGAAGGAAGTTGCTTTACTTTTAGGCATGTTGTGCCAGCTTCTGCCCATGCAGCCTGTGCCAGAATCTTCT
GATGGATTATTGACGGTGGAGCAGGTAAAAGAAATAGGAGATTACTTTAAACAACACCTTTTGCAGTCCAGGCACAGAGGAGCATTTGAA
TTGGCTTATACTGGTTTTGTGAAACTCACTGAAGTACTAAACAGGTGCCCAAATGTGAGTCTGCAAAAGCTGCCAGAACAGTGGCTATGG
AGTGTTTTAGAGGAAATTAAATGCAGTGATCCTTCATCTAAACTCTGTGCTACAAGGCGCAGTGCTGGAATTCCTTTCTACATACAGGCA
CTGTTGGCATCTGAACCAAAGAAAGGCAGAATGGATTTGTTGAAAATAACAATGAAAGAGTTAATCTCTTTGGCTGGGCCTACAGATGAC
ATACAGAGTACAGTCCCCCAGGTTCATGCTTTAAATATCCTTAGAGCATTGTTCAGAGATACGCGCCTGGGAGAAAATATTATTCCTTAT
GTTGCTGATGGAGCTAAGGCTGCAATTCTGGGTTTTACATCACCGGTCTGGGCAGTGCGAAATTCATCCACACTTCTCTTTAGTGCCTTG
ATCACAAGAATTTTTGGAGTTAAAAGGGCAAAGGATGAACATTCCAAAACAAATAGAATGACAGGGAGAGAGTTTTTCTCTCGTTTCCCA
GAACTCTATCCTTTTCTTCTCAAACAGTTGGAAACTGTAGCCAATACAGTAGACAGTGATATGGGAGAACCAAATCGTCATCCAAGCATG
TTTCTCTTACTTTTGGTGTTGGAGAGACTCTACGCTTCCCCGATGGATGGTACTTCTTCTGCTCTCAGCATGGGACCTTTTGTTCCCTTC
ATTATGAGGTGTGGTCACTCACCTGTCTACCACTCCCGTGAAATGGCAGCTCGTGCCTTGGTCCCATTTGTTATGATAGATCACATTCCT
AATACCATTCGAACTCTGTTGTCCACACTCCCCAGCTGCACTGACCAGTGTTTCCGGCAAAACCACATTCATGGGACACTTCTCCAGGAT
TCGGAAACTTCAGATACGAAATATCCCGCCTCATTTACAGTGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAGCTG
TGAGCAAGTGAACACTGACTCGGAAACTGCAGTTGTAAATGTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACTGAA
TGGATTTCAGTTAGAGAATTTCACCTTGAAAGTAGCCTATATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCGAGG
TCGCCGGGGGCTTGGGCAGAGGGGCTCCTCAAGGCAGGGGTCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCGCCT
GCTGGTTCCCACCCAATTTGTTGGAGCCATCATAGGAAAAGAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAATCGA
TGTCCACCGTAAAGAAAATGCGGGGGCTGCTGAGAAGTCGATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTCTAT
TCTGGAGATTATGCATAAGGAAGCTCAAGATATAAAATTCACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGGACG
TCTTATTGGTAAAGAAGGAAGAAATCTTAAAAAAATTGAGCAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGACGCT
GTATAATCCAGAACGCACTATTACAGTTAAAGGCAATGTTGAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGAGTC
TTATGAAAATGATATTGCTTCTATGAATCTTCAAGCACATTTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCACTTC
AGGGATGCCACCTCCCACCTCAGGGCCCCCTTCAGCCATGACTCCTCCCTACCCGCAGTTTGAGCAATCAGAAACGGAGACTGTTCATCT
GTTTATCCCAGCTCTATCAGTCGGTGCCATCATCGGCAAGCAGGGCCAGCACATCAAGCAGCTTTCTCGCTTTGCTGGAGCTTCAATTAA
GATTGCTCCAGCGGAAGCACCAGATGCTAAAGTGAGGATGGTGATTATCACTGGACCACCAGAGGCTCAGTTCAAGGCTCAGGGAAGAAT
TTATGGAAAAATTAAAGAAGAAAACTTTGTTAGTCCTAAAGAAGAGGTGAAACTTGAAGCTCATATCAGAGTGCCATCCTTTGCTGCTGG
CAGAGTTATTGGAAAAGGAGGCAAAACGGTGAATGAACTTCAGAATTTGTCAAGTGCAGAAGTTGTTGTCCCTCGTGACCAGACACCTGA
TGAGAATGACCAAGTGGTTGTCAAAATAACTGGTCACTTCTATGCTTGCCAGGTTGCCCAGAGAAAAATTCAGGAAATTCTGACTCAGGT

>In-frame_THADA_ENST00000415080_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_1504nt
GATTCGGAAACTTCAGATACGAAATATCCCGCCTCATTTACAGTGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAG
CTGTGAGCAAGTGAACACTGACTCGGAAACTGCAGTTGTAAATGTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACT
GAATGGATTTCAGTTAGAGAATTTCACCTTGAAAGTAGCCTATATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCG
AGGTCGCCGGGGGCTTGGGCAGAGGGGCTCCTCAAGGCAGGGGTCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCG
CCTGCTGGTTCCCACCCAATTTGTTGGAGCCATCATAGGAAAAGAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAAT
CGATGTCCACCGTAAAGAAAATGCGGGGGCTGCTGAGAAGTCGATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTC
TATTCTGGAGATTATGCATAAGGAAGCTCAAGATATAAAATTCACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGG
ACGTCTTATTGGTAAAGAAGGAAGAAATCTTAAAAAAATTGAGCAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGAC
GCTGTATAATCCAGAACGCACTATTACAGTTAAAGGCAATGTTGAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGA
GTCTTATGAAAATGATATTGCTTCTATGAATCTTCAAGCACATTTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCAC
TTCAGGGATGCCACCTCCCACCTCAGGGCCCCCTTCAGCCATGACTCCTCCCTACCCGCAGTTTGAGCAATCAGAAACGGAGACTGTTCA
TCTGTTTATCCCAGCTCTATCAGTCGGTGCCATCATCGGCAAGCAGGGCCAGCACATCAAGCAGCTTTCTCGCTTTGCTGGAGCTTCAAT
TAAGATTGCTCCAGCGGAAGCACCAGATGCTAAAGTGAGGATGGTGATTATCACTGGACCACCAGAGGCTCAGTTCAAGGCTCAGGGAAG
AATTTATGGAAAAATTAAAGAAGAAAACTTTGTTAGTCCTAAAGAAGAGGTGAAACTTGAAGCTCATATCAGAGTGCCATCCTTTGCTGC
TGGCAGAGTTATTGGAAAAGGAGGCAAAACGGTGAATGAACTTCAGAATTTGTCAAGTGCAGAAGTTGTTGTCCCTCGTGACCAGACACC
TGATGAGAATGACCAAGTGGTTGTCAAAATAACTGGTCACTTCTATGCTTGCCAGGTTGCCCAGAGAAAAATTCAGGAAATTCTGACTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_THADA_ENST00000405975_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_8024nt
GACCCGGTAGTCGACCGTGGACCGCGCTGCGAGCCTCGGAGACGCCGTAGAAGGAGACCTGCTTCCGGGACTGGACCAGGCGCCTGCGAC
TCTTCTCAGACGCCGACGTGCACGAGTGACTACTATTAATTCTATTTAAAATGGGTGTAAAGAAGAAGAAAGAAATGCAAGTTGCTGCGC
TGACCATTTGCCATCAGGACCTTGAAACTTTGAAATCTTTTGCTGATGTGGAAGGGAAAAATCTAGCTTCTTTGCTGTTACATTGTGTGC
AACTCACGGATGGAGTGTCACAAATCCATTATATTAAACAGATTGTGCCTCTGCTGGAGAAAGCAGATAAAAATGGCATGTGTGATCCCA
CTATTCAAAGTTGTTTGGATATCTTAGCAGGCATTTATCTTTCTTTGAGTCTAAAGAATCCCTTGAAGAAAGTATTGGCAAGCTCACTAA
ATAGCCTGCCTGATTTTTTTCTACCTGAGGCTATGCACCGTTTTACTTCTCGTCTTCAGGAAGAATTGAATACTACTGACTTATACTCTT
ACAGGAAAGTTACTGACAATATTTCTTCCTGTATGGAGAACTTTAACTTGGGTAGAGCAAGTGTTAATAATCTGCTTAAAAATGTGCTTC
ATTTTCTGCAGAAGAGTTTAATTGAAATCCTGGAAGAAAATAGAAAATGTGCTGGAAATCATATTATTCAAACACAGTTGATGAATGACT
TACTGGTAGGCATTAGAGTTTCAATGATGTTAGTACAGAAAGTACAAGATTTCCAGGGAAATCTTTGGAAGACTTCCGATTCTCCCATAT
GGCAAAATATGTGTGGATTGCTGAGTATTTTTACCAAGGTTTTAAGCGATGATGATCTGTTACAGACTGTACAGAGCACATCTGGATTAG
CTATTATTCTTTTTATTAAGACTATGTTTCACCCGTCTGAAAAGATTCCTCATTTGATTAGCAGTGTGCTGCTTCGTTCAGTGGACTGCA
CCAGTGTCCCCGAGTGGTTTATGAGCAGCTGCAGGAGCCTCTGTTGTGGTGACATCTCTCAGTCAGCTGTCTTATTCCTCTGTCAGGGGA
CACTTGCCATGTTGGACTGGCAGAACGGAAGCATGGGTCGGAGTGGGGAGGCCCTGCTCTTGGATACTGCACATGTTTTGTTCACCTTGA
GTTCACAGATTAAAGAGCCAACGCTGGAAATGTTTCTGTCTAGAATCTTAGCATCCTGGACTAATTCAGCCATACAAGTCCTTGAATCAA
GTTCCCCGAGCCTAACGGACAGCCTGAATGGGAATTCAAGTATAGTTGGGAGACTTTTGGAATATGTCTATACCCATTGGGAACATCCAT
TGGATGCTCTGAGACACCAAACCAAAATCATGTTCAAAAACCTTCTCCAAATGCACCGGCTCACTGTGGAAGGTGCAGATTTCGTCCCTG
ATCCTTTCTTTGTGGAATTGACTGAGAGTCTTTTACGATTGGAATGGCATATTAAAGGAAAGTACACGTGCCTTGGTTGTTTGGTAGAGT
GCATAGGAGTTGAACATATTTTGGCTATAGATAAAACTATTCCATCTCAAATCTTAGAGGTGATGGGAGACCAGTCATTGGTACCTTATG
CAAGTGACCTCTTGGAAACCATGTTTAGAAATCATAAGAGTCATTTGAAATCCCAGACTGCTGAGAGTTCTTGGATTGACCAGTGGCATG
AGACTTGGGTTTCTCCTCTCCTTTTTATATTGTGTGAAGGAAACTTGGATCAAAAATCTTACGTGATTGATTATTACTTGCCAAAATTAT
TAAGTTACAGCCCTGAAAGCTTACAGTACATGGTAAAGATTCTTCAGACTTCTATTGATGCTAAAACTGGACAAGAGCAATCTTTCCCAT
CCTTAGGGTCTTGTAATAGCAGGGGGGCTCTGGGAGCTTTGATGGCATGTCTGCGAATAGCTAGAGCTCATGGACATCTTCAGTCTGCAA
CTGATACCTGGGAGAACCTCGTGTCTGATGCAAGAATAAAGCAAGGCTTAATTCATCAGCATTGCCAAGTAAGGATAGATACATTAGGCT
TGCTTTGTGAAAGTAATCGGAGCACAGAAATTGTTTCCATGGAAGAAATGCAGTGGATTCAGTTCTTTATTACATACAATCTTAACAGCC
AGTCTCCAGGAGTGCGGCAACAGATCTGTTCTCTTCTTAAAAAGTTGTTTTGTAGGATACAGGAAAGTTCTCAGGTACTTTATAAATTGG
AGCAGAGTAAATCCAAACGTGAACCAGAGAATGAGTTAACCAAACAGCACCCTTCTGTTTCTTTACAGCAGTATAAGAATTTCATGTCAT
CCATTTGTAACAGTCTTTTTGAAGCATTGTTTCCTGGATCTTCCTACTCGACTAGATTTTCAGCTTTAACCATTTTAGGTTCAATAGCTG
AAGTTTTTCATGTCCCAGAAGGCAGAATTTATACAGTATATCAGCTGAGTCATGATATTGATGTTGGTCGTTTCCAAACACTAATGGAAT
GTTTTACCAGCACTTTTGAAGACGTGAAAATTTTAGCATTTGATCTTCTGATGAAGTTATCAAAAACAGCTGTACATTTTCAGGATTCGG
GGAAACTGCAAGGCTTATTTCAGGCAGCATTGGAGCTCAGCACAAGCACCAAACCATACGACTGTGTGACAGCTTCCTACCTGCTGAACT
TCTTAATCTGGCAGGATGCTCTACCGTCATCCTTGTCTGCCTACTTAACTCAGCAAGTTGCATGTGATAATGGAGATAGGCCTGCTGCTG
TGGTGGAAAGGAACACATTAATGGTTATCAAATGCTTGATGGAAAATCTTGAGGAAGAAGTATCTCAGGCTGAAAATTCTCTGCTTCAGG
CAGCAGCAGCATTTCCAATGTATGGGCGAGTCCACTGTATAACAGGAGCTTTGCAGAAGTTATCTCTAAACAGCCTGCAGTTGGTGAGCG
AGTGGAGACCTGTGGTAGAGAAGCTCCTTTTGATGTCCTACAGGCTTTCCACTGTGGTGTCTCCAGTCATTCAGAGCTCATCCCCTGAAG
GCCTCATCCCAATGGACACTGATTCAGAGTCAGCAAGCCGCTTACAGATGATTCTGAATGAGATTCAGCCTCGAGATACTAATGATTATT
TTAACCAAGCCAAAATATTGAAAGAACATGATAGCTTTGATATGAAGGACTTGAATGCTAGTGTGGTGAATATTGATACTTCTACAGAAA
TCAAAGGTAAAGAAGTAAAAACATGTGATGTAACTGCGCAGATGGTGCTGGTATGTTGTTGGAGAAGTATGAAGGAAGTTGCTTTACTTT
TAGGCATGTTGTGCCAGCTTCTGCCCATGCAGCCTGTGCCAGAATCTTCTGATGGATTATTGACGGTGGAGCAGGTAAAAGAAATAGGAG
ATTACTTTAAACAACACCTTTTGCAGTCCAGGCACAGAGGAGCATTTGAATTGGCTTATACTGGTTTTGTGAAACTCACTGAAGTACTAA
ACAGGTGCCCAAATGTGAGTCTGCAAAAGCTGCCAGAACAGTGGCTATGGAGTGTTTTAGAGGAAATTAAATGCAGTGATCCTTCATCTA
AACTCTGTGCTACAAGGCGCAGTGCTGGAATTCCTTTCTACATACAGGCACTGTTGGCATCTGAACCAAAGAAAGGCAGAATGGATTTGT
TGAAAATAACAATGAAAGAGTTAATCTCTTTGGCTGGGCCTACAGATGACATACAGAGTACAGTCCCCCAGGTTCATGCTTTAAATATCC
TTAGAGCATTGTTCAGAGATACGCGCCTGGGAGAAAATATTATTCCTTATGTTGCTGATGGAGCTAAGGCTGCAATTCTGGGTTTTACAT
CACCGGTCTGGGCAGTGCGAAATTCATCCACACTTCTCTTTAGTGCCTTGATCACAAGAATTTTTGGAGTTAAAAGGGCAAAGGATGAAC
ATTCCAAAACAAATAGAATGACAGGGAGAGAGTTTTTCTCTCGTTTCCCAGAACTCTATCCTTTTCTTCTCAAACAGTTGGAAACTGTAG
CCAATACAGTAGACAGTGATATGGGAGAACCAAATCGTCATCCAAGCATGTTTCTCTTACTTTTGGTGTTGGAGAGACTCTACGCTTCCC
CGATGGATGGTACTTCTTCTGCTCTCAGCATGGGACCTTTTGTTCCCTTCATTATGAGGTGTGGTCACTCACCTGTCTACCACTCCCGTG
AAATGGCAGCTCGTGCCTTGGTCCCATTTGTTATGATAGATCACATTCCTAATACCATTCGAACTCTGTTGTCCACACTCCCCAGCTGCA
CTGACCAGTGTTTCCGGCAAAACCACATTCATGGGACACTTCTCCAGGATTCGGAAACTTCAGATACGAAATATCCCGCCTCATTTACAG
TGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAGCTGTGAGCAAGTGAACACTGACTCGGAAACTGCAGTTGTAAAT
GTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACTGAATGGATTTCAGTTAGAGAATTTCACCTTGAAAGTAGCCTAT
ATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCGAGGTCGCCGGGGGCTTGGGCAGAGGGGCTCCTCAAGGCAGGGG
TCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCGCCTGCTGGTTCCCACCCAATTTGTTGGAGCCATCATAGGAAAA
GAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAATCGATGTCCACCGTAAAGAAAATGCGGGGGCTGCTGAGAAGTCG
ATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTCTATTCTGGAGATTATGCATAAGGAAGCTCAAGATATAAAATTC
ACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGGACGTCTTATTGGTAAAGAAGGAAGAAATCTTAAAAAAATTGAG
CAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGACGCTGTATAATCCAGAACGCACTATTACAGTTAAAGGCAATGTT
GAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGAGTCTTATGAAAATGATATTGCTTCTATGAATCTTCAAGCACAT
TTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCACTTCAGGGATGCCACCTCCCACCTCAGGGCCCCCTTCAGCCATG
ACTCCTCCCTACCCGCAGTTTGAGCAATCAGAAACGGAGACTGTTCATCTGTTTATCCCAGCTCTATCAGTCGGTGCCATCATCGGCAAG
CAGGGCCAGCACATCAAGCAGCTTTCTCGCTTTGCTGGAGCTTCAATTAAGATTGCTCCAGCGGAAGCACCAGATGCTAAAGTGAGGATG
GTGATTATCACTGGACCACCAGAGGCTCAGTTCAAGGCTCAGGGAAGAATTTATGGAAAAATTAAAGAAGAAAACTTTGTTAGTCCTAAA
GAAGAGGTGAAACTTGAAGCTCATATCAGAGTGCCATCCTTTGCTGCTGGCAGAGTTATTGGAAAAGGAGGCAAAACGGTGAATGAACTT
CAGAATTTGTCAAGTGCAGAAGTTGTTGTCCCTCGTGACCAGACACCTGATGAGAATGACCAAGTGGTTGTCAAAATAACTGGTCACTTC
TATGCTTGCCAGGTTGCCCAGAGAAAAATTCAGGAAATTCTGACTCAGGTAAAGCAGCACCAACAACAGAAGGCTCTGCAAAGTGGACCA
CCTCAGTCAAGACGGAAGTAAAGGCTCAGGAAACAGCCCACCACAGAGGCAGATGCCAAACCAAAGACAGATTGCTTAACCAACAGATGG
GCGCTGACCCCCTATCCAGAATCACATGCACAAGTTTTTACCTAGCCAGTTGTTTCTGAGGACCAGGCAACTTTTGAACTCCTGTCTCTG
TGAGAATGTATACTTTATGCTCTCTGAAATGTATGACACCCAGCTTTAAAACAAACAAACAAACAAACAAAAAAAGGGTGGGGGAGGGAG
GGAAAGAGAAGAGCTCTGCACTTCCCTTTGTTGTAGTCTCACAGTATAACAGATATTCTAATTCTTCTTAATATTCCCCCATAATGCCAG
AAATTGGCTTAATGATGCTTTCACTAAATTCATCAAATAGATTGCTCCTAAATCCAATTGTTAAAATTGGATCAGAATAATTATCACAGG
AACTTAAATGTTAAGCCATTAGCATAGAAAAACTGTTCTCAGTTTTATTTTTACCTAACACTAACATGAGTAACCTAAGGGAAGTGCTGA
ATGGTGTTGGCAGGGGTATTAAACGTGCATTTTTACTCAACTACCTCAGGTATTCAGTAATACAATGAAAAGCAAAATTGTTCCTTTTTT
TTGAAAATTTTATATACTTTATAATGATAGAAGTCCAACCGTTTTTTAAAAAATAAATTTAAAATTTAACAGCAATCAGCTAACAGGCAA
ATTAAGATTTTTACTTCTGGCTGGTGACAGTAAAGCTGGAAAATTAATTTCAGGGTTTTTTGAGGCTTTTGACACAGTTATTAGTTAAAT
CAAATGTTCAAAAATACGGAGCAGTGCCTAGTATCTGGAGAGCAGCACTACCATTTATTCTTTCATTTATAGTTGGGAAAGTTTTTGACG
GTACTAACAAAGTGGTCGCAGGAGATTTTGGAACGGCTGGTTTAAATGGCTTCAGGAGACTTCAGTTTTTTGTTTAGCTACATGATTGAA
TGCATAATAAATGCTTTGTGCTTCTGACTATCAATACCTAAAGAAAGTGCATCAGTGAAGAGATGCAAGACTTTCAACTGACTGGCAAAA
AGCAAGCTTTAGCTTGTCTTATAGGATGCTTAGTTTGCCACTACACTTCAGACCAATGGGACAGTCATAGATGGTGTGACAGTGTTTAAA
CGCAACAAAAGGCTACATTTCCATGGGGCCAGCACTGTCATGAGCCTCACTAAGCTATTTTGAAGATTTTTAAGCACTGATAAATTAAAA
AAAAAAAATTAGACTCCACCTTAAGTAGTAAAGTATAACAGGATTTCTGTATACTGTGCAATCAGTTCTTTGAAAAAAAAGTCAAAAGAT
AGAGAATACAAGAAAAGTTTTTGGGATATAATTTGAATGACTGTGAAAACATATGACCTTTGATAACGAACTCATTTGCTCACTCCTTGA
CAGCAAAGCCCAGTACGTACAATTGTGTTGGGTGTGGGTGGTCTCCAAGGCCACGCTGCTCTCTGAATTGATTTTTTGAGTTTTGTTTGT
AAGATGATCACAGTCATGTTACACTGATCTAAAGGACATATATATAACCCTTTAAAAAAAAAATCACTGCCTCATTCTTATTTCAAGATG
AATTTCTATACAGACTAGATGTTTTTCTGAAGATCAATTAGACATTTTGAAAATGATTTAAAGTGTTTTCCTTAATGTTCTCTGAAAACA
AGTTTCTTTTGTAGTTTTAACCAAAAAAGTGCCCTTTTTGTCACTGGATTCTCCTAGCATTCATGATTTTTTTTTCATACAATGAATTAA
AATTGCTAAAATCATGGACTGGCTTTCTGGTTGGATTTCAGGTAAGATGTGTTTAAGGCCAGAGCTTTTCTCAGTATTTGATTTTTTTCC
CCAATATTTGATTTTTTAAAAATATACACATAGGTGCTGCATTTATATCTGCTGGTTTAAATTCTGTCATATTTCACTTCTAGCCTTTTA
GTATGGCAAATCATATTTTACTTTTACTTAAGCATTTGTAATTTGGAGTATCTGGTACTAGCTAAGAAATAATTCTATAATTGAGTTTTG
TACTCACCATATATGGATCATTCCTCATGTATAATGTGCCCCAAATGCAGCTTCATTTTCCAGATACCTTGACGCAGAATAAATTTTTTC

>In-frame_THADA_ENST00000415080_chr2_43625110_-_IGF2BP3_ENST00000258729_chr7_23458443_-_7937nt
GACCCGGTAGTCGACCGTGGACCGCGCTGCGAGCCTCGGAGACGCCGTAGAAGGAGACCTGCTTCCGGGACTGGACCAGGCGCCTGCGAC
TCTTCTCAGACGCCGACGTGCACGAGTGACTACTATTAATTCTATTTAAAATGGGTGTAAAGAAGAAGAAAGAAATGCAAGTTGCTGCGC
TGACCATTTGCCATCAGGACCTTGAAACTTTGAAATCTTTTGCTGATGTGGAAGGGAAAAATCTAGCTTCTTTGCTGTTACATTGTGTGC
AACTCACGGATGGAGTGTCACAAATCCATTATATTAAACAGATTGTGCCTCTGCTGGAGAAAGCAGATAAAAATGGCATGTGTGATCCCA
CTATTCAAAGTTGTTTGGATATCTTAGCAGGCATTTATCTTTCTTTGAGTCTAAAGAATCCCTTGAAGAAAGTATTGGCAAGCTCACTAA
ATAGCCTGCCTGATTTTTTTCTACCTGAGGCTATGCACCGTTTTACTTCTCGTCTTCAGGAAGAATTGAATACTACTGACTTATACTCTT
ACAGGAAAGTTACTGACAATATTTCTTCCTGTATGGAGAACTTTAACTTGGGTAGAGCAAGTGTTAATAATCTGCTTAAAAATGTGCTTC
ATTTTCTGCAGAAGAGTTTAATTGAAATCCTGGAAGAAAATAGAAAATGTGCTGGAAATCATATTATTCAAACACAGTTGATGAATGACT
TACTGGTAGGCATTAGAGTTTCAATGATGTTAGTACAGAAAGTACAAGATTTCCAGGGAAATCTTTGGAAGACTTCCGATTCTCCCATAT
GGCAAAATATGTGTGGATTGCTGAGTATTTTTACCAAGGTTTTAAGCGATGATGATCTGTTACAGACTGTACAGAGCACATCTGGATTAG
CTATTATTCTTTTTATTAAGACTATGTTTCACCCGTCTGAAAAGATTCCTCATTTGATTAGCAGTGTGCTGCTTCGTTCAGTGGACTGCA
CCAGTGTCCCCGAGTGGTTTATGAGCAGCTGCAGGAGCCTCTGTTGTGGTGACATCTCTCAGTCAGCTGTCTTATTCCTCTGTCAGGGGA
CACTTGCCATGTTGGACTGGCAGAACGGAAGCATGGGTCGGAGTGGGGAGGCCCTGCTCTTGGATACTGCACATGTTTTGTTCACCTTGA
GTTCACAGATTAAAGAGCCAACGCTGGAAATGTTTCTGTCTAGAATCTTAGCATCCTGGACTAATTCAGCCATACAAGTCCTTGAATCAA
GTTCCCCGAGCCTAACGGACAGCCTGAATGGGAATTCAAGTATAGTTGGGAGACTTTTGGAATATGTCTATACCCATTGGGAACATCCAT
TGGATGCTCTGAGACACCAAACCAAAATCATGTTCAAAAACCTTCTCCAAATGCACCGGCTCACTGTGGAAGGTGCAGATTTCGTCCCTG
ATCCTTTCTTTGTGGAATTGACTGAGAGTCTTTTACGATTGGAATGGCATATTAAAGGAAAGTACACGTGCCTTGGTTGTTTGGTAGAGT
GCATAGGAGTTGAACATATTTTGGCTATAGATAAAACTATTCCATCTCAAATCTTAGAGGTGATGGGAGACCAGTCATTGGTACCTTATG
CAAGTGACCTCTTGGAAACCATGTTTAGAAATCATAAGAGTCATTTGAAATCCCAGACTGCTGAGAGTTCTTGGATTGACCAGTGGCATG
AGACTTGGGTTTCTCCTCTCCTTTTTATATTGTGTGAAGGAAACTTGGATCAAAAATCTTACGTGATTGATTATTACTTGCCAAAATTAT
TAAGTTACAGCCCTGAAAGCTTACAGTACATGGTAAAGATTCTTCAGACTTCTATTGATGCTAAAACTGGACAAGAGCAATCTTTCCCAT
CCTTAGGGTCTTGTAATAGCAGGGGGGCTCTGGGAGCTTTGATGGCATGTCTGCGAATAGCTAGAGCTCATGGACATCTTCAGTCTGCAA
CTGATACCTGGGAGAACCTCGTGTCTGATGCAAGAATAAAGCAAGGCTTAATTCATCAGCATTGCCAAGTAAGGATAGATACATTAGGCT
TGCTTTGTGAAAGTAATCGGAGCACAGAAATTGTTTCCATGGAAGAAATGCAGTGGATTCAGTTCTTTATTACATACAATCTTAACAGCC
AGTCTCCAGGAGTGCGGCAACAGATCTGTTCTCTTCTTAAAAAGTTGTTTTGTAGGATACAGGAAAGTTCTCAGGTACTTTATAAATTGG
AGCAGAGTAAATCCAAACGTGAACCAGAGAATGAGTTAACCAAACAGCACCCTTCTGTTTCTTTACAGCAGTATAAGAATTTCATGTCAT
CCATTTGTAACAGTCTTTTTGAAGCATTGTTTCCTGGATCTTCCTACTCGACTAGATTTTCAGCTTTAACCATTTTAGGTTCAATAGCTG
AAGTTTTTCATGTCCCAGAAGGCAGAATTTATACAGTATATCAGCTGAGTCATGATATTGATGTTGGTCGTTTCCAAACACTAATGGAAT
GTTTTACCAGCACTTTTGAAGACGTGAAAATTTTAGCATTTGATCTTCTGATGAAGTTATCAAAAACAGCTGTACATTTTCAGGATTCGG
GGAAACTGCAAGGCTTATTTCAGGCAGCATTGGAGCTCAGCACAAGCACCAAACCATACGACTGTGTGACAGCTTCCTACCTGCTGAACT
TCTTAATCTGGCAGGATGCTCTACCGTCATCCTTGTCTGCCTACTTAACTCAGCAAGTTGCATGTGATAATGGAGATAGGCCTGCTGCTG
TGGTGGAAAGGAACACATTAATGGTTATCAAATGCTTGATGGAAAATCTTGAGGAAGAAGTATCTCAGGCTGAAAATTCTCTGCTTCAGG
CAGCAGCAGCATTTCCAATGTATGGGCGAGTCCACTGTATAACAGGAGCTTTGCAGAAGTTATCTCTAAACAGCCTGCAGTTGGTGAGCG
AGTGGAGACCTGTGGTAGAGAAGCTCCTTTTGATGTCCTACAGGCTTTCCACTGTGGTGTCTCCAGTCATTCAGAGCTCATCCCCTGAAG
GCCTCATCCCAATGGACACTGATTCAGAGTCAGCAAGCCGCTTACAGATGATTCTGAATGAGATTCAGCCTCGAGATACTAATGATTATT
TTAACCAAGCCAAAATATTGAAAGAACATGATAGCTTTGATATGAAGGACTTGAATGCTAGTGTGGTGAATATTGATACTTCTACAGAAA
TCAAAGGTAAAGAAGTAAAAACATGTGATGTAACTGCGCAGATGGTGCTGGTATGTTGTTGGAGAAGTATGAAGGAAGTTGCTTTACTTT
TAGGCATGTTGTGCCAGCTTCTGCCCATGCAGCCTGTGCCAGAATCTTCTGATGGATTATTGACGGTGGAGCAGGTAAAAGAAATAGGAG
ATTACTTTAAACAACACCTTTTGCAGTCCAGGCACAGAGGAGCATTTGAATTGGCTTATACTGGTTTTGTGAAACTCACTGAAGTACTAA
ACAGGTGCCCAAATGTGAGTCTGCAAAAGCTGCCAGAACAGTGGCTATGGAGTGTTTTAGAGGAAATTAAATGCAGTGATCCTTCATCTA
AACTCTGTGCTACAAGGCGCAGTGCTGGAATTCCTTTCTACATACAGGCACTGTTGGCATCTGAACCAAAGAAAGGCAGAATGGATTTGT
TGAAAATAACAATGAAAGAGTTAATCTCTTTGGCTGGGCCTACAGATGACATACAGAGTACAGTCCCCCAGGTTCATGCTTTAAATATCC
TTAGAGCATTGTTCAGAGATACGCGCCTGGGAGAAAATATTATTCCTTATGTTGCTGATGGAGCTAAGGCTGCAATTCTGGGTTTTACAT
CACCGGTCTGGGCATCTCAAATGACAGGGAGAGAGTTTTTCTCTCGTTTCCCAGAACTCTATCCTTTTCTTCTCAAACAGTTGGAAACTG
TAGCCAATACAGTAGACAGTGATATGGGAGAACCAAATCGTCATCCAAGCATGTTTCTCTTACTTTTGGTGTTGGAGAGACTCTACGCTT
CCCCGATGGATGGTACTTCTTCTGCTCTCAGCATGGGACCTTTTGTTCCCTTCATTATGAGGTGTGGTCACTCACCTGTCTACCACTCCC
GTGAAATGGCAGCTCGTGCCTTGGTCCCATTTGTTATGATAGATCACATTCCTAATACCATTCGAACTCTGTTGTCCACACTCCCCAGCT
GCACTGACCAGTGTTTCCGGCAAAACCACATTCATGGGACACTTCTCCAGGATTCGGAAACTTCAGATACGAAATATCCCGCCTCATTTA
CAGTGGGAGGTGCTGGATAGTTTACTAGTCCAGTATGGAGTGGTGGAGAGCTGTGAGCAAGTGAACACTGACTCGGAAACTGCAGTTGTA
AATGTAACCTATTCCAGTAAGGACCAAGCTAGACAAGCACTAGACAAACTGAATGGATTTCAGTTAGAGAATTTCACCTTGAAAGTAGCC
TATATCCCTGATGAAATGGCCGCCCAGCAAAACCCCTTGCAGCAGCCCCGAGGTCGCCGGGGGCTTGGGCAGAGGGGCTCCTCAAGGCAG
GGGTCTCCAGGATCCGTATCCAAGCAGAAACCATGTGATTTGCCTCTGCGCCTGCTGGTTCCCACCCAATTTGTTGGAGCCATCATAGGA
AAAGAAGGTGCCACCATTCGGAACATCACCAAACAGACCCAGTCTAAAATCGATGTCCACCGTAAAGAAAATGCGGGGGCTGCTGAGAAG
TCGATTACTATCCTCTCTACTCCTGAAGGCACCTCTGCGGCTTGTAAGTCTATTCTGGAGATTATGCATAAGGAAGCTCAAGATATAAAA
TTCACAGAAGAGATCCCCTTGAAGATTTTAGCTCATAATAACTTTGTTGGACGTCTTATTGGTAAAGAAGGAAGAAATCTTAAAAAAATT
GAGCAAGACACAGACACTAAAATCACGATATCTCCATTGCAGGAATTGACGCTGTATAATCCAGAACGCACTATTACAGTTAAAGGCAAT
GTTGAGACATGTGCCAAAGCTGAGGAGGAGATCATGAAGAAAATCAGGGAGTCTTATGAAAATGATATTGCTTCTATGAATCTTCAAGCA
CATTTAATTCCTGGATTAAATCTGAACGCCTTGGGTCTGTTCCCACCCACTTCAGGGATGCCACCTCCCACCTCAGGGCCCCCTTCAGCC
ATGACTCCTCCCTACCCGCAGTTTGAGCAATCAGAAACGGAGACTGTTCATCTGTTTATCCCAGCTCTATCAGTCGGTGCCATCATCGGC
AAGCAGGGCCAGCACATCAAGCAGCTTTCTCGCTTTGCTGGAGCTTCAATTAAGATTGCTCCAGCGGAAGCACCAGATGCTAAAGTGAGG
ATGGTGATTATCACTGGACCACCAGAGGCTCAGTTCAAGGCTCAGGGAAGAATTTATGGAAAAATTAAAGAAGAAAACTTTGTTAGTCCT
AAAGAAGAGGTGAAACTTGAAGCTCATATCAGAGTGCCATCCTTTGCTGCTGGCAGAGTTATTGGAAAAGGAGGCAAAACGGTGAATGAA
CTTCAGAATTTGTCAAGTGCAGAAGTTGTTGTCCCTCGTGACCAGACACCTGATGAGAATGACCAAGTGGTTGTCAAAATAACTGGTCAC
TTCTATGCTTGCCAGGTTGCCCAGAGAAAAATTCAGGAAATTCTGACTCAGGTAAAGCAGCACCAACAACAGAAGGCTCTGCAAAGTGGA
CCACCTCAGTCAAGACGGAAGTAAAGGCTCAGGAAACAGCCCACCACAGAGGCAGATGCCAAACCAAAGACAGATTGCTTAACCAACAGA
TGGGCGCTGACCCCCTATCCAGAATCACATGCACAAGTTTTTACCTAGCCAGTTGTTTCTGAGGACCAGGCAACTTTTGAACTCCTGTCT
CTGTGAGAATGTATACTTTATGCTCTCTGAAATGTATGACACCCAGCTTTAAAACAAACAAACAAACAAACAAAAAAAGGGTGGGGGAGG
GAGGGAAAGAGAAGAGCTCTGCACTTCCCTTTGTTGTAGTCTCACAGTATAACAGATATTCTAATTCTTCTTAATATTCCCCCATAATGC
CAGAAATTGGCTTAATGATGCTTTCACTAAATTCATCAAATAGATTGCTCCTAAATCCAATTGTTAAAATTGGATCAGAATAATTATCAC
AGGAACTTAAATGTTAAGCCATTAGCATAGAAAAACTGTTCTCAGTTTTATTTTTACCTAACACTAACATGAGTAACCTAAGGGAAGTGC
TGAATGGTGTTGGCAGGGGTATTAAACGTGCATTTTTACTCAACTACCTCAGGTATTCAGTAATACAATGAAAAGCAAAATTGTTCCTTT
TTTTTGAAAATTTTATATACTTTATAATGATAGAAGTCCAACCGTTTTTTAAAAAATAAATTTAAAATTTAACAGCAATCAGCTAACAGG
CAAATTAAGATTTTTACTTCTGGCTGGTGACAGTAAAGCTGGAAAATTAATTTCAGGGTTTTTTGAGGCTTTTGACACAGTTATTAGTTA
AATCAAATGTTCAAAAATACGGAGCAGTGCCTAGTATCTGGAGAGCAGCACTACCATTTATTCTTTCATTTATAGTTGGGAAAGTTTTTG
ACGGTACTAACAAAGTGGTCGCAGGAGATTTTGGAACGGCTGGTTTAAATGGCTTCAGGAGACTTCAGTTTTTTGTTTAGCTACATGATT
GAATGCATAATAAATGCTTTGTGCTTCTGACTATCAATACCTAAAGAAAGTGCATCAGTGAAGAGATGCAAGACTTTCAACTGACTGGCA
AAAAGCAAGCTTTAGCTTGTCTTATAGGATGCTTAGTTTGCCACTACACTTCAGACCAATGGGACAGTCATAGATGGTGTGACAGTGTTT
AAACGCAACAAAAGGCTACATTTCCATGGGGCCAGCACTGTCATGAGCCTCACTAAGCTATTTTGAAGATTTTTAAGCACTGATAAATTA
AAAAAAAAAAATTAGACTCCACCTTAAGTAGTAAAGTATAACAGGATTTCTGTATACTGTGCAATCAGTTCTTTGAAAAAAAAGTCAAAA
GATAGAGAATACAAGAAAAGTTTTTGGGATATAATTTGAATGACTGTGAAAACATATGACCTTTGATAACGAACTCATTTGCTCACTCCT
TGACAGCAAAGCCCAGTACGTACAATTGTGTTGGGTGTGGGTGGTCTCCAAGGCCACGCTGCTCTCTGAATTGATTTTTTGAGTTTTGTT
TGTAAGATGATCACAGTCATGTTACACTGATCTAAAGGACATATATATAACCCTTTAAAAAAAAAATCACTGCCTCATTCTTATTTCAAG
ATGAATTTCTATACAGACTAGATGTTTTTCTGAAGATCAATTAGACATTTTGAAAATGATTTAAAGTGTTTTCCTTAATGTTCTCTGAAA
ACAAGTTTCTTTTGTAGTTTTAACCAAAAAAGTGCCCTTTTTGTCACTGGATTCTCCTAGCATTCATGATTTTTTTTTCATACAATGAAT
TAAAATTGCTAAAATCATGGACTGGCTTTCTGGTTGGATTTCAGGTAAGATGTGTTTAAGGCCAGAGCTTTTCTCAGTATTTGATTTTTT
TCCCCAATATTTGATTTTTTAAAAATATACACATAGGTGCTGCATTTATATCTGCTGGTTTAAATTCTGTCATATTTCACTTCTAGCCTT
TTAGTATGGCAAATCATATTTTACTTTTACTTAAGCATTTGTAATTTGGAGTATCTGGTACTAGCTAAGAAATAATTCTATAATTGAGTT
TTGTACTCACCATATATGGATCATTCCTCATGTATAATGTGCCCCAAATGCAGCTTCATTTTCCAGATACCTTGACGCAGAATAAATTTT


Top

FusionGenePPI for THADA_IGF2BP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
THADACUL3, UBA2, AHCYL1, SRXN1, SSSCA1, SEC24A, SEC23A, SULT1A1, NUBP2, STAM, IGBP1, PSAT1, SIN3A, TES, EGFR, USHBP1, CD274, VSIG2, CA14, LYPD3, SCN2B, ALDH3A2, NTRK1, VASN, TMEM206, TNFRSF1A, OPRM1, SIGLECL1, CHRM4, FZD10, ILVBL, EDNRB, NAA10, CCKBR, CD83, APLNR, MLST8, MTOR, XPO6, XPO4IGF2BP3PUF60, CNBP, HNRNPA1, MEPCE, KHDRBS2, UBC, ELAVL1, SIRT7, CUL3, CDK2, COPS5, CAND1, RAE1, DDX5, LAPTM4A, LGMN, HNRNPUL2, USP16, NDUFAF4, MYC, FN1, CBX6, CBX8, HDAC11, FBXO6, CRYZ, HNRNPA2B1, HNRNPM, HNRNPU, IARS, ABCF1, C14orf166, RTCB, NELFB, YBX3, DDX1, DHX9, DIMT1, EDC4, EIF2B2, EIF2B3, EPRS, FKBP3, FLII, ILF2, MAP2, NMT1, QARS, RFC4, RPL26L1, RPL38, KRT17, MRE11A, PA2G4, RPL23A, WWOX, EIF2AK2, LIN28A, STAU1, MDM2, AURKA, TP53, TUBGCP3, MEOX2, PIH1D2, MOV10, CUL7, OBSL1, CCDC8, NTRK1, G3BP2, IGF2BP1, PDCD6, RPL6, RAB2A, RPL37A, MED20, NPM1, ZNF746, SH3BGR, ELAVL2, GSPT2, MRPS34, HIST1H1E, APOBEC3D, PPAN, RBM3, TRIM25, G3BP1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for THADA_IGF2BP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for THADA_IGF2BP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTHADAC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
TgeneIGF2BP3C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneIGF2BP3C0031149Peritoneal Neoplasms1CTD_human
TgeneIGF2BP3C0345967Malignant mesothelioma1CTD_human