FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37746

FusionGeneSummary for TESC_ASAH1

check button Fusion gene summary
Fusion gene informationFusion gene name: TESC_ASAH1
Fusion gene ID: 37746
HgeneTgene
Gene symbol

TESC

ASAH1

Gene ID

54997

427

Gene nametescalcinN-acylsphingosine amidohydrolase 1
SynonymsCHP3|TSCAC|ACDase|ASAH|PHP|PHP32|SMAPME
Cytomap

12q24.22

8p22

Type of geneprotein-codingprotein-coding
Descriptioncalcineurin B homologous protein 3calcineurin-like EF hand protein 3acid ceramidaseN-acylsphingosine amidohydrolase (acid ceramidase) 1acid CDaseacylsphingosine deacylaseputative 32 kDa heart protein
Modification date2018051920180529
UniProtAcc

Q96BS2

Q13510

Ensembl transtripts involved in fusion geneENST00000335209, ENST00000541210, 
ENST00000392545, ENST00000535198, 
ENST00000262097, ENST00000381733, 
ENST00000417108, ENST00000520781, 
ENST00000314146, ENST00000520051, 
Fusion gene scores* DoF score4 X 4 X 4=646 X 6 X 5=180
# samples 47
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/180*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TESC [Title/Abstract] AND ASAH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTESC

GO:0030854

positive regulation of granulocyte differentiation

20060826

HgeneTESC

GO:0032417

positive regulation of sodium:proton antiporter activity

18321853

HgeneTESC

GO:0050821

protein stabilization

18321853

HgeneTESC

GO:0051604

protein maturation

18321853

HgeneTESC

GO:0071300

cellular response to retinoic acid

20060826

HgeneTESC

GO:0072659

protein localization to plasma membrane

18321853


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-YL-A9WJ-01ATESCchr12

117537030

-ASAH1chr8

17933096

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000335209ENST00000262097TESCchr12

117537030

-ASAH1chr8

17933096

-
In-frameENST00000335209ENST00000381733TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000335209ENST00000417108TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000335209ENST00000520781TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000335209ENST00000314146TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000335209ENST00000520051TESCchr12

117537030

-ASAH1chr8

17933096

-
In-frameENST00000541210ENST00000262097TESCchr12

117537030

-ASAH1chr8

17933096

-
In-frameENST00000541210ENST00000381733TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000541210ENST00000417108TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000541210ENST00000520781TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000541210ENST00000314146TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000541210ENST00000520051TESCchr12

117537030

-ASAH1chr8

17933096

-
In-frameENST00000392545ENST00000262097TESCchr12

117537030

-ASAH1chr8

17933096

-
In-frameENST00000392545ENST00000381733TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000392545ENST00000417108TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000392545ENST00000520781TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000392545ENST00000314146TESCchr12

117537030

-ASAH1chr8

17933096

-
5CDS-5UTRENST00000392545ENST00000520051TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-3CDSENST00000535198ENST00000262097TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-3CDSENST00000535198ENST00000381733TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-5UTRENST00000535198ENST00000417108TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-5UTRENST00000535198ENST00000520781TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-5UTRENST00000535198ENST00000314146TESCchr12

117537030

-ASAH1chr8

17933096

-
intron-5UTRENST00000535198ENST00000520051TESCchr12

117537030

-ASAH1chr8

17933096

-

Top

FusionProtFeatures for TESC_ASAH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TESC

Q96BS2

ASAH1

Q13510

Functions as an integral cofactor in cell pH regulationby controlling plasma membrane-type Na(+)/H(+) exchange activity.Promotes the maturation, transport, cell surface stability andexchange activity of SLC9A1/NHE1 at the plasma membrane. Promotesthe induction of hematopoietic stem cell differentiation towardmegakaryocytic lineage. Essential for the coupling of ERK cascadeactivation with the expression of ETS family genes inmegakaryocytic differentiation. Also involved in granulocyticdifferentiation in a ERK-dependent manner. Inhibits thephosphatase activity of calcineurin. {ECO:0000269|PubMed:17717601,ECO:0000269|PubMed:18321853, ECO:0000269|PubMed:20060826}. Hydrolyzes the sphingolipid ceramide into sphingosineand free fatty acid. {ECO:0000269|PubMed:7744740}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTESCchr12:117537030chr8:17933096ENST00000335209-18123_13419215Calcium bindingOntology_term=ECO:0000255
HgeneTESCchr12:117537030chr8:17933096ENST00000541210-17123_13419188Calcium bindingOntology_term=ECO:0000255
HgeneTESCchr12:117537030chr8:17933096ENST00000335209-18110_14519215DomainEF-hand
HgeneTESCchr12:117537030chr8:17933096ENST00000541210-17110_14519188DomainEF-hand


Top

FusionGeneSequence for TESC_ASAH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_389aa
MGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQRCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGG
G_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQTFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNS
EFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIG
PSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_MVCGTNKL_PLETSLLP__SQNACKDVSEPHQPRETLI_NHV_CPVNKTCPQQA

>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_389aa
MGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQRCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGG
G_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQTFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNS
EFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIG
PSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_MVCGTNKL_PLETSLLP__SQNACKDVSEPHQPRETLI_NHV_CPVNKTCPQQA

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_389aa
MGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQRCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGG
G_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQTFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNS
EFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIG
PSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_MVCGTNKL_PLETSLLP__SQNACKDVSEPHQPRETLI_NHV_CPVNKTCPQQA

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_389aa
MGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQRCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGG
G_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQTFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNS
EFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIG
PSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_MVCGTNKL_PLETSLLP__SQNACKDVSEPHQPRETLI_NHV_CPVNKTCPQQA

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_442aa
MRPRSGPTRNPRLRAFAGVPTRGRTRGQSRRCAAEASAGPERDARPGAPAAGTMGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQ
RCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGGG_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQ
TFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNSEFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE
_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIGPSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_M

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_442aa
MRPRSGPTRNPRLRAFAGVPTRGRTRGQSRRCAAEASAGPERDARPGAPAAGTMGAAHSASEEVRELEGKTGLDRGLQKINLSSFRTNVQ
RCSSMVHHKS_LTTLQKMA_IDA_QGTSAKGTSEFSEETDKYIRAKWKNTAGGG_KIAWPTWQLSWPF_RGNEGTCRCY_TTFRRDTFIQ
TFL_IIYHLYFNSSRRQKRSSNTWEKHGFWSISWVEHK__YLGHN_ATKTFNSEFGFPKKQQNCLQGFKLCWLCGHVNRIQTRTVQSYTE
_TFQTKWWLSGTSRMDSGKERCHVDRVPH_NSSGK_HKL_RSQEFIDQDQDIGPSLLTPGRQPVWGRLCDYTRQKGIIGCI_TRC_AG_M


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_1168nt
ATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCC
TCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCT
TGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGT
GGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTT
AGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACA
TGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGT
GAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGG
ACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCAT
GTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGC
CCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACT
CGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGC
AAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCT

>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_1168nt
ATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCC
TCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCT
TGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGT
GGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTT
AGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACA
TGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGT
GAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGG
ACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCAT
GTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGC
CCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACT
CGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGC
AAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCT

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_1168nt
ATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCC
TCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCT
TGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGT
GGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTT
AGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACA
TGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGT
GAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGG
ACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCAT
GTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGC
CCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACT
CGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGC
AAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCT

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_1168nt
ATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCC
TCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCT
TGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGT
GGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTT
AGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACA
TGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGT
GAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGG
ACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCAT
GTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGC
CCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACT
CGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGC
AAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCT

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_1327nt
ATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGTCCCGC
CGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACTCCGCG
TCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAG
AGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAA
GGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCTGGCCT
ACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCATTCAA
TATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGG
AGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAA
CAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAA
TGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAG
AACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGG
AGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATG
GTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCAC
CAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGAT

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_1327nt
ATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGTCCCGC
CGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACTCCGCG
TCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACGTACAG
AGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTGCTAAA
GGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCTGGCCT
ACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCATTCAA
TATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGATTTTGG
AGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAA
CAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAA
TGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAG
AACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGG
AGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATG
GTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCAC
CAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_2464nt
ACCGCGGCGCGCCGCCCTCCGCCGTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGAC
CCGAGGCCGGACCCGAGGCCAGTCCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGC
GGGCACCATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAA
CCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAAT
TGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGC
AGGTGGTGGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATA
TACCTTTAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATC
TAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTT
TAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCA
AACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAG
ATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGA
TATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTAT
ATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAA
CGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCA
ACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTT
GGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTC
CAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCC
CTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGAC
ATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGT
CTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTT
TTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAG
GGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGT
AATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGC
TAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTA
AATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACT
AAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACT
GTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTG

>In-frame_TESC_ENST00000335209_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_2463nt
ACCGCGGCGCGCCGCCCTCCGCCGTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGAC
CCGAGGCCGGACCCGAGGCCAGTCCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGC
GGGCACCATGGGCGCTGCCCACTCCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAA
CCTATCCTCCTTCAGGACCAACGTACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAAT
TGATGCTTGACAAGGCACCAGTGCTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGC
AGGTGGTGGATGAAAAATTGCCTGGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATA
TACCTTTAGGAGAGATTATTTCATTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATC
TAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTT
TAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCA
AACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAG
ATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGA
TATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTAT
ATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAA
CGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCA
ACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTT
GGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTC
CAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCC
CTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGAC
ATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGT
CTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTT
TTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAG
GGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGT
AATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGC
TAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTA
AATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACT
AAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACT
GTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTG

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_2441nt
GTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGT
CCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACT
CCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACG
TACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTG
CTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCT
GGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCA
TTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGAT
TTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAA
AGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACA
CTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTC
ACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATC
CTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGT
AGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAAC
CGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACC
TTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACA
GAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGG
TTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTT
ACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTC
GAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAA
ACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGT
TAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGT
ATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTT
TATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCAC
GTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATG
TAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTC
AGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCA
AGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTCAGCAGTCA

>In-frame_TESC_ENST00000541210_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_2440nt
GTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGT
CCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACT
CCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACG
TACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTG
CTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCT
GGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCA
TTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGAT
TTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAA
AGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACA
CTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTC
ACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATC
CTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGT
AGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAAC
CGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACC
TTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACA
GAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGG
TTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTT
ACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTC
GAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAA
ACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGT
TAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGT
ATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTT
TATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCAC
GTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATG
TAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTC
AGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCA
AGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTCAGCAGTCA

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000262097_chr8_17933096_-_2441nt
GTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGT
CCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACT
CCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACG
TACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTG
CTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCT
GGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCA
TTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGAT
TTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAA
AGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACA
CTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTC
ACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATC
CTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGT
AGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAAC
CGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACC
TTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACA
GAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGG
TTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTT
ACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTC
GAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAA
ACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGT
TAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGT
ATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTT
TATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCAC
GTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATG
TAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTC
AGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCA
AGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTCAGCAGTCA

>In-frame_TESC_ENST00000392545_chr12_117537030_-_ASAH1_ENST00000381733_chr8_17933096_-_2440nt
GTTATATGAGGCCCCGCTCCGGCCCCACGCGGAACCCGCGGCTCCGAGCCTTCGCCGGCGTCCCGACCCGAGGCCGGACCCGAGGCCAGT
CCCGCCGCTGCGCAGCCGAAGCCAGTGCGGGGCCTGAGAGGGACGCGCGCCCCGGGGCCCCCGCCGCGGGCACCATGGGCGCTGCCCACT
CCGCGTCTGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGCTTGGACAGAGGACTGCAGAAAATCAACCTATCCTCCTTCAGGACCAACG
TACAGAGGTGCAGTTCCATGGTACACCATAAATCTTGACTTACCACCCTACAAAAGATGGCATGAATTGATGCTTGACAAGGCACCAGTG
CTAAAGGTTATAGTGAATTCTCTGAAGAATATGATAAATACATTCGTGCCAAGTGGAAAAATTATGCAGGTGGTGGATGAAAAATTGCCT
GGCCTACTTGGCAACTTTCCTGGCCCTTTTGAAGAGGAAATGAAGGGTATTGCCGCTGTTACTGATATACCTTTAGGAGAGATTATTTCA
TTCAATATTTTTTATGAATTATTTACCATTTGTACTTCAATAGTAGCAGAAGACAAAAAAGGTCATCTAATACATGGGAGAAACATGGAT
TTTGGAGTATTTCTTGGGTGGAACATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAA
AGAAACAACAAAACTGTCTTCAAGGCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACA
CTGAATGAACGTTTCAGTATAAATGGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTC
ACTAGAACAGTTCTGGAAAATAGCACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATC
CTGGGAGGCAACCAGTCTGGGGAAGGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGT
AGATGGTATGTGGTACAAACAAATTATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAAC
CGCACCAGCCAAGAGAATATCTCATTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACC
TTGATAGATGTTACCAAAGGTCAATTCGAAACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACA
GAATGCGGCCTCTGAGACATGAAGACACCATCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGG
TTCTCTTTGAGTCAATAGCTTGTCTTCGTCCATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTT
ACAGATAACTTCTTTAGGGGAAGTAAAACAGTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTC
GAACCATGGTGAACTCCACCTCCGTGGAATAAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAA
ACACTCCACATTCTTCAGTTTTTCACTTCTACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGT
TAAAATTAATATATCATTATCTTTGCTGTTATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGT
ATATTTCTTTTAATGGGCACAAAATGGGCCCTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTT
TATACAATAATTGAAGTGTTCCCTTTTTCATAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCAC
GTTCTGTTAATTTAGTAAATAAACAAGTCAAAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATG
TAATAAACAGGTTTTTAGTTTGTTCTTCAGATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTC
AGAAATCAAACTGCTTATGAAAAGTACTAATAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCA
AGACCGTTTGTCCACTTCATTTTGTATAATCACAGTTGTGTTCCTGACACTCAATAAACAGTCACTGGAAAGAGTGCCAGTCAGCAGTCA


Top

FusionGenePPI for TESC_ASAH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TESCHMG20A, RAI1, CCDC91, DYNLT3, SLC9A1, WBP11, LPAR1, IPPKASAH1SETDB1, TSC22D1, PSMA3, FBXO6, CAMK1D, SRPK1, GSG1, PNKD, AAGAB, AAMP, NEFH, CAMK2B, HSF2, HSPB2, HERC2, CYP1A2, GLT1D1, ZIC1, ZSCAN12, FTH1, NONO, TBC1D22B, SLCO6A1, AIRE, HTATIP2, RNF6, TRMT2A, ZNF684, ZNF556, HMP19, LYPD1, NCDN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TESC_ASAH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TESC_ASAH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneASAH1C0268255Farber Lipogranulomatosis8CTD_human;ORPHANET;UNIPROT
TgeneASAH1C0023794Lipoidosis2CTD_human
TgeneASAH1C1834569Jankovic Rivera syndrome2ORPHANET;UNIPROT
TgeneASAH1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneASAH1C0036341Schizophrenia1PSYGENET
TgeneASAH1C0221765Chronic schizophrenia1PSYGENET