FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37672

FusionGeneSummary for TEAD1_PARVA

check button Fusion gene summary
Fusion gene informationFusion gene name: TEAD1_PARVA
Fusion gene ID: 37672
HgeneTgene
Gene symbol

TEAD1

PARVA

Gene ID

7003

55742

Gene nameTEA domain transcription factor 1parvin alpha
SynonymsAA|NTEF-1|REF1|TCF-13|TCF13|TEAD-1|TEF-1CH-ILKBP|MXRA2
Cytomap

11p15.3

11p15.3

Type of geneprotein-codingprotein-coding
Descriptiontranscriptional enhancer factor TEF-1TEA domain family member 1 (SV40 transcriptional enhancer factor)protein GT-IICtranscription factor 13transcriptional enhancer factor 1alpha-parvinactopaxincalponin-like integrin-linked kinase-binding proteinmatrix-remodeling-associated protein 2
Modification date2018052320180523
UniProtAcc

P28347

Q9NVD7

Ensembl transtripts involved in fusion geneENST00000361905, ENST00000527636, 
ENST00000527575, ENST00000334310, 
ENST00000361985, ENST00000526600, 
ENST00000334956, ENST00000539723, 
ENST00000550549, ENST00000538608, 
ENST00000526746, 
Fusion gene scores* DoF score12 X 7 X 10=8409 X 6 X 7=378
# samples 1511
** MAII scorelog2(15/840*10)=-2.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/378*10)=-1.78088271069641
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TEAD1 [Title/Abstract] AND PARVA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTEAD1

GO:0035329

hippo signaling

18579750|19324877


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-E7-A85H-01ATEAD1chr11

12785981

+PARVAchr11

12549396

+
TCGARVBRCATCGA-E2-A15E-01ATEAD1chr11

12697108

+PARVAchr11

12495292

+
TCGARVBRCATCGA-E2-A15E-06ATEAD1chr11

12697108

+PARVAchr11

12495292

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000361905ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000361905ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000361905ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000361905ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000361905ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
In-frameENST00000527636ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000527636ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000527636ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000527636ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000527636ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
In-frameENST00000527575ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000527575ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000527575ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000527575ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000527575ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
In-frameENST00000334310ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000334310ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000334310ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000334310ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000334310ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
In-frameENST00000361985ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000361985ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
Frame-shiftENST00000361985ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000361985ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
5CDS-intronENST00000361985ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
intron-3CDSENST00000526600ENST00000334956TEAD1chr11

12785981

+PARVAchr11

12549396

+
intron-3CDSENST00000526600ENST00000539723TEAD1chr11

12785981

+PARVAchr11

12549396

+
intron-3CDSENST00000526600ENST00000550549TEAD1chr11

12785981

+PARVAchr11

12549396

+
intron-intronENST00000526600ENST00000538608TEAD1chr11

12785981

+PARVAchr11

12549396

+
intron-intronENST00000526600ENST00000526746TEAD1chr11

12785981

+PARVAchr11

12549396

+
5UTR-3CDSENST00000361905ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000361905ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000361905ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000361905ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000361905ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527636ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527636ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527636ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000527636ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000527636ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527575ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527575ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000527575ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000527575ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000527575ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000334310ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000334310ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-3CDSENST00000334310ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000334310ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
5UTR-5UTRENST00000334310ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000361985ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000361985ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000361985ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-5UTRENST00000361985ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-5UTRENST00000361985ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000526600ENST00000334956TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000526600ENST00000539723TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-3CDSENST00000526600ENST00000550549TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-5UTRENST00000526600ENST00000538608TEAD1chr11

12697108

+PARVAchr11

12495292

+
intron-5UTRENST00000526600ENST00000526746TEAD1chr11

12697108

+PARVAchr11

12495292

+

Top

FusionProtFeatures for TEAD1_PARVA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TEAD1

P28347

PARVA

Q9NVD7

Transcription factor which plays a key role in the Hipposignaling pathway, a pathway involved in organ size control andtumor suppression by restricting proliferation and promotingapoptosis. The core of this pathway is composed of a kinasecascade wherein MST1/MST2, in complex with its regulatory proteinSAV1, phosphorylates and activates LATS1/2 in complex with itsregulatory protein MOB1, which in turn phosphorylates andinactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating geneexpression of YAP1 and WWTR1/TAZ, thereby regulating cellproliferation, migration and epithelial mesenchymal transition(EMT) induction. Binds specifically and cooperatively to the SPHand GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activatestranscription in vivo in a cell-specific manner. The activationfunction appears to be mediated by a limiting cell-specifictranscriptional intermediary factor (TIF). Involved in cardiacdevelopment. Binds to the M-CAT motif.{ECO:0000269|PubMed:18579750, ECO:0000269|PubMed:19324877}. Plays a role in sarcomere organization and in smoothmuscle cell contraction. Required for normal development of theembryonic cardiovascular system, and for normal septation of theheart outflow tract. Plays a role in sprouting angiogenesis and isrequired for normal adhesion of vascular smooth muscle cells toendothelial cells during blood vessel development (By similarity).Plays a role in the reorganization of the actin cytoskeleton,formation of lamellipodia and ciliogenesis. Plays a role in theestablishement of cell polarity, cell adhesion, cell spreading,and directed cell migration. {ECO:0000250,ECO:0000269|PubMed:11134073, ECO:0000269|PubMed:11331308,ECO:0000269|PubMed:15284246, ECO:0000269|PubMed:20393563}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTEAD1chr11:12785981chr11:12549396ENST00000361905+313143_20452412Compositional biasNote=Pro-rich
HgeneTEAD1chr11:12785981chr11:12549396ENST00000361905+313306_32852412Compositional biasNote=Ser/Thr/Tyr-rich
HgeneTEAD1chr11:12785981chr11:12549396ENST00000361905+31328_10452412DNA bindingTEA
HgeneTEAD1chr11:12785981chr11:12549396ENST00000361905+313167_42652412RegionTranscriptional activation
TgenePARVAchr11:12785981chr11:12549396ENST00000550549+1113262_369347373DomainCalponin-homology (CH) 2
TgenePARVAchr11:12785981chr11:12549396ENST00000550549+111395_202347373DomainCalponin-homology (CH) 1


Top

FusionGeneSequence for TEAD1_PARVA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TEAD1_ENST00000361905_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_78aa

>In-frame_TEAD1_ENST00000527636_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_93aa
IEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYDIVNCDLKSTLRVLYNLFTKYRN

>In-frame_TEAD1_ENST00000527575_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_93aa
IEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYDIVNCDLKSTLRVLYNLFTKYRN

>In-frame_TEAD1_ENST00000334310_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_78aa

>In-frame_TEAD1_ENST00000361985_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_93aa
IEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYDIVNCDLKSTLRVLYNLFTKYRN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TEAD1_ENST00000361905_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_234nt
ATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGATGCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAG
GCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAA

>In-frame_TEAD1_ENST00000527636_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_279nt
ATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGAT
GCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTA
TCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAAC

>In-frame_TEAD1_ENST00000527575_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_279nt
ATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGAT
GCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTA
TCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAAC

>In-frame_TEAD1_ENST00000334310_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_234nt
ATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGATGCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAG
GCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAA

>In-frame_TEAD1_ENST00000361985_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_279nt
ATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGAT
GCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTA
TCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TEAD1_ENST00000361905_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_3775nt
TTCCGAACATTCTTAGCATCGCTCGCGCCGCGCCGCGCCGCCTGAGCCGAGCCGAGCCTCTGCTGCCGCCGCCGCGGCCCCGCCGCCCGC
CGCGGGCGCCCACCAAGCACTTTGCAGACTCGCTTCCACCCTGCGGGCCATTCCGCGCGGCGGGGCCCGGGCCCGGGGCGGCCGCGTCCA
GGCACAGGCCATGCAGTGACGCCCCCCCACCCCTCCACCTTTGCCCGGAGCGCGGGCAGCAGCCCAGCGCGCCAGCCGGCCCCGGGGCAG
GAGCGGTGCTAGGCAGGGGTGGGGTGGCCGGGCCCAGGGACCGGGAGCCGGGGAGGGAGCCGGGCACCGAGCAGAGGGCGGGGGAAGCGG
CGCCGAAGTTTGCCTCGGACTCGCCGGGCGCTGCGGTGGCTCCCTGGGCCGAGGACTGTTGCTGCCGCTGCCGCCGCCGCTTCATTGCAC
ATTCAAGTGGAAAATTTTCAGGAGTCAGCAGAAACATTGTGTCCAAAAAAGACTGAGTCGCAGTTACCACCAAACCCAGGAGGAGACTCT
CCCTGGAAAACTTCCCTTCCCTTTCGGTTTATTTTCTTGAAAAGGCTCCAGGCTTCGGCTTGGAAAATCCCACCGCCAAAATTGAGCCCA
GCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGATGCAGAAGGGG
TCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTATCAGACGAAG
GCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAACGTGGAGTGAG
GGGCTGCCCTGGGCCCACCACTGCCCAAGAGTTCTTGCTGTTGGCGTACTGGACCCTCCTCCGAACTGCCTTACCCTGCTTATTCCTGTC
TCTTGCACTGTGCTCTCCCACAAGTCCAGCTGCAACCCAGAGATAGTGGAAACTGAAATTAGGAAGGAAATCATCAATAACTCAGTGGGC
TGACCCATCCCTCCCAGGCGCTGGGGACCAACCTAGCAATGAAGGTTGGGAAGGTTGTTCCCTTCCCGGTGCCAGGTCCAGATTTCCCTC
CATGATTTGGGAACCAGCTTAGGCAAAAGAGTCCCCACAAGATGAAAATAAAGATCCTAGTTACCATTCAAAGGATGCTAACTGTGTGTC
AGGCCCCACACTAAGTGCTCTGCTCTGATATACTCAAGGCCATTAATCTTCAGGACTCCCATTGACGTAGGTGTTTCATTCCCCTTTTAC
AGATGAGGAAACTAAGGCTTGGAGGTTAAATGACTTGCCAGAAGTTGGAATTTTTTTCCTCTTTGAACATAACCTCTCCCTTCTCCCTAA
AGGTAACCACTATTCTGAGTCCAATCATCAAGGTTTTGCTTTTCTTTTTAGCTAAGTATGCATTCCTCAATAGTAGACAGTACAACATGT
TTATAACAAGCCAATTACATTATGTTCTTTGCATGTTCTAAAGTTGTGTATGTGTGTGCACATCTGAGCACGTGCACATGTACACCTGAG
CCAAAAACACGAGAACCCACTGATCTCACCACTGGGGCAAGCTAGGTCAGAGCTTAGTGATTCACACTGAAATTGGCAAATTGGATTTAA
CCCAATTAATAGTGTGTGTGTGGCAGGAGTCATGTCCCTCACATCCTTTGTACAAATGAAAATTACTCTTAATTCCTTCAGATTTATAAT
AACTCTGTACTTTGGTTTCAGGGTGACATTTGGGAAGGATTTTGTTTAGAATTAATGGAGTGGCACATTTTGCAGCCTTTTTGCTTGATT
GCATGTAATGGAAATGCCCTATATTTTCCTGCAAAATAAGTACTAAATTCATTATCGTTAAGCAAATGTACAATATGCTCAGGCACCGCA
GAGAGCTGGGCACGGGCCCATGTGAGCATCACTTTGGAAGTAGGGCTCTTCAACAGGGACCCTTGAACTTTAAAGAAAGGAACTTCTTTT
TGCCTTCTAATTGATCATTTAGACTATTCTGGCTAAGTCTGCCCACATGTAATTACCGGCTAATTCAAGCGAGGAAAAATGTAAGTCATT
TAGACCAAAGCCAAGCAGTTTCTTTGCGTGGGTTACTCAAGGGCTTGTGGTTACTTGTATCTCCTCTATGTGAACTTGACTTTGAAAGAC
AGAGCTCTAGTGTGCCAGCCTGCTAAGTCCTGTAAGAATAGGGAAGGGCGGAGGGGGGTGGGCAGTGACTAGGGGACGAGAAGCATGGGG
AAAATATTTGCACTCTAAACATACAGAGATAGAGGTGGGGCTTGTGGTACTTAACACTTGTAGCCATCAACTGACTGAGACCTTGGGCTA
AATAATCAATTGTGCTGATATTACATCTCGTTATGGAATGTTCCTAAATATGCCAGGTAGACACCAGCCCAAGTACCCTCCTCCAGAAGT
CTGTGACTACCTTGTCACTACTTTAGGCCCATTCCACAAAGCCCATCTCTGGTTTGAGAATTCATTTTGATCTGTATCTACACCACCCAA
AGTTAGGCCTCCTATAATGTCCAAAACATTCCTTTCAGCCTTTTTATTTCTTACTGTACTGTCTCTTACTGTACTGTCTATCTGCAGTAA
TTGAGGACCCATAAAATTTAGATAACTACATGTCTTTGCTCTTAGAATTGTCACTCAGCATAATGAGCATTTAACATACAAAGGCAATGT
ACTGTTTTGTGTTGATCTATGTAAAAGAATACAATTCTTTTTTACATAATTAGTGAAATTTTATTTTTTATTAGGAAACACTAAATAGTG
TAATATTTCTTTTGCTTTTAAAAAAATTCCTGGTAGCAAATCAAGATAAATAATTGCTTCATTTTCTTGAGCAATACTGAAGCAGGATGA
AGTAAGAGGAATGCATTCATTTAAACATGCTTTGCTTTATGAATTTTGTCTCTTTTTTGGTCTCTTTTTCTTATATTCAAGTTACAAATG
TACAAGTATCCTTACTAAGAGTGCTCCTTTTGTATTTTACATATATACAGTATGAAAATACATTGGAACACTAGGAAAGTTTTTAAATAA
CAGTTCTAATTTATCAGAAAATTGTGTTTTGGGATTGAGTTCTTTGTCTCAGCCCAGAATCCCAGGTCCTGGGCCTGGTTTTCTAATGCT
GTCATCTCAGTTCGATATTTTACTTTAGAACCTGGAATCTCCTACTTAATATATGACCATGACTTTGAAAGGCAAAAGAGGAATCAAGAA
TAAATAAAACAAACTTAATCTTCATCTTTAAAAAAAAGAAAAAAGAAACCAAAATGAGAATCAACACTTCATAGGCTCACTGGGTTTTCT
TTTCTTTTCTGTTAATTTAAACTCAGTTATTTTTAATGCTTAATACATACATGGTGCAAAATTTAAAAAGCGCAAATAGGTATCTAGTGG
AAAACCTAAGCCTCCCTCTCTCCTCCGGCACCCATTACCTCTCCCTGGAGGCAACTGTTTTGATCCATTTCTTACACACACTGCCAGAGA
TACTCTAGGCATGTAAAGCACAAACATACATATAAAATCTGCGGGCTTCAAAAAATATAAGTAGGATGTCATCTATACTGTCATACACTT

>In-frame_TEAD1_ENST00000527636_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_3606nt
GGCCGCGTCCAGGCACAGGCCATGCAGTGACGCCCCCCCACCCCTCCACCTTTGCCCGGAGCGCGGGCAGCAGCCCAGCGCGCCAGCCGG
CCCCGGGGCAGGAGCGGTGCTAGGCAGGGGTGGGGTGGCCGGGCCCAGGGACCGGGAGCCGGGGAGGGAGCCGGGCACCGAGCAGAGGGC
GGGGGAAGCGGCGCCGAAGTTTGCCTCGGACTCGCCGGGCGCTGCGGTGGCTCCCTGGGCCGAGGACTGTTGCTGCCGCTGCCGCCGCCG
CTTCATTGCACATTCAAGTGGAAAATTTTCAGGAGTCAGCAGAAACATTGTGTCCAAAAAAGACTGAGTCGCAGTTACCACCAAACCCAG
GAGGAGACTCTCCCTGGAAAACTTCCCTTCCCTTTCGGTTTATTTTCTTGAAAAGGCTCCAGGCTTCGGCTTGGAAAATCCCACCGCCAA
AATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGA
TGCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTT
ATCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAA
CGTGGAGTGAGGGGCTGCCCTGGGCCCACCACTGCCCAAGAGTTCTTGCTGTTGGCGTACTGGACCCTCCTCCGAACTGCCTTACCCTGC
TTATTCCTGTCTCTTGCACTGTGCTCTCCCACAAGTCCAGCTGCAACCCAGAGATAGTGGAAACTGAAATTAGGAAGGAAATCATCAATA
ACTCAGTGGGCTGACCCATCCCTCCCAGGCGCTGGGGACCAACCTAGCAATGAAGGTTGGGAAGGTTGTTCCCTTCCCGGTGCCAGGTCC
AGATTTCCCTCCATGATTTGGGAACCAGCTTAGGCAAAAGAGTCCCCACAAGATGAAAATAAAGATCCTAGTTACCATTCAAAGGATGCT
AACTGTGTGTCAGGCCCCACACTAAGTGCTCTGCTCTGATATACTCAAGGCCATTAATCTTCAGGACTCCCATTGACGTAGGTGTTTCAT
TCCCCTTTTACAGATGAGGAAACTAAGGCTTGGAGGTTAAATGACTTGCCAGAAGTTGGAATTTTTTTCCTCTTTGAACATAACCTCTCC
CTTCTCCCTAAAGGTAACCACTATTCTGAGTCCAATCATCAAGGTTTTGCTTTTCTTTTTAGCTAAGTATGCATTCCTCAATAGTAGACA
GTACAACATGTTTATAACAAGCCAATTACATTATGTTCTTTGCATGTTCTAAAGTTGTGTATGTGTGTGCACATCTGAGCACGTGCACAT
GTACACCTGAGCCAAAAACACGAGAACCCACTGATCTCACCACTGGGGCAAGCTAGGTCAGAGCTTAGTGATTCACACTGAAATTGGCAA
ATTGGATTTAACCCAATTAATAGTGTGTGTGTGGCAGGAGTCATGTCCCTCACATCCTTTGTACAAATGAAAATTACTCTTAATTCCTTC
AGATTTATAATAACTCTGTACTTTGGTTTCAGGGTGACATTTGGGAAGGATTTTGTTTAGAATTAATGGAGTGGCACATTTTGCAGCCTT
TTTGCTTGATTGCATGTAATGGAAATGCCCTATATTTTCCTGCAAAATAAGTACTAAATTCATTATCGTTAAGCAAATGTACAATATGCT
CAGGCACCGCAGAGAGCTGGGCACGGGCCCATGTGAGCATCACTTTGGAAGTAGGGCTCTTCAACAGGGACCCTTGAACTTTAAAGAAAG
GAACTTCTTTTTGCCTTCTAATTGATCATTTAGACTATTCTGGCTAAGTCTGCCCACATGTAATTACCGGCTAATTCAAGCGAGGAAAAA
TGTAAGTCATTTAGACCAAAGCCAAGCAGTTTCTTTGCGTGGGTTACTCAAGGGCTTGTGGTTACTTGTATCTCCTCTATGTGAACTTGA
CTTTGAAAGACAGAGCTCTAGTGTGCCAGCCTGCTAAGTCCTGTAAGAATAGGGAAGGGCGGAGGGGGGTGGGCAGTGACTAGGGGACGA
GAAGCATGGGGAAAATATTTGCACTCTAAACATACAGAGATAGAGGTGGGGCTTGTGGTACTTAACACTTGTAGCCATCAACTGACTGAG
ACCTTGGGCTAAATAATCAATTGTGCTGATATTACATCTCGTTATGGAATGTTCCTAAATATGCCAGGTAGACACCAGCCCAAGTACCCT
CCTCCAGAAGTCTGTGACTACCTTGTCACTACTTTAGGCCCATTCCACAAAGCCCATCTCTGGTTTGAGAATTCATTTTGATCTGTATCT
ACACCACCCAAAGTTAGGCCTCCTATAATGTCCAAAACATTCCTTTCAGCCTTTTTATTTCTTACTGTACTGTCTCTTACTGTACTGTCT
ATCTGCAGTAATTGAGGACCCATAAAATTTAGATAACTACATGTCTTTGCTCTTAGAATTGTCACTCAGCATAATGAGCATTTAACATAC
AAAGGCAATGTACTGTTTTGTGTTGATCTATGTAAAAGAATACAATTCTTTTTTACATAATTAGTGAAATTTTATTTTTTATTAGGAAAC
ACTAAATAGTGTAATATTTCTTTTGCTTTTAAAAAAATTCCTGGTAGCAAATCAAGATAAATAATTGCTTCATTTTCTTGAGCAATACTG
AAGCAGGATGAAGTAAGAGGAATGCATTCATTTAAACATGCTTTGCTTTATGAATTTTGTCTCTTTTTTGGTCTCTTTTTCTTATATTCA
AGTTACAAATGTACAAGTATCCTTACTAAGAGTGCTCCTTTTGTATTTTACATATATACAGTATGAAAATACATTGGAACACTAGGAAAG
TTTTTAAATAACAGTTCTAATTTATCAGAAAATTGTGTTTTGGGATTGAGTTCTTTGTCTCAGCCCAGAATCCCAGGTCCTGGGCCTGGT
TTTCTAATGCTGTCATCTCAGTTCGATATTTTACTTTAGAACCTGGAATCTCCTACTTAATATATGACCATGACTTTGAAAGGCAAAAGA
GGAATCAAGAATAAATAAAACAAACTTAATCTTCATCTTTAAAAAAAAGAAAAAAGAAACCAAAATGAGAATCAACACTTCATAGGCTCA
CTGGGTTTTCTTTTCTTTTCTGTTAATTTAAACTCAGTTATTTTTAATGCTTAATACATACATGGTGCAAAATTTAAAAAGCGCAAATAG
GTATCTAGTGGAAAACCTAAGCCTCCCTCTCTCCTCCGGCACCCATTACCTCTCCCTGGAGGCAACTGTTTTGATCCATTTCTTACACAC
ACTGCCAGAGATACTCTAGGCATGTAAAGCACAAACATACATATAAAATCTGCGGGCTTCAAAAAATATAAGTAGGATGTCATCTATACT
GTCATACACTTTGTTTTTTATCACTTAATGTTATATCTTGGATATTGTATTACCCTGGGTATTAAAAAGAACTCCTTTCACATTTTAAAA

>In-frame_TEAD1_ENST00000527575_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_3268nt
TCGCAGTTACCACCAAACCCAGGAGGAGACTCTCCCTGGAAAACTTCCCTTCCCTTTCGGTTTATTTTCTTGAAAAGGCTCCAGGCTTCG
GCTTGGAAAATCCCACCGCCAAAATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTG
CAGATAAGCCAATTGACAATGATGCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCAT
GTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACA
ACCTCTTCACCAAGTACCGTAACGTGGAGTGAGGGGCTGCCCTGGGCCCACCACTGCCCAAGAGTTCTTGCTGTTGGCGTACTGGACCCT
CCTCCGAACTGCCTTACCCTGCTTATTCCTGTCTCTTGCACTGTGCTCTCCCACAAGTCCAGCTGCAACCCAGAGATAGTGGAAACTGAA
ATTAGGAAGGAAATCATCAATAACTCAGTGGGCTGACCCATCCCTCCCAGGCGCTGGGGACCAACCTAGCAATGAAGGTTGGGAAGGTTG
TTCCCTTCCCGGTGCCAGGTCCAGATTTCCCTCCATGATTTGGGAACCAGCTTAGGCAAAAGAGTCCCCACAAGATGAAAATAAAGATCC
TAGTTACCATTCAAAGGATGCTAACTGTGTGTCAGGCCCCACACTAAGTGCTCTGCTCTGATATACTCAAGGCCATTAATCTTCAGGACT
CCCATTGACGTAGGTGTTTCATTCCCCTTTTACAGATGAGGAAACTAAGGCTTGGAGGTTAAATGACTTGCCAGAAGTTGGAATTTTTTT
CCTCTTTGAACATAACCTCTCCCTTCTCCCTAAAGGTAACCACTATTCTGAGTCCAATCATCAAGGTTTTGCTTTTCTTTTTAGCTAAGT
ATGCATTCCTCAATAGTAGACAGTACAACATGTTTATAACAAGCCAATTACATTATGTTCTTTGCATGTTCTAAAGTTGTGTATGTGTGT
GCACATCTGAGCACGTGCACATGTACACCTGAGCCAAAAACACGAGAACCCACTGATCTCACCACTGGGGCAAGCTAGGTCAGAGCTTAG
TGATTCACACTGAAATTGGCAAATTGGATTTAACCCAATTAATAGTGTGTGTGTGGCAGGAGTCATGTCCCTCACATCCTTTGTACAAAT
GAAAATTACTCTTAATTCCTTCAGATTTATAATAACTCTGTACTTTGGTTTCAGGGTGACATTTGGGAAGGATTTTGTTTAGAATTAATG
GAGTGGCACATTTTGCAGCCTTTTTGCTTGATTGCATGTAATGGAAATGCCCTATATTTTCCTGCAAAATAAGTACTAAATTCATTATCG
TTAAGCAAATGTACAATATGCTCAGGCACCGCAGAGAGCTGGGCACGGGCCCATGTGAGCATCACTTTGGAAGTAGGGCTCTTCAACAGG
GACCCTTGAACTTTAAAGAAAGGAACTTCTTTTTGCCTTCTAATTGATCATTTAGACTATTCTGGCTAAGTCTGCCCACATGTAATTACC
GGCTAATTCAAGCGAGGAAAAATGTAAGTCATTTAGACCAAAGCCAAGCAGTTTCTTTGCGTGGGTTACTCAAGGGCTTGTGGTTACTTG
TATCTCCTCTATGTGAACTTGACTTTGAAAGACAGAGCTCTAGTGTGCCAGCCTGCTAAGTCCTGTAAGAATAGGGAAGGGCGGAGGGGG
GTGGGCAGTGACTAGGGGACGAGAAGCATGGGGAAAATATTTGCACTCTAAACATACAGAGATAGAGGTGGGGCTTGTGGTACTTAACAC
TTGTAGCCATCAACTGACTGAGACCTTGGGCTAAATAATCAATTGTGCTGATATTACATCTCGTTATGGAATGTTCCTAAATATGCCAGG
TAGACACCAGCCCAAGTACCCTCCTCCAGAAGTCTGTGACTACCTTGTCACTACTTTAGGCCCATTCCACAAAGCCCATCTCTGGTTTGA
GAATTCATTTTGATCTGTATCTACACCACCCAAAGTTAGGCCTCCTATAATGTCCAAAACATTCCTTTCAGCCTTTTTATTTCTTACTGT
ACTGTCTCTTACTGTACTGTCTATCTGCAGTAATTGAGGACCCATAAAATTTAGATAACTACATGTCTTTGCTCTTAGAATTGTCACTCA
GCATAATGAGCATTTAACATACAAAGGCAATGTACTGTTTTGTGTTGATCTATGTAAAAGAATACAATTCTTTTTTACATAATTAGTGAA
ATTTTATTTTTTATTAGGAAACACTAAATAGTGTAATATTTCTTTTGCTTTTAAAAAAATTCCTGGTAGCAAATCAAGATAAATAATTGC
TTCATTTTCTTGAGCAATACTGAAGCAGGATGAAGTAAGAGGAATGCATTCATTTAAACATGCTTTGCTTTATGAATTTTGTCTCTTTTT
TGGTCTCTTTTTCTTATATTCAAGTTACAAATGTACAAGTATCCTTACTAAGAGTGCTCCTTTTGTATTTTACATATATACAGTATGAAA
ATACATTGGAACACTAGGAAAGTTTTTAAATAACAGTTCTAATTTATCAGAAAATTGTGTTTTGGGATTGAGTTCTTTGTCTCAGCCCAG
AATCCCAGGTCCTGGGCCTGGTTTTCTAATGCTGTCATCTCAGTTCGATATTTTACTTTAGAACCTGGAATCTCCTACTTAATATATGAC
CATGACTTTGAAAGGCAAAAGAGGAATCAAGAATAAATAAAACAAACTTAATCTTCATCTTTAAAAAAAAGAAAAAAGAAACCAAAATGA
GAATCAACACTTCATAGGCTCACTGGGTTTTCTTTTCTTTTCTGTTAATTTAAACTCAGTTATTTTTAATGCTTAATACATACATGGTGC
AAAATTTAAAAAGCGCAAATAGGTATCTAGTGGAAAACCTAAGCCTCCCTCTCTCCTCCGGCACCCATTACCTCTCCCTGGAGGCAACTG
TTTTGATCCATTTCTTACACACACTGCCAGAGATACTCTAGGCATGTAAAGCACAAACATACATATAAAATCTGCGGGCTTCAAAAAATA
TAAGTAGGATGTCATCTATACTGTCATACACTTTGTTTTTTATCACTTAATGTTATATCTTGGATATTGTATTACCCTGGGTATTAAAAA

>In-frame_TEAD1_ENST00000334310_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_3268nt
TCGCAGTTACCACCAAACCCAGGAGGAGACTCTCCCTGGAAAACTTCCCTTCCCTTTCGGTTTATTTTCTTGAAAAGGCTCCAGGCTTCG
GCTTGGAAAATCCCACCGCCAAAATTGAGCCCAGCAGCTGGAGCGGCAGTGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTG
CAGATAAGCCAATTGACAATGATGCAGAAGGGGTCTGGAGCCCCGACATCGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCAT
GTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAAATGTATGACATAGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACA
ACCTCTTCACCAAGTACCGTAACGTGGAGTGAGGGGCTGCCCTGGGCCCACCACTGCCCAAGAGTTCTTGCTGTTGGCGTACTGGACCCT
CCTCCGAACTGCCTTACCCTGCTTATTCCTGTCTCTTGCACTGTGCTCTCCCACAAGTCCAGCTGCAACCCAGAGATAGTGGAAACTGAA
ATTAGGAAGGAAATCATCAATAACTCAGTGGGCTGACCCATCCCTCCCAGGCGCTGGGGACCAACCTAGCAATGAAGGTTGGGAAGGTTG
TTCCCTTCCCGGTGCCAGGTCCAGATTTCCCTCCATGATTTGGGAACCAGCTTAGGCAAAAGAGTCCCCACAAGATGAAAATAAAGATCC
TAGTTACCATTCAAAGGATGCTAACTGTGTGTCAGGCCCCACACTAAGTGCTCTGCTCTGATATACTCAAGGCCATTAATCTTCAGGACT
CCCATTGACGTAGGTGTTTCATTCCCCTTTTACAGATGAGGAAACTAAGGCTTGGAGGTTAAATGACTTGCCAGAAGTTGGAATTTTTTT
CCTCTTTGAACATAACCTCTCCCTTCTCCCTAAAGGTAACCACTATTCTGAGTCCAATCATCAAGGTTTTGCTTTTCTTTTTAGCTAAGT
ATGCATTCCTCAATAGTAGACAGTACAACATGTTTATAACAAGCCAATTACATTATGTTCTTTGCATGTTCTAAAGTTGTGTATGTGTGT
GCACATCTGAGCACGTGCACATGTACACCTGAGCCAAAAACACGAGAACCCACTGATCTCACCACTGGGGCAAGCTAGGTCAGAGCTTAG
TGATTCACACTGAAATTGGCAAATTGGATTTAACCCAATTAATAGTGTGTGTGTGGCAGGAGTCATGTCCCTCACATCCTTTGTACAAAT
GAAAATTACTCTTAATTCCTTCAGATTTATAATAACTCTGTACTTTGGTTTCAGGGTGACATTTGGGAAGGATTTTGTTTAGAATTAATG
GAGTGGCACATTTTGCAGCCTTTTTGCTTGATTGCATGTAATGGAAATGCCCTATATTTTCCTGCAAAATAAGTACTAAATTCATTATCG
TTAAGCAAATGTACAATATGCTCAGGCACCGCAGAGAGCTGGGCACGGGCCCATGTGAGCATCACTTTGGAAGTAGGGCTCTTCAACAGG
GACCCTTGAACTTTAAAGAAAGGAACTTCTTTTTGCCTTCTAATTGATCATTTAGACTATTCTGGCTAAGTCTGCCCACATGTAATTACC
GGCTAATTCAAGCGAGGAAAAATGTAAGTCATTTAGACCAAAGCCAAGCAGTTTCTTTGCGTGGGTTACTCAAGGGCTTGTGGTTACTTG
TATCTCCTCTATGTGAACTTGACTTTGAAAGACAGAGCTCTAGTGTGCCAGCCTGCTAAGTCCTGTAAGAATAGGGAAGGGCGGAGGGGG
GTGGGCAGTGACTAGGGGACGAGAAGCATGGGGAAAATATTTGCACTCTAAACATACAGAGATAGAGGTGGGGCTTGTGGTACTTAACAC
TTGTAGCCATCAACTGACTGAGACCTTGGGCTAAATAATCAATTGTGCTGATATTACATCTCGTTATGGAATGTTCCTAAATATGCCAGG
TAGACACCAGCCCAAGTACCCTCCTCCAGAAGTCTGTGACTACCTTGTCACTACTTTAGGCCCATTCCACAAAGCCCATCTCTGGTTTGA
GAATTCATTTTGATCTGTATCTACACCACCCAAAGTTAGGCCTCCTATAATGTCCAAAACATTCCTTTCAGCCTTTTTATTTCTTACTGT
ACTGTCTCTTACTGTACTGTCTATCTGCAGTAATTGAGGACCCATAAAATTTAGATAACTACATGTCTTTGCTCTTAGAATTGTCACTCA
GCATAATGAGCATTTAACATACAAAGGCAATGTACTGTTTTGTGTTGATCTATGTAAAAGAATACAATTCTTTTTTACATAATTAGTGAA
ATTTTATTTTTTATTAGGAAACACTAAATAGTGTAATATTTCTTTTGCTTTTAAAAAAATTCCTGGTAGCAAATCAAGATAAATAATTGC
TTCATTTTCTTGAGCAATACTGAAGCAGGATGAAGTAAGAGGAATGCATTCATTTAAACATGCTTTGCTTTATGAATTTTGTCTCTTTTT
TGGTCTCTTTTTCTTATATTCAAGTTACAAATGTACAAGTATCCTTACTAAGAGTGCTCCTTTTGTATTTTACATATATACAGTATGAAA
ATACATTGGAACACTAGGAAAGTTTTTAAATAACAGTTCTAATTTATCAGAAAATTGTGTTTTGGGATTGAGTTCTTTGTCTCAGCCCAG
AATCCCAGGTCCTGGGCCTGGTTTTCTAATGCTGTCATCTCAGTTCGATATTTTACTTTAGAACCTGGAATCTCCTACTTAATATATGAC
CATGACTTTGAAAGGCAAAAGAGGAATCAAGAATAAATAAAACAAACTTAATCTTCATCTTTAAAAAAAAGAAAAAAGAAACCAAAATGA
GAATCAACACTTCATAGGCTCACTGGGTTTTCTTTTCTTTTCTGTTAATTTAAACTCAGTTATTTTTAATGCTTAATACATACATGGTGC
AAAATTTAAAAAGCGCAAATAGGTATCTAGTGGAAAACCTAAGCCTCCCTCTCTCCTCCGGCACCCATTACCTCTCCCTGGAGGCAACTG
TTTTGATCCATTTCTTACACACACTGCCAGAGATACTCTAGGCATGTAAAGCACAAACATACATATAAAATCTGCGGGCTTCAAAAAATA
TAAGTAGGATGTCATCTATACTGTCATACACTTTGTTTTTTATCACTTAATGTTATATCTTGGATATTGTATTACCCTGGGTATTAAAAA

>In-frame_TEAD1_ENST00000361985_chr11_12785981_+_PARVA_ENST00000334956_chr11_12549396_+_3309nt
AGGGAGTGTGGTGGCATTGCTCTGCAGAGACATGAACAGCTCCCTGGGAGACACTGCTGGGGAAAGATGAGTCGAGTCTACGGTTTTTTC
TCATCCTCCTGTTTATTTTCTTGAAAAGGCTCCAGGCTTCGGCTTGGAAAATCCCACCGCCAAAATTGAGCCCAGCAGCTGGAGCGGCAG
TGAGAGCCCTGCCGAAAACATGGAAAGGATGAGTGACTCTGCAGATAAGCCAATTGACAATGATGCAGAAGGGGTCTGGAGCCCCGACAT
CGAGCAAAGCTTTCAGGAGGCCCTGGCTATCTATCCACCATGTGGGAGGAGGAAAATCATCTTATCAGACGAAGGCAAAATGTATGACAT
AGTCAACTGTGACCTGAAATCTACACTACGAGTGTTGTACAACCTCTTCACCAAGTACCGTAACGTGGAGTGAGGGGCTGCCCTGGGCCC
ACCACTGCCCAAGAGTTCTTGCTGTTGGCGTACTGGACCCTCCTCCGAACTGCCTTACCCTGCTTATTCCTGTCTCTTGCACTGTGCTCT
CCCACAAGTCCAGCTGCAACCCAGAGATAGTGGAAACTGAAATTAGGAAGGAAATCATCAATAACTCAGTGGGCTGACCCATCCCTCCCA
GGCGCTGGGGACCAACCTAGCAATGAAGGTTGGGAAGGTTGTTCCCTTCCCGGTGCCAGGTCCAGATTTCCCTCCATGATTTGGGAACCA
GCTTAGGCAAAAGAGTCCCCACAAGATGAAAATAAAGATCCTAGTTACCATTCAAAGGATGCTAACTGTGTGTCAGGCCCCACACTAAGT
GCTCTGCTCTGATATACTCAAGGCCATTAATCTTCAGGACTCCCATTGACGTAGGTGTTTCATTCCCCTTTTACAGATGAGGAAACTAAG
GCTTGGAGGTTAAATGACTTGCCAGAAGTTGGAATTTTTTTCCTCTTTGAACATAACCTCTCCCTTCTCCCTAAAGGTAACCACTATTCT
GAGTCCAATCATCAAGGTTTTGCTTTTCTTTTTAGCTAAGTATGCATTCCTCAATAGTAGACAGTACAACATGTTTATAACAAGCCAATT
ACATTATGTTCTTTGCATGTTCTAAAGTTGTGTATGTGTGTGCACATCTGAGCACGTGCACATGTACACCTGAGCCAAAAACACGAGAAC
CCACTGATCTCACCACTGGGGCAAGCTAGGTCAGAGCTTAGTGATTCACACTGAAATTGGCAAATTGGATTTAACCCAATTAATAGTGTG
TGTGTGGCAGGAGTCATGTCCCTCACATCCTTTGTACAAATGAAAATTACTCTTAATTCCTTCAGATTTATAATAACTCTGTACTTTGGT
TTCAGGGTGACATTTGGGAAGGATTTTGTTTAGAATTAATGGAGTGGCACATTTTGCAGCCTTTTTGCTTGATTGCATGTAATGGAAATG
CCCTATATTTTCCTGCAAAATAAGTACTAAATTCATTATCGTTAAGCAAATGTACAATATGCTCAGGCACCGCAGAGAGCTGGGCACGGG
CCCATGTGAGCATCACTTTGGAAGTAGGGCTCTTCAACAGGGACCCTTGAACTTTAAAGAAAGGAACTTCTTTTTGCCTTCTAATTGATC
ATTTAGACTATTCTGGCTAAGTCTGCCCACATGTAATTACCGGCTAATTCAAGCGAGGAAAAATGTAAGTCATTTAGACCAAAGCCAAGC
AGTTTCTTTGCGTGGGTTACTCAAGGGCTTGTGGTTACTTGTATCTCCTCTATGTGAACTTGACTTTGAAAGACAGAGCTCTAGTGTGCC
AGCCTGCTAAGTCCTGTAAGAATAGGGAAGGGCGGAGGGGGGTGGGCAGTGACTAGGGGACGAGAAGCATGGGGAAAATATTTGCACTCT
AAACATACAGAGATAGAGGTGGGGCTTGTGGTACTTAACACTTGTAGCCATCAACTGACTGAGACCTTGGGCTAAATAATCAATTGTGCT
GATATTACATCTCGTTATGGAATGTTCCTAAATATGCCAGGTAGACACCAGCCCAAGTACCCTCCTCCAGAAGTCTGTGACTACCTTGTC
ACTACTTTAGGCCCATTCCACAAAGCCCATCTCTGGTTTGAGAATTCATTTTGATCTGTATCTACACCACCCAAAGTTAGGCCTCCTATA
ATGTCCAAAACATTCCTTTCAGCCTTTTTATTTCTTACTGTACTGTCTCTTACTGTACTGTCTATCTGCAGTAATTGAGGACCCATAAAA
TTTAGATAACTACATGTCTTTGCTCTTAGAATTGTCACTCAGCATAATGAGCATTTAACATACAAAGGCAATGTACTGTTTTGTGTTGAT
CTATGTAAAAGAATACAATTCTTTTTTACATAATTAGTGAAATTTTATTTTTTATTAGGAAACACTAAATAGTGTAATATTTCTTTTGCT
TTTAAAAAAATTCCTGGTAGCAAATCAAGATAAATAATTGCTTCATTTTCTTGAGCAATACTGAAGCAGGATGAAGTAAGAGGAATGCAT
TCATTTAAACATGCTTTGCTTTATGAATTTTGTCTCTTTTTTGGTCTCTTTTTCTTATATTCAAGTTACAAATGTACAAGTATCCTTACT
AAGAGTGCTCCTTTTGTATTTTACATATATACAGTATGAAAATACATTGGAACACTAGGAAAGTTTTTAAATAACAGTTCTAATTTATCA
GAAAATTGTGTTTTGGGATTGAGTTCTTTGTCTCAGCCCAGAATCCCAGGTCCTGGGCCTGGTTTTCTAATGCTGTCATCTCAGTTCGAT
ATTTTACTTTAGAACCTGGAATCTCCTACTTAATATATGACCATGACTTTGAAAGGCAAAAGAGGAATCAAGAATAAATAAAACAAACTT
AATCTTCATCTTTAAAAAAAAGAAAAAAGAAACCAAAATGAGAATCAACACTTCATAGGCTCACTGGGTTTTCTTTTCTTTTCTGTTAAT
TTAAACTCAGTTATTTTTAATGCTTAATACATACATGGTGCAAAATTTAAAAAGCGCAAATAGGTATCTAGTGGAAAACCTAAGCCTCCC
TCTCTCCTCCGGCACCCATTACCTCTCCCTGGAGGCAACTGTTTTGATCCATTTCTTACACACACTGCCAGAGATACTCTAGGCATGTAA
AGCACAAACATACATATAAAATCTGCGGGCTTCAAAAAATATAAGTAGGATGTCATCTATACTGTCATACACTTTGTTTTTTATCACTTA


Top

FusionGenePPI for TEAD1_PARVA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TEAD1VGLL4, NCOA1, VGLL1, MEF2C, MAX, SRF, SOX2, YAP1, HLA-DMB, INSR, GCAT, UBTD1, ZDHHC17, TEAD4, RAD51, WWTR1, FOXK2, SKI, TEAD2, TRIM25, PFKMPARVAILK, DHX36, UBE3A, ELAVL1, APP, MLH1, SOX2, HSPH1, CARM1, CORO1B, CRMP1, OSBP, OTUD6B, PPAT, TBC1D17, UGP2, ZRANB2, RSU1, SEC24C, MOCOS, LIMS1, PARVB, IQGAP1, VPS11, GCA, DDX47, CHMP2A, CMTR2, DDX17, DPH5, HSPB2, UBQLN1, SNW1, CDC5L, CDH1, LPXN, CCNB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgenePARVAchr11:12785981chr11:12549396ENST00000550549+111321_25347373ARHGAP31


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TEAD1_PARVA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TEAD1_PARVA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTEAD1C1862382SVEINSSON CHORIORETINAL ATROPHY1CTD_human;ORPHANET;UNIPROT
TgenePARVAC0236969Substance-Related Disorders1CTD_human