FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37551

FusionGeneSummary for TCF12_NIPA1

check button Fusion gene summary
Fusion gene informationFusion gene name: TCF12_NIPA1
Fusion gene ID: 37551
HgeneTgene
Gene symbol

TCF12

NIPA1

Gene ID

6938

123606

Gene nametranscription factor 12NIPA magnesium transporter 1
SynonymsCRS3|HEB|HTF4|HsT17266|TCF-12|bHLHb20|p64FSP3|SLC57A1|SPG6
Cytomap

15q21.3

15q11.2

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor 12DNA-binding protein HTF4E-box-binding proteinclass B basic helix-loop-helix protein 20helix-loop-helix transcription factor 4transcription factor HTF-4magnesium transporter NIPA1non imprinted in Prader-Willi/Angelman syndrome 1non-imprinted in Prader-Willi/Angelman syndrome region protein 1spastic paraplegia 6 protein
Modification date2018052320180523
UniProtAcc

Q99081

Q7RTP0

Ensembl transtripts involved in fusion geneENST00000438423, ENST00000267811, 
ENST00000452095, ENST00000333725, 
ENST00000557843, ENST00000560764, 
ENST00000543579, ENST00000537840, 
ENST00000343827, ENST00000559710, 
ENST00000559703, 
ENST00000337435, 
ENST00000437912, ENST00000538684, 
ENST00000561183, 
Fusion gene scores* DoF score22 X 12 X 9=23761 X 1 X 1=1
# samples 221
** MAII scorelog2(22/2376*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: TCF12 [Title/Abstract] AND NIPA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTCF12

GO:0045944

positive regulation of transcription by RNA polymerase II

11802795


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-75-7031-01ATCF12chr15

57213296

+NIPA1chr15

23062319

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000438423ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000438423ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000438423ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000438423ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
In-frameENST00000267811ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000267811ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000267811ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000267811ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
In-frameENST00000452095ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000452095ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000452095ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000452095ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
In-frameENST00000333725ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000333725ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000333725ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000333725ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
In-frameENST00000557843ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000557843ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000557843ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
5CDS-5UTRENST00000557843ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000560764ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000560764ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000560764ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000560764ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000543579ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000543579ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000543579ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000543579ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000537840ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000537840ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000537840ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000537840ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000343827ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000343827ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000343827ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000343827ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000559710ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559710ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559710ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559710ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-3CDSENST00000559703ENST00000337435TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559703ENST00000437912TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559703ENST00000538684TCF12chr15

57213296

+NIPA1chr15

23062319

+
intron-5UTRENST00000559703ENST00000561183TCF12chr15

57213296

+NIPA1chr15

23062319

+

Top

FusionProtFeatures for TCF12_NIPA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TCF12

Q99081

NIPA1

Q7RTP0

Transcriptional regulator. Involved in the initiation ofneuronal differentiation. Activates transcription by binding tothe E box (5'-CANNTG-3'). Acts as a Mg(2+) transporter. Can also transport otherdivalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+)but to a much less extent than Mg(2+) (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTCF12chr15:57213296chr15:23062319ENST00000267811+32019_27491821MotifNote=9aaTAD
HgeneTCF12chr15:57213296chr15:23062319ENST00000333725+32119_27491420MotifNote=9aaTAD
HgeneTCF12chr15:57213296chr15:23062319ENST00000438423+32119_27491398MotifNote=9aaTAD
HgeneTCF12chr15:57213296chr15:23062319ENST00000557843+32019_27491301MotifNote=9aaTAD
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05110_11759330Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05139_15959330Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05181_18359330Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05205_22459330Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05246_25959330Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05281_29059330Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05312_32959330Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-0588_8859330Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05110_117-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05139_159-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05181_183-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-051_27-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05205_224-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05246_259-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05281_290-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05312_329-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-0549_66-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-0588_88-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05110_117-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05139_159-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05181_183-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-051_27-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05205_224-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05246_259-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05281_290-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05312_329-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-0549_66-16255Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-0588_88-16255Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05118_13859330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05160_18059330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05184_20459330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05225_24559330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05260_28059330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-05291_31159330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-0567_8759330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-0589_10959330TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05118_138-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05160_180-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05184_204-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05225_245-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05260_280-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-0528_48-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-05291_311-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-0567_87-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000437912-0589_109-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05118_138-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05160_180-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05184_204-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05225_245-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05260_280-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-0528_48-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-05291_311-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-0567_87-16255TransmembraneHelical
TgeneNIPA1chr15:57213296chr15:23062319ENST00000561183-0589_109-16255TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTCF12chr15:57213296chr15:23062319ENST00000267811+320577_630491821DomainbHLH
HgeneTCF12chr15:57213296chr15:23062319ENST00000333725+321577_630491420DomainbHLH
HgeneTCF12chr15:57213296chr15:23062319ENST00000343827+113577_630-191254DomainbHLH
HgeneTCF12chr15:57213296chr15:23062319ENST00000438423+321577_630491398DomainbHLH
HgeneTCF12chr15:57213296chr15:23062319ENST00000557843+320577_630491301DomainbHLH
HgeneTCF12chr15:57213296chr15:23062319ENST00000343827+11319_27-191254MotifNote=9aaTAD
HgeneTCF12chr15:57213296chr15:23062319ENST00000267811+320119_140491821RegionNote=Leucine-zipper
HgeneTCF12chr15:57213296chr15:23062319ENST00000267811+320632_655491821RegionNote=Class A specific domain
HgeneTCF12chr15:57213296chr15:23062319ENST00000333725+321119_140491420RegionNote=Leucine-zipper
HgeneTCF12chr15:57213296chr15:23062319ENST00000333725+321632_655491420RegionNote=Class A specific domain
HgeneTCF12chr15:57213296chr15:23062319ENST00000343827+113119_140-191254RegionNote=Leucine-zipper
HgeneTCF12chr15:57213296chr15:23062319ENST00000343827+113632_655-191254RegionNote=Class A specific domain
HgeneTCF12chr15:57213296chr15:23062319ENST00000438423+321119_140491398RegionNote=Leucine-zipper
HgeneTCF12chr15:57213296chr15:23062319ENST00000438423+321632_655491398RegionNote=Class A specific domain
HgeneTCF12chr15:57213296chr15:23062319ENST00000557843+320119_140491301RegionNote=Leucine-zipper
HgeneTCF12chr15:57213296chr15:23062319ENST00000557843+320632_655491301RegionNote=Class A specific domain
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-051_2759330Topological domainExtracellular
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-0549_6659330Topological domainCytoplasmic
TgeneNIPA1chr15:57213296chr15:23062319ENST00000337435-0528_4859330TransmembraneHelical


Top

FusionGeneSequence for TCF12_NIPA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TCF12_ENST00000438423_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_320aa
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGTSTLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA
LGVPFGSILASTLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMV
YISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF

>In-frame_TCF12_ENST00000267811_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_320aa
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGTSTLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA
LGVPFGSILASTLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMV
YISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF

>In-frame_TCF12_ENST00000452095_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_320aa
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGTSTLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA
LGVPFGSILASTLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMV
YISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF

>In-frame_TCF12_ENST00000333725_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_320aa
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGTSTLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA
LGVPFGSILASTLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMV
YISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF

>In-frame_TCF12_ENST00000557843_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_320aa
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGTSTLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA
LGVPFGSILASTLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMV
YISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TCF12_ENST00000438423_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_960nt
ATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCT
GTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGG
GCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGT
GCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTG
TTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTC
TACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAAC
CCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAG
GCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTC
CGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTG

>In-frame_TCF12_ENST00000267811_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_960nt
ATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCT
GTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGG
GCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGT
GCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTG
TTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTC
TACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAAC
CCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAG
GCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTC
CGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTG

>In-frame_TCF12_ENST00000452095_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_960nt
ATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCT
GTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGG
GCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGT
GCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTG
TTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTC
TACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAAC
CCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAG
GCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTC
CGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTG

>In-frame_TCF12_ENST00000333725_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_960nt
ATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCT
GTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGG
GCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGT
GCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTG
TTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTC
TACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAAC
CCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAG
GCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTC
CGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTG

>In-frame_TCF12_ENST00000557843_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_960nt
ATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCT
GTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGG
GCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCC
CTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGT
GCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTG
TTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTC
TACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAAC
CCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAG
GCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTC
CGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TCF12_ENST00000438423_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_6808nt
GGCGCGGAGGGATCCGGAGGCGAGCCGAGCGCGGTGGTGAGGCCGCCTCAGCGAAAAAAATGTCCGCCTGAAGAGACCCACAAGTTCTAT
TCGGGGGGACCGACAGCCCGCCCCGGGAGGAAGGGGCGGCCAGGCCCGAAAGCCGCCTCCCCCTCCCAGACCCGAGAGCTCGTGCGGGGC
AAAGTGAACCGAGCCGCTGGGCGGTGCAAGGGGAAGCCCAAGCCCGTTCTCCCGGCCAAAGTGAACTTTAATCGGGGTGGTTGGATGCGG
AGACGGGGCGGCAGAAGTGGCCGAAGATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGG
ACTTCAGTGCGATGTTTTCCCCACCTGTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTT
CCTATTTAACAGACATTGTGTGGTGGGCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCA
CGGTCCTGGTAACCCCCCTGGGCGCCCTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGG
GCAAGTTGGGGTGCCTGCTAAGCTGTGCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGC
TGGAGGAAAAGCTGACCAATCCAGTGTTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGG
CCCATGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGG
CGGCCCAAGACATCTTGCATAACAACCCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCA
TCGTCCAGTTCAGGTACATCAACAAGGCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGG
TCCTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCT
CCGTGGGGATTGTCCTTATACAGGTGTTCAAAGAGTTCAATTTCAACCTTGGGGAGATGAACAAATCTAATATGAAAACAGACTAGATTG
CAATAGGAGCTTGGATGGTTCGAGGAATAGGCATTGGAGGTGGTTTCTGGCCGTGATTGGATGTGAAGTAGAAGAGGTCCTCGATCATGG
TGTTAGAATTGACTGGATAGTAACAGGTGGTCTGGTGGATAGCGGGGAGCATGGCTCAGCACCAGAGCAGAGGCCCAGCCAGCCCTCTGC
AGCCCAAACGTCCCCAACGGTTGCCTGGCACCATCTCTCTCTGATGAGACGAATCTCATTTTCATTTCCATTAACCTGGAAGCTTTCATG
AATATTCTCTTCTTTTAAAACATTTTAACATTATTTAAACAGAAAAAGATGGGCTCTTTCTGGTTAGTTGTTACATGATAGCAGAGATAT
TTTTACTTAGATTACTTTGGGAATGAGAGATTGTTGTCTTGAACTCTGGCACTGTACAGTGAATGTGTCTGTAGTTGTGTTAGTTTGCAT
TAAGCATGTATAACATTCAAGTATGTCATCCAAATAAGAGGCATATACATTGAATTGTTTTTAATCCTCTGACAAGTTGACTCTTCGACC
CCCACCCCCACCCAAGACATTTTAATAGTAAATAGAGAGAGAGAGAAGAGTTAATGAACATGAGGTAGTGTTCCACTGGCAGGATGACTT
TTCAATAGCTCAAATCAATTTCAGTGCCTTTATCACTTGAATTATTAACTTAATTTGACTCTTAATGTGTATATGTTCTTAGATTAGAAT
AATGCAACTTCGAGTATGCTTTAATATTTCAATATTCAAGTTACAAATGTATAAGGCAGTTAGAAATAATACAGTCACATGTCACTTAAT
GATAGGGAAACATTCTGAGAAATGCATTGTAAGGTGACTTTATTGTGTGAACATCATGGAGTGCACTTATACAAACCTAGATGGGACACC
TATGACCCACCCAGGCCAGATGGTACAGCCTGTTGCTCCTGGGCCACACACCTGTACAGCATGTGACCGCACTGAATACCGCAGGCAATT
GTAACACAGTGGTGAGTATTTGTGTTTACAAACATAGGAAAGGTACAGTAAAACTATGGTATTACAATGTTATGGGACCACCGTCATGTA
AGTGGTATGTCTTTGACAGAAACATGGTTACGTGGTTCATGACTGTATATTCACTGGAAGATAGTCAAGACTAAAGACACATTAGAGCAA
ATTGACCCCTTTAACATGTGATTATTGTCCAATTAAAGACAGTTGATTTAAGTAGCATGAGGTATTATTTTATTTGTATTCGATCTGTGT
TACCTGGGATCCAGTATCAAATATATCCACATTCTTTATCAGCAAGCATTCATGGCCATTCAGAAGAAATAAATTAGGTAACTTGATAAT
AAGGCTAAGTGGGAGAGTACCTGTTCAATAGCTCATATATCGAGTACCCTGTCATACAGGAACAAGTTAAAGGACACAATTGAGGTTAGG
CTAGCTTCTACAAATTGCAATATGCAGTTTTTGAAAGATTTTCTAACAAAAAGCCAATAAATGTAGCCATCTCCTTGTTGTTTGCAATGG
CAGAGCATCCTAGAGTTCCTCAGCTAACCTCTCATTATGTGTCTTAAATGCAAAAGAGCCATTAATTATGCCAGTATTTGAATCAAAGAG
GTCATTCTCTGTCTATAGTGTTCCCATCCATGTGTTCCAAATGGGAGCATAGCATGAAGTGATGCACATATTTCACCACGGTATCATGTA
CTTCATGGCCAGTGTTTTATCTCAGCAGGGAACTACGCCAAGTTGAAAGATGGGGTTGGGTAAAGTAGATTAGGTGAAGTAGAACATAAA
ATTGAATAGTACCCAATTAAAGTTCCTCAGTAAGAAAAAAAATGTGTTTTTGTAGGCAAAAAGAACATTTCTAAAGTCTCAAGGAATAGC
TTCCTAAAGTGTTGAGTAAAGAGGCTAAATAAAATGAGACTAGTTTAATATAGAGAGAAAAATACCTTTATGGAGTAAACGTGTACATGA
TGATCATGGGTTGTCAGTGATTTGTGAACTGAGAGCAGCAACAACATTATTTTTTAAAAATCTTAAATCCTCTCAATGGATGGTTAACAA
ATGCTCAAAGTCCATTACTCTTTTTATTGGCTCTTGCAGGTTTTGTGTTTTATCATCAGTGCTTTTAGAAATGCAGGCCTTAACTTACTG
AACTGAACTTTCTGAAAACGTAATGTAGCAGTATCAATATACTTTTGGGCATAAAAATAGTTTCCTAGGTAAGGGGTGTGAGATATTCAA
AGAATACATGTGGCTAACAAGTGTAATGAGAAAGTTCATGTGTCACATGAAAATGATCATGTTTGTGTTGCTACAGCTTTTGTGGGAAAT
TTAGTTTAAAGGCAGCTCTTGGTGTACCTTAGTATATTTTAATCCACAATTATACCATTGATACTGAGAGGTGATACCCGATGATCTTCT
CTATAATATTCTTAGAGTAAAACAAAATCTCAAAAGTATTAATAGCTCTTCTACCCTTGAAGGTGACTGGTCCTGGGACAGTTAGAATCT
TTCAGGTTTACCTCTGTTCAGCAGATACTTCAGTAGGATACATAGCTTTTCTTCCAGTGAAACAAAGTTCATATCATCCATTGTTTTTCA
AGCACGTGACACCAGCCTCAAAGTAAATGACATGACCAGTGGTTGAACAGTCTAATTTTCAAATTTAATATAGAGCATATAACTTCTGAT
TTGATAGTATTTATTTTAAAAAATTATGTTTTCATCATTCATTTGAAAATGAAAAAGCCCCAAAGTGAGAACTTTGGGGGAGGGCCTAGA
ACATGGATAGATCTCTTAGTGGTCTTTCCAAAAGTACATGTACTTGAAATATTTTCATTATCATACTATTCTTTGAAAAAAAAGATGCTT
ACTGTATACTTGTTTTCAAGCATCCTCTAAAATCAAAGGTTTTGATCACAATATGCAGATTTCTCTTGATAGATACTTAAATAGGCTATT
TCTCTCCTCTTCTTGGGCAATGCCTTGTTTTCTCCTCTGAATATTTGCATTTGAAAGGATTGCTTCCTGTTCTGCTCATTGATCAAAGGT
AGGGCCAATTAAGGATTCTAACCCTAACCCAGCACCACAAAGCCCCCCTGGAGCATCTTCCCGGCTGGCAGGACCATGCCATCTCTGTGG
AGAAGGTGCTGGGGAGGGAAGTCCTTCCAGTGCCACATGGAGTGAGGCCCTGCCCATGCTGGGGACTTTGGGGAGGAATTTGGTATTCTG
GTGGCCTTGCTCAGCTCTCATTGAGATCTTTTCCTATCAGAATGTTAGTGAATATACTTCGCAGCTCTTTGTTCAGCAATAAGGAATATT
CTTTCAATTCCTGCTCTTCAAGCCAATTTACTACACCCAGTTGTCTTTCCAGAAGTTCATCCCAGCGGTAATATGTTGGTGTTTGTTCTT
CTTTGGATTTCACATCTGTTTTCTGGTAGAAGTGAGCACTGTTCACTTGTGCAGTCGTCTTATTTTCCTTCTTCCTAGATGACTCAGCTC
TTTGTAAATGTTGTGCTCAACTTCTAGGGGCCAGTTCTAGACTTTGGAGATGCAGTGTCTCCCAGGTGTGCACGGACACCTGGTCCGTGG
AAACAGGTGTGATGGGCACAGGCTGCTGCCCTTCTGTCTGGTCGGGGGATTCCTCTTCTTCAAGCTGCTCAGCTAACCCAGAAGAGGGGA
GAGAGTACTCCGGTGGTTCCCAGAGCCCCTCCCGTTGTGCCGCTTCGACCTGACACCTGCTCGATGCTGACTTAGGCTTCCTGCCACCAA
GCAGGAAACTAGAAAGAGAACATTTCAGTGTAAGGTCTGTTCCCGACAGCATGGATTAGCTTCCGTGTTCTGAAGTTGTTCTTTTCATGG
TGTCTGACACCGAGGGCGTTGTTCGTCCATCAGGCGGGATTGGATGGAGTCTTGGTGTTTTGCCTTCTCAGGGACCAAAAATGTATCATT
GACTCCTTAACAGTGACCTTCCTCCCAAGGACATATCCGTGTTCATTTTTCATAGGTTTTACTCATATTCATAGGTAGATTCTGTTAATG
TGAGTTGGAAAGAAAAGACCAATTTGTACACCAGTCACACCACAAGACAGTTTATCATATAAAATACCTCAATTTTTTGTATTCCTCATT
TCCACCTCACAATTGTACTGGTGATGAATTTTAAGGGTCTGTCCTTTAGCTTATAGGTGATGTTTCACATCTGGCCAGATTCTTATACCT
CCATTGTATACTTGAAAAGGTTCAGAATTACAGGAACAGCAGTGAGAATTTGGCCCACTACCACGACTCATTTGTTTCATTCACATTCCT
CACGTGCAACAACATAATTATATTTTAAGAAAATGTAACTTTGTTACATCAAAATATGTTGTCTAGTAAAAAGTTGATATTCAGTAGAAC
AAGGATCATGTAAATAAACATCTATTTCACATGTACCCAAAAGCATTTAAAAAGCAGAATCCAGGGCCCAGAGCATGAGCCAGGGAGGAG
GATGTTTTTCTTCTTTTCTCTATTTTTCCCTAAATTGTGCAAACATAGGTGAGTCTCTTAACCTTTCTGTGCCTCAGTTTTTCTACCTCT
AAAGGGGTGGGATGGTTCTTCAAATTGTTTCTAAAACACCGGCACTTTCAGCAGTGTTCTGGTGGCCTGAGATGAGAGCACCGTGTTCAG
AAGTGCCTGGGAGTGGCACAGTGGAAACTCCGCTTGCACGGACCATGGAGTCTGCTCAGGACCATGCTGTAGGACACACAGCCTCATGCG
CTGAGAAAGCAAAGGAAGTGCTGGGTGTAAAGTTTGCATGATTCCATGAAGCTTTAGTTTTCCTTTTTTTGTTTTAAAAGAAAGGGTTTT
ATATGTTCTATTGTAAAATATGGAAATTAAACAGGGACTTCAGAAAGCCGCACAGAAAGATCACCTTCCGATGGTGTGATGTGCTCCTGA
CATTCGGCCGAGGTCTGTATTCTGAAAAAGATTTAATGGCCTGTGAAACACGTGGATTCTGTTGCACTGGATTTGTAATAAATGACGCTG
AACTTCCTGCTTCCAAGCAGCTCAACCCTGATGCTGAACTGACACCAGGCGAATGTCAGGGCTCCCAAACCACTAGTGCCAAAGGGTCAT
GTTGAAAAGTTCAGAATATTTATTTGTCAGAATATAATAATTGCCCCCCACCTTAGTATTTTTGCACTTTACAGAAATTTAGATACTGTT
TTTCAGTGGCTTGAGCGTTTTGCCTTTTCAAAGGATAACTATTATTTTCTTGAAAATGGAATATAATCATGAGAGGAAGAAGATGTAAAA
AATGTCAAATGTTGATTGGTTGTGTAAAAGTTTTGTCATAGACATGTATTGGGGAGCTTCCAATTAGCATACATAGACACATGTGTCAGT
GGCCAAGACCTGCTTATATTTTGCTTTATAGATGTAGTCATAGCATGTTGTTATTGCCTCATGTAAATAAAAAGGCTATTAAGTTTTCCA

>In-frame_TCF12_ENST00000267811_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_6816nt
CGCGGAGGGATCCGGAGGCGAGCCGAGCGCGGTGGTGAGGCCGCCTCAGCGAAAAAAATGTCCGCCTGAAGAGACCCACAAGTTCTATTC
GGGGGGACCGACAGCCCGCCCCGGGAGGAAGGGGCGGCCAGGCCCGAAAGCCGCCTCCCCCTCCCAGACCCGAGAGCTCGTGCGGGGCAA
AGTGAACCGAGCCGCTGGGCGGTGCAAGGGGAAGCCCAAGCCCGTTCTCCCGGCCAAAGTGAACTTTAATCGGGGTGGTTGGATGCGGAG
ACGGGGCGGCAGGACCTGCTAGAAGTGGCCGAAGATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGA
CCTACTGGACTTCAGTGCGATGTTTTCCCCACCTGTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATC
AGGTACTTCCTATTTAACAGACATTGTGTGGTGGGCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGC
GGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCCCTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAA
CATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGTGCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCA
GGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTGTTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGAT
CGCGCCGGCCCATGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCAT
CGGGCTGGCGGCCCAAGACATCTTGCATAACAACCCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTG
CAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTAC
CACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCAC
GACCGTCTCCGTGGGGATTGTCCTTATACAGGTGTTCAAAGAGTTCAATTTCAACCTTGGGGAGATGAACAAATCTAATATGAAAACAGA
CTAGATTGCAATAGGAGCTTGGATGGTTCGAGGAATAGGCATTGGAGGTGGTTTCTGGCCGTGATTGGATGTGAAGTAGAAGAGGTCCTC
GATCATGGTGTTAGAATTGACTGGATAGTAACAGGTGGTCTGGTGGATAGCGGGGAGCATGGCTCAGCACCAGAGCAGAGGCCCAGCCAG
CCCTCTGCAGCCCAAACGTCCCCAACGGTTGCCTGGCACCATCTCTCTCTGATGAGACGAATCTCATTTTCATTTCCATTAACCTGGAAG
CTTTCATGAATATTCTCTTCTTTTAAAACATTTTAACATTATTTAAACAGAAAAAGATGGGCTCTTTCTGGTTAGTTGTTACATGATAGC
AGAGATATTTTTACTTAGATTACTTTGGGAATGAGAGATTGTTGTCTTGAACTCTGGCACTGTACAGTGAATGTGTCTGTAGTTGTGTTA
GTTTGCATTAAGCATGTATAACATTCAAGTATGTCATCCAAATAAGAGGCATATACATTGAATTGTTTTTAATCCTCTGACAAGTTGACT
CTTCGACCCCCACCCCCACCCAAGACATTTTAATAGTAAATAGAGAGAGAGAGAAGAGTTAATGAACATGAGGTAGTGTTCCACTGGCAG
GATGACTTTTCAATAGCTCAAATCAATTTCAGTGCCTTTATCACTTGAATTATTAACTTAATTTGACTCTTAATGTGTATATGTTCTTAG
ATTAGAATAATGCAACTTCGAGTATGCTTTAATATTTCAATATTCAAGTTACAAATGTATAAGGCAGTTAGAAATAATACAGTCACATGT
CACTTAATGATAGGGAAACATTCTGAGAAATGCATTGTAAGGTGACTTTATTGTGTGAACATCATGGAGTGCACTTATACAAACCTAGAT
GGGACACCTATGACCCACCCAGGCCAGATGGTACAGCCTGTTGCTCCTGGGCCACACACCTGTACAGCATGTGACCGCACTGAATACCGC
AGGCAATTGTAACACAGTGGTGAGTATTTGTGTTTACAAACATAGGAAAGGTACAGTAAAACTATGGTATTACAATGTTATGGGACCACC
GTCATGTAAGTGGTATGTCTTTGACAGAAACATGGTTACGTGGTTCATGACTGTATATTCACTGGAAGATAGTCAAGACTAAAGACACAT
TAGAGCAAATTGACCCCTTTAACATGTGATTATTGTCCAATTAAAGACAGTTGATTTAAGTAGCATGAGGTATTATTTTATTTGTATTCG
ATCTGTGTTACCTGGGATCCAGTATCAAATATATCCACATTCTTTATCAGCAAGCATTCATGGCCATTCAGAAGAAATAAATTAGGTAAC
TTGATAATAAGGCTAAGTGGGAGAGTACCTGTTCAATAGCTCATATATCGAGTACCCTGTCATACAGGAACAAGTTAAAGGACACAATTG
AGGTTAGGCTAGCTTCTACAAATTGCAATATGCAGTTTTTGAAAGATTTTCTAACAAAAAGCCAATAAATGTAGCCATCTCCTTGTTGTT
TGCAATGGCAGAGCATCCTAGAGTTCCTCAGCTAACCTCTCATTATGTGTCTTAAATGCAAAAGAGCCATTAATTATGCCAGTATTTGAA
TCAAAGAGGTCATTCTCTGTCTATAGTGTTCCCATCCATGTGTTCCAAATGGGAGCATAGCATGAAGTGATGCACATATTTCACCACGGT
ATCATGTACTTCATGGCCAGTGTTTTATCTCAGCAGGGAACTACGCCAAGTTGAAAGATGGGGTTGGGTAAAGTAGATTAGGTGAAGTAG
AACATAAAATTGAATAGTACCCAATTAAAGTTCCTCAGTAAGAAAAAAAATGTGTTTTTGTAGGCAAAAAGAACATTTCTAAAGTCTCAA
GGAATAGCTTCCTAAAGTGTTGAGTAAAGAGGCTAAATAAAATGAGACTAGTTTAATATAGAGAGAAAAATACCTTTATGGAGTAAACGT
GTACATGATGATCATGGGTTGTCAGTGATTTGTGAACTGAGAGCAGCAACAACATTATTTTTTAAAAATCTTAAATCCTCTCAATGGATG
GTTAACAAATGCTCAAAGTCCATTACTCTTTTTATTGGCTCTTGCAGGTTTTGTGTTTTATCATCAGTGCTTTTAGAAATGCAGGCCTTA
ACTTACTGAACTGAACTTTCTGAAAACGTAATGTAGCAGTATCAATATACTTTTGGGCATAAAAATAGTTTCCTAGGTAAGGGGTGTGAG
ATATTCAAAGAATACATGTGGCTAACAAGTGTAATGAGAAAGTTCATGTGTCACATGAAAATGATCATGTTTGTGTTGCTACAGCTTTTG
TGGGAAATTTAGTTTAAAGGCAGCTCTTGGTGTACCTTAGTATATTTTAATCCACAATTATACCATTGATACTGAGAGGTGATACCCGAT
GATCTTCTCTATAATATTCTTAGAGTAAAACAAAATCTCAAAAGTATTAATAGCTCTTCTACCCTTGAAGGTGACTGGTCCTGGGACAGT
TAGAATCTTTCAGGTTTACCTCTGTTCAGCAGATACTTCAGTAGGATACATAGCTTTTCTTCCAGTGAAACAAAGTTCATATCATCCATT
GTTTTTCAAGCACGTGACACCAGCCTCAAAGTAAATGACATGACCAGTGGTTGAACAGTCTAATTTTCAAATTTAATATAGAGCATATAA
CTTCTGATTTGATAGTATTTATTTTAAAAAATTATGTTTTCATCATTCATTTGAAAATGAAAAAGCCCCAAAGTGAGAACTTTGGGGGAG
GGCCTAGAACATGGATAGATCTCTTAGTGGTCTTTCCAAAAGTACATGTACTTGAAATATTTTCATTATCATACTATTCTTTGAAAAAAA
AGATGCTTACTGTATACTTGTTTTCAAGCATCCTCTAAAATCAAAGGTTTTGATCACAATATGCAGATTTCTCTTGATAGATACTTAAAT
AGGCTATTTCTCTCCTCTTCTTGGGCAATGCCTTGTTTTCTCCTCTGAATATTTGCATTTGAAAGGATTGCTTCCTGTTCTGCTCATTGA
TCAAAGGTAGGGCCAATTAAGGATTCTAACCCTAACCCAGCACCACAAAGCCCCCCTGGAGCATCTTCCCGGCTGGCAGGACCATGCCAT
CTCTGTGGAGAAGGTGCTGGGGAGGGAAGTCCTTCCAGTGCCACATGGAGTGAGGCCCTGCCCATGCTGGGGACTTTGGGGAGGAATTTG
GTATTCTGGTGGCCTTGCTCAGCTCTCATTGAGATCTTTTCCTATCAGAATGTTAGTGAATATACTTCGCAGCTCTTTGTTCAGCAATAA
GGAATATTCTTTCAATTCCTGCTCTTCAAGCCAATTTACTACACCCAGTTGTCTTTCCAGAAGTTCATCCCAGCGGTAATATGTTGGTGT
TTGTTCTTCTTTGGATTTCACATCTGTTTTCTGGTAGAAGTGAGCACTGTTCACTTGTGCAGTCGTCTTATTTTCCTTCTTCCTAGATGA
CTCAGCTCTTTGTAAATGTTGTGCTCAACTTCTAGGGGCCAGTTCTAGACTTTGGAGATGCAGTGTCTCCCAGGTGTGCACGGACACCTG
GTCCGTGGAAACAGGTGTGATGGGCACAGGCTGCTGCCCTTCTGTCTGGTCGGGGGATTCCTCTTCTTCAAGCTGCTCAGCTAACCCAGA
AGAGGGGAGAGAGTACTCCGGTGGTTCCCAGAGCCCCTCCCGTTGTGCCGCTTCGACCTGACACCTGCTCGATGCTGACTTAGGCTTCCT
GCCACCAAGCAGGAAACTAGAAAGAGAACATTTCAGTGTAAGGTCTGTTCCCGACAGCATGGATTAGCTTCCGTGTTCTGAAGTTGTTCT
TTTCATGGTGTCTGACACCGAGGGCGTTGTTCGTCCATCAGGCGGGATTGGATGGAGTCTTGGTGTTTTGCCTTCTCAGGGACCAAAAAT
GTATCATTGACTCCTTAACAGTGACCTTCCTCCCAAGGACATATCCGTGTTCATTTTTCATAGGTTTTACTCATATTCATAGGTAGATTC
TGTTAATGTGAGTTGGAAAGAAAAGACCAATTTGTACACCAGTCACACCACAAGACAGTTTATCATATAAAATACCTCAATTTTTTGTAT
TCCTCATTTCCACCTCACAATTGTACTGGTGATGAATTTTAAGGGTCTGTCCTTTAGCTTATAGGTGATGTTTCACATCTGGCCAGATTC
TTATACCTCCATTGTATACTTGAAAAGGTTCAGAATTACAGGAACAGCAGTGAGAATTTGGCCCACTACCACGACTCATTTGTTTCATTC
ACATTCCTCACGTGCAACAACATAATTATATTTTAAGAAAATGTAACTTTGTTACATCAAAATATGTTGTCTAGTAAAAAGTTGATATTC
AGTAGAACAAGGATCATGTAAATAAACATCTATTTCACATGTACCCAAAAGCATTTAAAAAGCAGAATCCAGGGCCCAGAGCATGAGCCA
GGGAGGAGGATGTTTTTCTTCTTTTCTCTATTTTTCCCTAAATTGTGCAAACATAGGTGAGTCTCTTAACCTTTCTGTGCCTCAGTTTTT
CTACCTCTAAAGGGGTGGGATGGTTCTTCAAATTGTTTCTAAAACACCGGCACTTTCAGCAGTGTTCTGGTGGCCTGAGATGAGAGCACC
GTGTTCAGAAGTGCCTGGGAGTGGCACAGTGGAAACTCCGCTTGCACGGACCATGGAGTCTGCTCAGGACCATGCTGTAGGACACACAGC
CTCATGCGCTGAGAAAGCAAAGGAAGTGCTGGGTGTAAAGTTTGCATGATTCCATGAAGCTTTAGTTTTCCTTTTTTTGTTTTAAAAGAA
AGGGTTTTATATGTTCTATTGTAAAATATGGAAATTAAACAGGGACTTCAGAAAGCCGCACAGAAAGATCACCTTCCGATGGTGTGATGT
GCTCCTGACATTCGGCCGAGGTCTGTATTCTGAAAAAGATTTAATGGCCTGTGAAACACGTGGATTCTGTTGCACTGGATTTGTAATAAA
TGACGCTGAACTTCCTGCTTCCAAGCAGCTCAACCCTGATGCTGAACTGACACCAGGCGAATGTCAGGGCTCCCAAACCACTAGTGCCAA
AGGGTCATGTTGAAAAGTTCAGAATATTTATTTGTCAGAATATAATAATTGCCCCCCACCTTAGTATTTTTGCACTTTACAGAAATTTAG
ATACTGTTTTTCAGTGGCTTGAGCGTTTTGCCTTTTCAAAGGATAACTATTATTTTCTTGAAAATGGAATATAATCATGAGAGGAAGAAG
ATGTAAAAAATGTCAAATGTTGATTGGTTGTGTAAAAGTTTTGTCATAGACATGTATTGGGGAGCTTCCAATTAGCATACATAGACACAT
GTGTCAGTGGCCAAGACCTGCTTATATTTTGCTTTATAGATGTAGTCATAGCATGTTGTTATTGCCTCATGTAAATAAAAAGGCTATTAA

>In-frame_TCF12_ENST00000452095_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_6806nt
TCCGGAGGCGAGCCGAGCGCGGTGGTGAGGCCGCCTCAGCGAAAAAAATGTCCGCCTGAAGAGACCCACAAGTTCTATTCGGGGGGACCG
ACAGCCCGCCCCGGGAGGAAGGGGCGGCCAGGCCCGAAAGCCGCCTCCCCCTCCCAGACCCGAGAGCTCGTGCGGGGCAAAGTGAACCGA
GCCGCTGGGCGGTGCAAGGGGAAGCCCAAGCCCGTTCTCCCGGCCAAAGTGAACTTTAATCGGGGTGGTTGGATGCGGAGACGGGGCGGC
AGGACCTGCTAGAAGTGGCCGAAGATGAATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGAC
TTCAGTGCGATGTTTTCCCCACCTGTTAATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCC
TATTTAACAGACATTGTGTGGTGGGCTGGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACG
GTCCTGGTAACCCCCCTGGGCGCCCTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGC
AAGTTGGGGTGCCTGCTAAGCTGTGCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTG
GAGGAAAAGCTGACCAATCCAGTGTTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCC
CATGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCG
GCCCAAGACATCTTGCATAACAACCCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATC
GTCCAGTTCAGGTACATCAACAAGGCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTC
CTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCC
GTGGGGATTGTCCTTATACAGGTGTTCAAAGAGTTCAATTTCAACCTTGGGGAGATGAACAAATCTAATATGAAAACAGACTAGATTGCA
ATAGGAGCTTGGATGGTTCGAGGAATAGGCATTGGAGGTGGTTTCTGGCCGTGATTGGATGTGAAGTAGAAGAGGTCCTCGATCATGGTG
TTAGAATTGACTGGATAGTAACAGGTGGTCTGGTGGATAGCGGGGAGCATGGCTCAGCACCAGAGCAGAGGCCCAGCCAGCCCTCTGCAG
CCCAAACGTCCCCAACGGTTGCCTGGCACCATCTCTCTCTGATGAGACGAATCTCATTTTCATTTCCATTAACCTGGAAGCTTTCATGAA
TATTCTCTTCTTTTAAAACATTTTAACATTATTTAAACAGAAAAAGATGGGCTCTTTCTGGTTAGTTGTTACATGATAGCAGAGATATTT
TTACTTAGATTACTTTGGGAATGAGAGATTGTTGTCTTGAACTCTGGCACTGTACAGTGAATGTGTCTGTAGTTGTGTTAGTTTGCATTA
AGCATGTATAACATTCAAGTATGTCATCCAAATAAGAGGCATATACATTGAATTGTTTTTAATCCTCTGACAAGTTGACTCTTCGACCCC
CACCCCCACCCAAGACATTTTAATAGTAAATAGAGAGAGAGAGAAGAGTTAATGAACATGAGGTAGTGTTCCACTGGCAGGATGACTTTT
CAATAGCTCAAATCAATTTCAGTGCCTTTATCACTTGAATTATTAACTTAATTTGACTCTTAATGTGTATATGTTCTTAGATTAGAATAA
TGCAACTTCGAGTATGCTTTAATATTTCAATATTCAAGTTACAAATGTATAAGGCAGTTAGAAATAATACAGTCACATGTCACTTAATGA
TAGGGAAACATTCTGAGAAATGCATTGTAAGGTGACTTTATTGTGTGAACATCATGGAGTGCACTTATACAAACCTAGATGGGACACCTA
TGACCCACCCAGGCCAGATGGTACAGCCTGTTGCTCCTGGGCCACACACCTGTACAGCATGTGACCGCACTGAATACCGCAGGCAATTGT
AACACAGTGGTGAGTATTTGTGTTTACAAACATAGGAAAGGTACAGTAAAACTATGGTATTACAATGTTATGGGACCACCGTCATGTAAG
TGGTATGTCTTTGACAGAAACATGGTTACGTGGTTCATGACTGTATATTCACTGGAAGATAGTCAAGACTAAAGACACATTAGAGCAAAT
TGACCCCTTTAACATGTGATTATTGTCCAATTAAAGACAGTTGATTTAAGTAGCATGAGGTATTATTTTATTTGTATTCGATCTGTGTTA
CCTGGGATCCAGTATCAAATATATCCACATTCTTTATCAGCAAGCATTCATGGCCATTCAGAAGAAATAAATTAGGTAACTTGATAATAA
GGCTAAGTGGGAGAGTACCTGTTCAATAGCTCATATATCGAGTACCCTGTCATACAGGAACAAGTTAAAGGACACAATTGAGGTTAGGCT
AGCTTCTACAAATTGCAATATGCAGTTTTTGAAAGATTTTCTAACAAAAAGCCAATAAATGTAGCCATCTCCTTGTTGTTTGCAATGGCA
GAGCATCCTAGAGTTCCTCAGCTAACCTCTCATTATGTGTCTTAAATGCAAAAGAGCCATTAATTATGCCAGTATTTGAATCAAAGAGGT
CATTCTCTGTCTATAGTGTTCCCATCCATGTGTTCCAAATGGGAGCATAGCATGAAGTGATGCACATATTTCACCACGGTATCATGTACT
TCATGGCCAGTGTTTTATCTCAGCAGGGAACTACGCCAAGTTGAAAGATGGGGTTGGGTAAAGTAGATTAGGTGAAGTAGAACATAAAAT
TGAATAGTACCCAATTAAAGTTCCTCAGTAAGAAAAAAAATGTGTTTTTGTAGGCAAAAAGAACATTTCTAAAGTCTCAAGGAATAGCTT
CCTAAAGTGTTGAGTAAAGAGGCTAAATAAAATGAGACTAGTTTAATATAGAGAGAAAAATACCTTTATGGAGTAAACGTGTACATGATG
ATCATGGGTTGTCAGTGATTTGTGAACTGAGAGCAGCAACAACATTATTTTTTAAAAATCTTAAATCCTCTCAATGGATGGTTAACAAAT
GCTCAAAGTCCATTACTCTTTTTATTGGCTCTTGCAGGTTTTGTGTTTTATCATCAGTGCTTTTAGAAATGCAGGCCTTAACTTACTGAA
CTGAACTTTCTGAAAACGTAATGTAGCAGTATCAATATACTTTTGGGCATAAAAATAGTTTCCTAGGTAAGGGGTGTGAGATATTCAAAG
AATACATGTGGCTAACAAGTGTAATGAGAAAGTTCATGTGTCACATGAAAATGATCATGTTTGTGTTGCTACAGCTTTTGTGGGAAATTT
AGTTTAAAGGCAGCTCTTGGTGTACCTTAGTATATTTTAATCCACAATTATACCATTGATACTGAGAGGTGATACCCGATGATCTTCTCT
ATAATATTCTTAGAGTAAAACAAAATCTCAAAAGTATTAATAGCTCTTCTACCCTTGAAGGTGACTGGTCCTGGGACAGTTAGAATCTTT
CAGGTTTACCTCTGTTCAGCAGATACTTCAGTAGGATACATAGCTTTTCTTCCAGTGAAACAAAGTTCATATCATCCATTGTTTTTCAAG
CACGTGACACCAGCCTCAAAGTAAATGACATGACCAGTGGTTGAACAGTCTAATTTTCAAATTTAATATAGAGCATATAACTTCTGATTT
GATAGTATTTATTTTAAAAAATTATGTTTTCATCATTCATTTGAAAATGAAAAAGCCCCAAAGTGAGAACTTTGGGGGAGGGCCTAGAAC
ATGGATAGATCTCTTAGTGGTCTTTCCAAAAGTACATGTACTTGAAATATTTTCATTATCATACTATTCTTTGAAAAAAAAGATGCTTAC
TGTATACTTGTTTTCAAGCATCCTCTAAAATCAAAGGTTTTGATCACAATATGCAGATTTCTCTTGATAGATACTTAAATAGGCTATTTC
TCTCCTCTTCTTGGGCAATGCCTTGTTTTCTCCTCTGAATATTTGCATTTGAAAGGATTGCTTCCTGTTCTGCTCATTGATCAAAGGTAG
GGCCAATTAAGGATTCTAACCCTAACCCAGCACCACAAAGCCCCCCTGGAGCATCTTCCCGGCTGGCAGGACCATGCCATCTCTGTGGAG
AAGGTGCTGGGGAGGGAAGTCCTTCCAGTGCCACATGGAGTGAGGCCCTGCCCATGCTGGGGACTTTGGGGAGGAATTTGGTATTCTGGT
GGCCTTGCTCAGCTCTCATTGAGATCTTTTCCTATCAGAATGTTAGTGAATATACTTCGCAGCTCTTTGTTCAGCAATAAGGAATATTCT
TTCAATTCCTGCTCTTCAAGCCAATTTACTACACCCAGTTGTCTTTCCAGAAGTTCATCCCAGCGGTAATATGTTGGTGTTTGTTCTTCT
TTGGATTTCACATCTGTTTTCTGGTAGAAGTGAGCACTGTTCACTTGTGCAGTCGTCTTATTTTCCTTCTTCCTAGATGACTCAGCTCTT
TGTAAATGTTGTGCTCAACTTCTAGGGGCCAGTTCTAGACTTTGGAGATGCAGTGTCTCCCAGGTGTGCACGGACACCTGGTCCGTGGAA
ACAGGTGTGATGGGCACAGGCTGCTGCCCTTCTGTCTGGTCGGGGGATTCCTCTTCTTCAAGCTGCTCAGCTAACCCAGAAGAGGGGAGA
GAGTACTCCGGTGGTTCCCAGAGCCCCTCCCGTTGTGCCGCTTCGACCTGACACCTGCTCGATGCTGACTTAGGCTTCCTGCCACCAAGC
AGGAAACTAGAAAGAGAACATTTCAGTGTAAGGTCTGTTCCCGACAGCATGGATTAGCTTCCGTGTTCTGAAGTTGTTCTTTTCATGGTG
TCTGACACCGAGGGCGTTGTTCGTCCATCAGGCGGGATTGGATGGAGTCTTGGTGTTTTGCCTTCTCAGGGACCAAAAATGTATCATTGA
CTCCTTAACAGTGACCTTCCTCCCAAGGACATATCCGTGTTCATTTTTCATAGGTTTTACTCATATTCATAGGTAGATTCTGTTAATGTG
AGTTGGAAAGAAAAGACCAATTTGTACACCAGTCACACCACAAGACAGTTTATCATATAAAATACCTCAATTTTTTGTATTCCTCATTTC
CACCTCACAATTGTACTGGTGATGAATTTTAAGGGTCTGTCCTTTAGCTTATAGGTGATGTTTCACATCTGGCCAGATTCTTATACCTCC
ATTGTATACTTGAAAAGGTTCAGAATTACAGGAACAGCAGTGAGAATTTGGCCCACTACCACGACTCATTTGTTTCATTCACATTCCTCA
CGTGCAACAACATAATTATATTTTAAGAAAATGTAACTTTGTTACATCAAAATATGTTGTCTAGTAAAAAGTTGATATTCAGTAGAACAA
GGATCATGTAAATAAACATCTATTTCACATGTACCCAAAAGCATTTAAAAAGCAGAATCCAGGGCCCAGAGCATGAGCCAGGGAGGAGGA
TGTTTTTCTTCTTTTCTCTATTTTTCCCTAAATTGTGCAAACATAGGTGAGTCTCTTAACCTTTCTGTGCCTCAGTTTTTCTACCTCTAA
AGGGGTGGGATGGTTCTTCAAATTGTTTCTAAAACACCGGCACTTTCAGCAGTGTTCTGGTGGCCTGAGATGAGAGCACCGTGTTCAGAA
GTGCCTGGGAGTGGCACAGTGGAAACTCCGCTTGCACGGACCATGGAGTCTGCTCAGGACCATGCTGTAGGACACACAGCCTCATGCGCT
GAGAAAGCAAAGGAAGTGCTGGGTGTAAAGTTTGCATGATTCCATGAAGCTTTAGTTTTCCTTTTTTTGTTTTAAAAGAAAGGGTTTTAT
ATGTTCTATTGTAAAATATGGAAATTAAACAGGGACTTCAGAAAGCCGCACAGAAAGATCACCTTCCGATGGTGTGATGTGCTCCTGACA
TTCGGCCGAGGTCTGTATTCTGAAAAAGATTTAATGGCCTGTGAAACACGTGGATTCTGTTGCACTGGATTTGTAATAAATGACGCTGAA
CTTCCTGCTTCCAAGCAGCTCAACCCTGATGCTGAACTGACACCAGGCGAATGTCAGGGCTCCCAAACCACTAGTGCCAAAGGGTCATGT
TGAAAAGTTCAGAATATTTATTTGTCAGAATATAATAATTGCCCCCCACCTTAGTATTTTTGCACTTTACAGAAATTTAGATACTGTTTT
TCAGTGGCTTGAGCGTTTTGCCTTTTCAAAGGATAACTATTATTTTCTTGAAAATGGAATATAATCATGAGAGGAAGAAGATGTAAAAAA
TGTCAAATGTTGATTGGTTGTGTAAAAGTTTTGTCATAGACATGTATTGGGGAGCTTCCAATTAGCATACATAGACACATGTGTCAGTGG
CCAAGACCTGCTTATATTTTGCTTTATAGATGTAGTCATAGCATGTTGTTATTGCCTCATGTAAATAAAAAGGCTATTAAGTTTTCCAGT

>In-frame_TCF12_ENST00000333725_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_6747nt
AGAGACCCACAAGTTCTATTCGGGGGGACCGACAGCCCGCCCCGGGAGGAAGGGGCGGCCAGGCCCGAAAGCCGCCTCCCCCTCCCAGAC
CCGAGAGCTCGTGCGGGGCAAAGTGAACCGAGCCGCTGGGCGGTGCAAGGGGAAGCCCAAGCCCGTTCTCCCGGCCAAAGTGAACTTTAA
TCGGGGTGGTTGGATGCGGAGACGGGGCGGCAGGACCTGCTAGAAGTGGCCGAAGATGAATCCCCAGCAACAACGCATGGCCGCTATAGG
GACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCTGTTAATAGTGGGAAAACTAGACCAACTACACTGGG
AAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGGGCTGGCACAATCGCAATGGCTGTTGGCCAGATTGG
AAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCCCTTGGAGTACCGTTCGGGTCCATTTTAGCTTCCTA
TCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGTGCAGGCTCCGTCGTGCTGATTATCCACTCCCCAAA
GTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTGTTTGTGGGCTACCTGTGCATCGTGCTGCTCATGCT
GCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTCTACATCAGCATCTGCTCCTTGCTGGGCAGTTTCAC
CGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAACCCGTCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGT
ACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCGCTGGAGTGCTTCGACTCCTCGGTGTTCGGGGC
CATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTCCGGGAGTGGAGCAACGTGGGCCTGGTGGACTTCTT
GGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTGTTCAAAGAGTTCAATTTCAACCTTGGGGAGATGAA
CAAATCTAATATGAAAACAGACTAGATTGCAATAGGAGCTTGGATGGTTCGAGGAATAGGCATTGGAGGTGGTTTCTGGCCGTGATTGGA
TGTGAAGTAGAAGAGGTCCTCGATCATGGTGTTAGAATTGACTGGATAGTAACAGGTGGTCTGGTGGATAGCGGGGAGCATGGCTCAGCA
CCAGAGCAGAGGCCCAGCCAGCCCTCTGCAGCCCAAACGTCCCCAACGGTTGCCTGGCACCATCTCTCTCTGATGAGACGAATCTCATTT
TCATTTCCATTAACCTGGAAGCTTTCATGAATATTCTCTTCTTTTAAAACATTTTAACATTATTTAAACAGAAAAAGATGGGCTCTTTCT
GGTTAGTTGTTACATGATAGCAGAGATATTTTTACTTAGATTACTTTGGGAATGAGAGATTGTTGTCTTGAACTCTGGCACTGTACAGTG
AATGTGTCTGTAGTTGTGTTAGTTTGCATTAAGCATGTATAACATTCAAGTATGTCATCCAAATAAGAGGCATATACATTGAATTGTTTT
TAATCCTCTGACAAGTTGACTCTTCGACCCCCACCCCCACCCAAGACATTTTAATAGTAAATAGAGAGAGAGAGAAGAGTTAATGAACAT
GAGGTAGTGTTCCACTGGCAGGATGACTTTTCAATAGCTCAAATCAATTTCAGTGCCTTTATCACTTGAATTATTAACTTAATTTGACTC
TTAATGTGTATATGTTCTTAGATTAGAATAATGCAACTTCGAGTATGCTTTAATATTTCAATATTCAAGTTACAAATGTATAAGGCAGTT
AGAAATAATACAGTCACATGTCACTTAATGATAGGGAAACATTCTGAGAAATGCATTGTAAGGTGACTTTATTGTGTGAACATCATGGAG
TGCACTTATACAAACCTAGATGGGACACCTATGACCCACCCAGGCCAGATGGTACAGCCTGTTGCTCCTGGGCCACACACCTGTACAGCA
TGTGACCGCACTGAATACCGCAGGCAATTGTAACACAGTGGTGAGTATTTGTGTTTACAAACATAGGAAAGGTACAGTAAAACTATGGTA
TTACAATGTTATGGGACCACCGTCATGTAAGTGGTATGTCTTTGACAGAAACATGGTTACGTGGTTCATGACTGTATATTCACTGGAAGA
TAGTCAAGACTAAAGACACATTAGAGCAAATTGACCCCTTTAACATGTGATTATTGTCCAATTAAAGACAGTTGATTTAAGTAGCATGAG
GTATTATTTTATTTGTATTCGATCTGTGTTACCTGGGATCCAGTATCAAATATATCCACATTCTTTATCAGCAAGCATTCATGGCCATTC
AGAAGAAATAAATTAGGTAACTTGATAATAAGGCTAAGTGGGAGAGTACCTGTTCAATAGCTCATATATCGAGTACCCTGTCATACAGGA
ACAAGTTAAAGGACACAATTGAGGTTAGGCTAGCTTCTACAAATTGCAATATGCAGTTTTTGAAAGATTTTCTAACAAAAAGCCAATAAA
TGTAGCCATCTCCTTGTTGTTTGCAATGGCAGAGCATCCTAGAGTTCCTCAGCTAACCTCTCATTATGTGTCTTAAATGCAAAAGAGCCA
TTAATTATGCCAGTATTTGAATCAAAGAGGTCATTCTCTGTCTATAGTGTTCCCATCCATGTGTTCCAAATGGGAGCATAGCATGAAGTG
ATGCACATATTTCACCACGGTATCATGTACTTCATGGCCAGTGTTTTATCTCAGCAGGGAACTACGCCAAGTTGAAAGATGGGGTTGGGT
AAAGTAGATTAGGTGAAGTAGAACATAAAATTGAATAGTACCCAATTAAAGTTCCTCAGTAAGAAAAAAAATGTGTTTTTGTAGGCAAAA
AGAACATTTCTAAAGTCTCAAGGAATAGCTTCCTAAAGTGTTGAGTAAAGAGGCTAAATAAAATGAGACTAGTTTAATATAGAGAGAAAA
ATACCTTTATGGAGTAAACGTGTACATGATGATCATGGGTTGTCAGTGATTTGTGAACTGAGAGCAGCAACAACATTATTTTTTAAAAAT
CTTAAATCCTCTCAATGGATGGTTAACAAATGCTCAAAGTCCATTACTCTTTTTATTGGCTCTTGCAGGTTTTGTGTTTTATCATCAGTG
CTTTTAGAAATGCAGGCCTTAACTTACTGAACTGAACTTTCTGAAAACGTAATGTAGCAGTATCAATATACTTTTGGGCATAAAAATAGT
TTCCTAGGTAAGGGGTGTGAGATATTCAAAGAATACATGTGGCTAACAAGTGTAATGAGAAAGTTCATGTGTCACATGAAAATGATCATG
TTTGTGTTGCTACAGCTTTTGTGGGAAATTTAGTTTAAAGGCAGCTCTTGGTGTACCTTAGTATATTTTAATCCACAATTATACCATTGA
TACTGAGAGGTGATACCCGATGATCTTCTCTATAATATTCTTAGAGTAAAACAAAATCTCAAAAGTATTAATAGCTCTTCTACCCTTGAA
GGTGACTGGTCCTGGGACAGTTAGAATCTTTCAGGTTTACCTCTGTTCAGCAGATACTTCAGTAGGATACATAGCTTTTCTTCCAGTGAA
ACAAAGTTCATATCATCCATTGTTTTTCAAGCACGTGACACCAGCCTCAAAGTAAATGACATGACCAGTGGTTGAACAGTCTAATTTTCA
AATTTAATATAGAGCATATAACTTCTGATTTGATAGTATTTATTTTAAAAAATTATGTTTTCATCATTCATTTGAAAATGAAAAAGCCCC
AAAGTGAGAACTTTGGGGGAGGGCCTAGAACATGGATAGATCTCTTAGTGGTCTTTCCAAAAGTACATGTACTTGAAATATTTTCATTAT
CATACTATTCTTTGAAAAAAAAGATGCTTACTGTATACTTGTTTTCAAGCATCCTCTAAAATCAAAGGTTTTGATCACAATATGCAGATT
TCTCTTGATAGATACTTAAATAGGCTATTTCTCTCCTCTTCTTGGGCAATGCCTTGTTTTCTCCTCTGAATATTTGCATTTGAAAGGATT
GCTTCCTGTTCTGCTCATTGATCAAAGGTAGGGCCAATTAAGGATTCTAACCCTAACCCAGCACCACAAAGCCCCCCTGGAGCATCTTCC
CGGCTGGCAGGACCATGCCATCTCTGTGGAGAAGGTGCTGGGGAGGGAAGTCCTTCCAGTGCCACATGGAGTGAGGCCCTGCCCATGCTG
GGGACTTTGGGGAGGAATTTGGTATTCTGGTGGCCTTGCTCAGCTCTCATTGAGATCTTTTCCTATCAGAATGTTAGTGAATATACTTCG
CAGCTCTTTGTTCAGCAATAAGGAATATTCTTTCAATTCCTGCTCTTCAAGCCAATTTACTACACCCAGTTGTCTTTCCAGAAGTTCATC
CCAGCGGTAATATGTTGGTGTTTGTTCTTCTTTGGATTTCACATCTGTTTTCTGGTAGAAGTGAGCACTGTTCACTTGTGCAGTCGTCTT
ATTTTCCTTCTTCCTAGATGACTCAGCTCTTTGTAAATGTTGTGCTCAACTTCTAGGGGCCAGTTCTAGACTTTGGAGATGCAGTGTCTC
CCAGGTGTGCACGGACACCTGGTCCGTGGAAACAGGTGTGATGGGCACAGGCTGCTGCCCTTCTGTCTGGTCGGGGGATTCCTCTTCTTC
AAGCTGCTCAGCTAACCCAGAAGAGGGGAGAGAGTACTCCGGTGGTTCCCAGAGCCCCTCCCGTTGTGCCGCTTCGACCTGACACCTGCT
CGATGCTGACTTAGGCTTCCTGCCACCAAGCAGGAAACTAGAAAGAGAACATTTCAGTGTAAGGTCTGTTCCCGACAGCATGGATTAGCT
TCCGTGTTCTGAAGTTGTTCTTTTCATGGTGTCTGACACCGAGGGCGTTGTTCGTCCATCAGGCGGGATTGGATGGAGTCTTGGTGTTTT
GCCTTCTCAGGGACCAAAAATGTATCATTGACTCCTTAACAGTGACCTTCCTCCCAAGGACATATCCGTGTTCATTTTTCATAGGTTTTA
CTCATATTCATAGGTAGATTCTGTTAATGTGAGTTGGAAAGAAAAGACCAATTTGTACACCAGTCACACCACAAGACAGTTTATCATATA
AAATACCTCAATTTTTTGTATTCCTCATTTCCACCTCACAATTGTACTGGTGATGAATTTTAAGGGTCTGTCCTTTAGCTTATAGGTGAT
GTTTCACATCTGGCCAGATTCTTATACCTCCATTGTATACTTGAAAAGGTTCAGAATTACAGGAACAGCAGTGAGAATTTGGCCCACTAC
CACGACTCATTTGTTTCATTCACATTCCTCACGTGCAACAACATAATTATATTTTAAGAAAATGTAACTTTGTTACATCAAAATATGTTG
TCTAGTAAAAAGTTGATATTCAGTAGAACAAGGATCATGTAAATAAACATCTATTTCACATGTACCCAAAAGCATTTAAAAAGCAGAATC
CAGGGCCCAGAGCATGAGCCAGGGAGGAGGATGTTTTTCTTCTTTTCTCTATTTTTCCCTAAATTGTGCAAACATAGGTGAGTCTCTTAA
CCTTTCTGTGCCTCAGTTTTTCTACCTCTAAAGGGGTGGGATGGTTCTTCAAATTGTTTCTAAAACACCGGCACTTTCAGCAGTGTTCTG
GTGGCCTGAGATGAGAGCACCGTGTTCAGAAGTGCCTGGGAGTGGCACAGTGGAAACTCCGCTTGCACGGACCATGGAGTCTGCTCAGGA
CCATGCTGTAGGACACACAGCCTCATGCGCTGAGAAAGCAAAGGAAGTGCTGGGTGTAAAGTTTGCATGATTCCATGAAGCTTTAGTTTT
CCTTTTTTTGTTTTAAAAGAAAGGGTTTTATATGTTCTATTGTAAAATATGGAAATTAAACAGGGACTTCAGAAAGCCGCACAGAAAGAT
CACCTTCCGATGGTGTGATGTGCTCCTGACATTCGGCCGAGGTCTGTATTCTGAAAAAGATTTAATGGCCTGTGAAACACGTGGATTCTG
TTGCACTGGATTTGTAATAAATGACGCTGAACTTCCTGCTTCCAAGCAGCTCAACCCTGATGCTGAACTGACACCAGGCGAATGTCAGGG
CTCCCAAACCACTAGTGCCAAAGGGTCATGTTGAAAAGTTCAGAATATTTATTTGTCAGAATATAATAATTGCCCCCCACCTTAGTATTT
TTGCACTTTACAGAAATTTAGATACTGTTTTTCAGTGGCTTGAGCGTTTTGCCTTTTCAAAGGATAACTATTATTTTCTTGAAAATGGAA
TATAATCATGAGAGGAAGAAGATGTAAAAAATGTCAAATGTTGATTGGTTGTGTAAAAGTTTTGTCATAGACATGTATTGGGGAGCTTCC
AATTAGCATACATAGACACATGTGTCAGTGGCCAAGACCTGCTTATATTTTGCTTTATAGATGTAGTCATAGCATGTTGTTATTGCCTCA

>In-frame_TCF12_ENST00000557843_chr15_57213296_+_NIPA1_ENST00000337435_chr15_23062319_+_6599nt
GGGGAAGCCCAAGCCCGTTCTCCCGGCCAAAGTGAACTTTAATCGGGGTGGTTGGATGCGGAGACGGGGCGGCAGAAGTGGCCGAAGATG
AATCCCCAGCAACAACGCATGGCCGCTATAGGGACCGACAAGGAGCTGAGCGACCTACTGGACTTCAGTGCGATGTTTTCCCCACCTGTT
AATAGTGGGAAAACTAGACCAACTACACTGGGAAGCAGTCAATTCAGTGGATCAGGTACTTCCTATTTAACAGACATTGTGTGGTGGGCT
GGCACAATCGCAATGGCTGTTGGCCAGATTGGAAACTTCCTGGCTTACACGGCGGTCCCCACGGTCCTGGTAACCCCCCTGGGCGCCCTT
GGAGTACCGTTCGGGTCCATTTTAGCTTCCTATCTCCTGAAGGAAAAGCTCAACATCTTGGGCAAGTTGGGGTGCCTGCTAAGCTGTGCA
GGCTCCGTCGTGCTGATTATCCACTCCCCAAAGTCTGAGAGTGTGACAACTCAGGCTGAGCTGGAGGAAAAGCTGACCAATCCAGTGTTT
GTGGGCTACCTGTGCATCGTGCTGCTCATGCTGCTGCTGCTCATCTTCTGGATCGCGCCGGCCCATGGGCCCACCAACATCATGGTCTAC
ATCAGCATCTGCTCCTTGCTGGGCAGTTTCACCGTGCCTTCCACCAAGGGCATCGGGCTGGCGGCCCAAGACATCTTGCATAACAACCCG
TCCAGTCAGAGAGCCCTCTGCCTGTGCCTGGTACTCCTGGCCGTGCTCGGCTGCAGCATCATCGTCCAGTTCAGGTACATCAACAAGGCG
CTGGAGTGCTTCGACTCCTCGGTGTTCGGGGCCATCTACTACGTCGTGTTTACCACGCTGGTCCTGCTGGCCTCAGCCATCCTCTTCCGG
GAGTGGAGCAACGTGGGCCTGGTGGACTTCTTGGGGATGGCCTGTGGATTCACGACCGTCTCCGTGGGGATTGTCCTTATACAGGTGTTC
AAAGAGTTCAATTTCAACCTTGGGGAGATGAACAAATCTAATATGAAAACAGACTAGATTGCAATAGGAGCTTGGATGGTTCGAGGAATA
GGCATTGGAGGTGGTTTCTGGCCGTGATTGGATGTGAAGTAGAAGAGGTCCTCGATCATGGTGTTAGAATTGACTGGATAGTAACAGGTG
GTCTGGTGGATAGCGGGGAGCATGGCTCAGCACCAGAGCAGAGGCCCAGCCAGCCCTCTGCAGCCCAAACGTCCCCAACGGTTGCCTGGC
ACCATCTCTCTCTGATGAGACGAATCTCATTTTCATTTCCATTAACCTGGAAGCTTTCATGAATATTCTCTTCTTTTAAAACATTTTAAC
ATTATTTAAACAGAAAAAGATGGGCTCTTTCTGGTTAGTTGTTACATGATAGCAGAGATATTTTTACTTAGATTACTTTGGGAATGAGAG
ATTGTTGTCTTGAACTCTGGCACTGTACAGTGAATGTGTCTGTAGTTGTGTTAGTTTGCATTAAGCATGTATAACATTCAAGTATGTCAT
CCAAATAAGAGGCATATACATTGAATTGTTTTTAATCCTCTGACAAGTTGACTCTTCGACCCCCACCCCCACCCAAGACATTTTAATAGT
AAATAGAGAGAGAGAGAAGAGTTAATGAACATGAGGTAGTGTTCCACTGGCAGGATGACTTTTCAATAGCTCAAATCAATTTCAGTGCCT
TTATCACTTGAATTATTAACTTAATTTGACTCTTAATGTGTATATGTTCTTAGATTAGAATAATGCAACTTCGAGTATGCTTTAATATTT
CAATATTCAAGTTACAAATGTATAAGGCAGTTAGAAATAATACAGTCACATGTCACTTAATGATAGGGAAACATTCTGAGAAATGCATTG
TAAGGTGACTTTATTGTGTGAACATCATGGAGTGCACTTATACAAACCTAGATGGGACACCTATGACCCACCCAGGCCAGATGGTACAGC
CTGTTGCTCCTGGGCCACACACCTGTACAGCATGTGACCGCACTGAATACCGCAGGCAATTGTAACACAGTGGTGAGTATTTGTGTTTAC
AAACATAGGAAAGGTACAGTAAAACTATGGTATTACAATGTTATGGGACCACCGTCATGTAAGTGGTATGTCTTTGACAGAAACATGGTT
ACGTGGTTCATGACTGTATATTCACTGGAAGATAGTCAAGACTAAAGACACATTAGAGCAAATTGACCCCTTTAACATGTGATTATTGTC
CAATTAAAGACAGTTGATTTAAGTAGCATGAGGTATTATTTTATTTGTATTCGATCTGTGTTACCTGGGATCCAGTATCAAATATATCCA
CATTCTTTATCAGCAAGCATTCATGGCCATTCAGAAGAAATAAATTAGGTAACTTGATAATAAGGCTAAGTGGGAGAGTACCTGTTCAAT
AGCTCATATATCGAGTACCCTGTCATACAGGAACAAGTTAAAGGACACAATTGAGGTTAGGCTAGCTTCTACAAATTGCAATATGCAGTT
TTTGAAAGATTTTCTAACAAAAAGCCAATAAATGTAGCCATCTCCTTGTTGTTTGCAATGGCAGAGCATCCTAGAGTTCCTCAGCTAACC
TCTCATTATGTGTCTTAAATGCAAAAGAGCCATTAATTATGCCAGTATTTGAATCAAAGAGGTCATTCTCTGTCTATAGTGTTCCCATCC
ATGTGTTCCAAATGGGAGCATAGCATGAAGTGATGCACATATTTCACCACGGTATCATGTACTTCATGGCCAGTGTTTTATCTCAGCAGG
GAACTACGCCAAGTTGAAAGATGGGGTTGGGTAAAGTAGATTAGGTGAAGTAGAACATAAAATTGAATAGTACCCAATTAAAGTTCCTCA
GTAAGAAAAAAAATGTGTTTTTGTAGGCAAAAAGAACATTTCTAAAGTCTCAAGGAATAGCTTCCTAAAGTGTTGAGTAAAGAGGCTAAA
TAAAATGAGACTAGTTTAATATAGAGAGAAAAATACCTTTATGGAGTAAACGTGTACATGATGATCATGGGTTGTCAGTGATTTGTGAAC
TGAGAGCAGCAACAACATTATTTTTTAAAAATCTTAAATCCTCTCAATGGATGGTTAACAAATGCTCAAAGTCCATTACTCTTTTTATTG
GCTCTTGCAGGTTTTGTGTTTTATCATCAGTGCTTTTAGAAATGCAGGCCTTAACTTACTGAACTGAACTTTCTGAAAACGTAATGTAGC
AGTATCAATATACTTTTGGGCATAAAAATAGTTTCCTAGGTAAGGGGTGTGAGATATTCAAAGAATACATGTGGCTAACAAGTGTAATGA
GAAAGTTCATGTGTCACATGAAAATGATCATGTTTGTGTTGCTACAGCTTTTGTGGGAAATTTAGTTTAAAGGCAGCTCTTGGTGTACCT
TAGTATATTTTAATCCACAATTATACCATTGATACTGAGAGGTGATACCCGATGATCTTCTCTATAATATTCTTAGAGTAAAACAAAATC
TCAAAAGTATTAATAGCTCTTCTACCCTTGAAGGTGACTGGTCCTGGGACAGTTAGAATCTTTCAGGTTTACCTCTGTTCAGCAGATACT
TCAGTAGGATACATAGCTTTTCTTCCAGTGAAACAAAGTTCATATCATCCATTGTTTTTCAAGCACGTGACACCAGCCTCAAAGTAAATG
ACATGACCAGTGGTTGAACAGTCTAATTTTCAAATTTAATATAGAGCATATAACTTCTGATTTGATAGTATTTATTTTAAAAAATTATGT
TTTCATCATTCATTTGAAAATGAAAAAGCCCCAAAGTGAGAACTTTGGGGGAGGGCCTAGAACATGGATAGATCTCTTAGTGGTCTTTCC
AAAAGTACATGTACTTGAAATATTTTCATTATCATACTATTCTTTGAAAAAAAAGATGCTTACTGTATACTTGTTTTCAAGCATCCTCTA
AAATCAAAGGTTTTGATCACAATATGCAGATTTCTCTTGATAGATACTTAAATAGGCTATTTCTCTCCTCTTCTTGGGCAATGCCTTGTT
TTCTCCTCTGAATATTTGCATTTGAAAGGATTGCTTCCTGTTCTGCTCATTGATCAAAGGTAGGGCCAATTAAGGATTCTAACCCTAACC
CAGCACCACAAAGCCCCCCTGGAGCATCTTCCCGGCTGGCAGGACCATGCCATCTCTGTGGAGAAGGTGCTGGGGAGGGAAGTCCTTCCA
GTGCCACATGGAGTGAGGCCCTGCCCATGCTGGGGACTTTGGGGAGGAATTTGGTATTCTGGTGGCCTTGCTCAGCTCTCATTGAGATCT
TTTCCTATCAGAATGTTAGTGAATATACTTCGCAGCTCTTTGTTCAGCAATAAGGAATATTCTTTCAATTCCTGCTCTTCAAGCCAATTT
ACTACACCCAGTTGTCTTTCCAGAAGTTCATCCCAGCGGTAATATGTTGGTGTTTGTTCTTCTTTGGATTTCACATCTGTTTTCTGGTAG
AAGTGAGCACTGTTCACTTGTGCAGTCGTCTTATTTTCCTTCTTCCTAGATGACTCAGCTCTTTGTAAATGTTGTGCTCAACTTCTAGGG
GCCAGTTCTAGACTTTGGAGATGCAGTGTCTCCCAGGTGTGCACGGACACCTGGTCCGTGGAAACAGGTGTGATGGGCACAGGCTGCTGC
CCTTCTGTCTGGTCGGGGGATTCCTCTTCTTCAAGCTGCTCAGCTAACCCAGAAGAGGGGAGAGAGTACTCCGGTGGTTCCCAGAGCCCC
TCCCGTTGTGCCGCTTCGACCTGACACCTGCTCGATGCTGACTTAGGCTTCCTGCCACCAAGCAGGAAACTAGAAAGAGAACATTTCAGT
GTAAGGTCTGTTCCCGACAGCATGGATTAGCTTCCGTGTTCTGAAGTTGTTCTTTTCATGGTGTCTGACACCGAGGGCGTTGTTCGTCCA
TCAGGCGGGATTGGATGGAGTCTTGGTGTTTTGCCTTCTCAGGGACCAAAAATGTATCATTGACTCCTTAACAGTGACCTTCCTCCCAAG
GACATATCCGTGTTCATTTTTCATAGGTTTTACTCATATTCATAGGTAGATTCTGTTAATGTGAGTTGGAAAGAAAAGACCAATTTGTAC
ACCAGTCACACCACAAGACAGTTTATCATATAAAATACCTCAATTTTTTGTATTCCTCATTTCCACCTCACAATTGTACTGGTGATGAAT
TTTAAGGGTCTGTCCTTTAGCTTATAGGTGATGTTTCACATCTGGCCAGATTCTTATACCTCCATTGTATACTTGAAAAGGTTCAGAATT
ACAGGAACAGCAGTGAGAATTTGGCCCACTACCACGACTCATTTGTTTCATTCACATTCCTCACGTGCAACAACATAATTATATTTTAAG
AAAATGTAACTTTGTTACATCAAAATATGTTGTCTAGTAAAAAGTTGATATTCAGTAGAACAAGGATCATGTAAATAAACATCTATTTCA
CATGTACCCAAAAGCATTTAAAAAGCAGAATCCAGGGCCCAGAGCATGAGCCAGGGAGGAGGATGTTTTTCTTCTTTTCTCTATTTTTCC
CTAAATTGTGCAAACATAGGTGAGTCTCTTAACCTTTCTGTGCCTCAGTTTTTCTACCTCTAAAGGGGTGGGATGGTTCTTCAAATTGTT
TCTAAAACACCGGCACTTTCAGCAGTGTTCTGGTGGCCTGAGATGAGAGCACCGTGTTCAGAAGTGCCTGGGAGTGGCACAGTGGAAACT
CCGCTTGCACGGACCATGGAGTCTGCTCAGGACCATGCTGTAGGACACACAGCCTCATGCGCTGAGAAAGCAAAGGAAGTGCTGGGTGTA
AAGTTTGCATGATTCCATGAAGCTTTAGTTTTCCTTTTTTTGTTTTAAAAGAAAGGGTTTTATATGTTCTATTGTAAAATATGGAAATTA
AACAGGGACTTCAGAAAGCCGCACAGAAAGATCACCTTCCGATGGTGTGATGTGCTCCTGACATTCGGCCGAGGTCTGTATTCTGAAAAA
GATTTAATGGCCTGTGAAACACGTGGATTCTGTTGCACTGGATTTGTAATAAATGACGCTGAACTTCCTGCTTCCAAGCAGCTCAACCCT
GATGCTGAACTGACACCAGGCGAATGTCAGGGCTCCCAAACCACTAGTGCCAAAGGGTCATGTTGAAAAGTTCAGAATATTTATTTGTCA
GAATATAATAATTGCCCCCCACCTTAGTATTTTTGCACTTTACAGAAATTTAGATACTGTTTTTCAGTGGCTTGAGCGTTTTGCCTTTTC
AAAGGATAACTATTATTTTCTTGAAAATGGAATATAATCATGAGAGGAAGAAGATGTAAAAAATGTCAAATGTTGATTGGTTGTGTAAAA
GTTTTGTCATAGACATGTATTGGGGAGCTTCCAATTAGCATACATAGACACATGTGTCAGTGGCCAAGACCTGCTTATATTTTGCTTTAT
AGATGTAGTCATAGCATGTTGTTATTGCCTCATGTAAATAAAAAGGCTATTAAGTTTTCCAGTAATATTTATTAATCTGTATGTGTTTTA


Top

FusionGenePPI for TCF12_NIPA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TCF12ID2, ASCL4, TCF23, OLIG3, PRSS23, TAL1, ID1, ID3, TAL2, RUNX1T1, CREBBP, EP300, TAF4, TBP, RUNX1, TRIM33, ELAVL1, SMAD2, SMAD3, TCF3, FOXH1, NOTCH1, MYC, SOX2, TCF21, BMF, DGCR6, CDKN2C, MLLT6, PSMA1, QARS, RNASEL, SRI, STAT5A, TSNAX, STK16, MAPKBP1, ARMC8, EDRF1, CRCP, OSGIN1, NEUROG3, VPS28, SPG21, C1orf109, NAGK, HOPX, C16orf45, TWIST2, MORN4, HEXIM2, C6orf165, LYSMD1, TRIM72, SHMT2, MOV10, NXF1, MYOG, CCDC101, NEUROD1, MESP2, NTRK1, TCF12, FRMD6, MYF6, XPO1, ZWINT, STRN3, TCF4, NFATC2, ATOH1, FERD3L, TRIM25NIPA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTCF12chr15:57213296chr15:23062319ENST00000267811+320182_196491821RUNX1T1
HgeneTCF12chr15:57213296chr15:23062319ENST00000333725+321182_196491420RUNX1T1
HgeneTCF12chr15:57213296chr15:23062319ENST00000343827+113182_196-191254RUNX1T1
HgeneTCF12chr15:57213296chr15:23062319ENST00000438423+321182_196491398RUNX1T1
HgeneTCF12chr15:57213296chr15:23062319ENST00000557843+320182_196491301RUNX1T1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TCF12_NIPA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TCF12_NIPA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTCF12C3715051CRANIOSYNOSTOSIS 32UNIPROT
HgeneTCF12C0010278Craniosynostosis1CTD_human;HPO
TgeneNIPA1C1838192SPASTIC PARAPLEGIA 6, AUTOSOMAL DOMINANT (disorder)2CTD_human;ORPHANET;UNIPROT