FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37464

FusionGeneSummary for TBK1_ARHGAP5

check button Fusion gene summary
Fusion gene informationFusion gene name: TBK1_ARHGAP5
Fusion gene ID: 37464
HgeneTgene
Gene symbol

TBK1

ARHGAP5

Gene ID

29110

394

Gene nameTANK binding kinase 1Rho GTPase activating protein 5
SynonymsFTDALS4|IIAE8|NAK|T2KGFI2|RhoGAP5|p190-B|p190BRhoGAP
Cytomap

12q14.2

14q12

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase TBK1NF-kB-activating kinaseNF-kappa-B-activating kinaserho GTPase-activating protein 5growth factor independent 2p100 RasGAP-associated p105 proteinp105 RhoGAPrho-type GTPase-activating protein 5
Modification date2018052320180523
UniProtAcc

Q9UHD2

Q13017

Ensembl transtripts involved in fusion geneENST00000331710, ENST00000556611, 
ENST00000539826, ENST00000396582, 
ENST00000432921, ENST00000345122, 
ENST00000433497, 
Fusion gene scores* DoF score6 X 3 X 4=724 X 4 X 3=48
# samples 54
** MAII scorelog2(5/72*10)=-0.526068811667588
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TBK1 [Title/Abstract] AND ARHGAP5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneTBK1

GO:0006468

protein phosphorylation

27103069

HgeneTBK1

GO:0016239

positive regulation of macroautophagy

27103069

HgeneTBK1

GO:0018105

peptidyl-serine phosphorylation

25803835|27103069

HgeneTBK1

GO:0018107

peptidyl-threonine phosphorylation

27103069

HgeneTBK1

GO:0032727

positive regulation of interferon-alpha production

16127453

HgeneTBK1

GO:0032728

positive regulation of interferon-beta production

16127453

HgeneTBK1

GO:0045944

positive regulation of transcription by RNA polymerase II

16127453


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AO-A03O-01ATBK1chr12

64849737

+ARHGAP5chr14

32586346

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000331710ENST00000556611TBK1chr12

64849737

+ARHGAP5chr14

32586346

+
In-frameENST00000331710ENST00000539826TBK1chr12

64849737

+ARHGAP5chr14

32586346

+
5CDS-intronENST00000331710ENST00000396582TBK1chr12

64849737

+ARHGAP5chr14

32586346

+
5CDS-intronENST00000331710ENST00000432921TBK1chr12

64849737

+ARHGAP5chr14

32586346

+
5CDS-intronENST00000331710ENST00000345122TBK1chr12

64849737

+ARHGAP5chr14

32586346

+
5CDS-5UTRENST00000331710ENST00000433497TBK1chr12

64849737

+ARHGAP5chr14

32586346

+

Top

FusionProtFeatures for TBK1_ARHGAP5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TBK1

Q9UHD2

ARHGAP5

Q13017

Serine/threonine kinase that plays an essential role inregulating inflammatory responses to foreign agents. Followingactivation of toll-like receptors by viral or bacterialcomponents, associates with TRAF3 and TANK and phosphorylatesinterferon regulatory factors (IRFs) IRF3 and IRF7 as well asDDX3X. This activity allows subsequent homodimerization andnuclear translocation of the IRFs leading to transcriptionalactivation of pro-inflammatory and antiviral genes including IFNAand IFNB. In order to establish such an antiviral state, TBK1 formseveral different complexes whose composition depends on the typeof cell and cellular stimuli. Thus, several scaffolding moleculesincluding FADD, TRADD, MAVS, AZI2, TANK or TBKBP1/SINTBAD can berecruited to the TBK1-containing-complexes. Under particularconditions, functions as a NF-kappa-B effector by phosphorylatingNF-kappa-B inhibitor alpha/NFKBIA, IKBKB or RELA to translocateNF-Kappa-B to the nucleus. Restricts bacterial proliferation byphosphorylating the autophagy receptor OPTN/Optineurin on 'Ser-177', thus enhancing LC3 binding affinity and antibacterialautophagy (PubMed:21617041). Phosphorylates SMCR8 component of theC9orf72-SMCR8 complex, promoting autophagosome maturation(PubMed:27103069). Phosphorylates and activates AKT1(PubMed:21464307). Seems to play a role in energy balanceregulation by sustaining a state of chronic, low-gradeinflammation in obesity, wich leads to a negative impact oninsulin sensitivity. Attenuates retroviral budding byphosphorylating the endosomal sorting complex required fortransport-I (ESCRT-I) subunit VPS37C (PubMed:21270402).Phosphorylates Borna disease virus (BDV) P protein(PubMed:16155125). Plays an essential role in the TLR3- and IFN-dependent control of herpes virus HSV-1 and HSV-2 infections inthe central nervous system (PubMed:22851595).{ECO:0000269|PubMed:10581243, ECO:0000269|PubMed:10783893,ECO:0000269|PubMed:11839743, ECO:0000269|PubMed:12692549,ECO:0000269|PubMed:12702806, ECO:0000269|PubMed:14703513,ECO:0000269|PubMed:15367631, ECO:0000269|PubMed:15485837,ECO:0000269|PubMed:15489227, ECO:0000269|PubMed:16155125,ECO:0000269|PubMed:18583960, ECO:0000269|PubMed:21138416,ECO:0000269|PubMed:21270402, ECO:0000269|PubMed:21464307,ECO:0000269|PubMed:21617041, ECO:0000269|PubMed:21931631,ECO:0000269|PubMed:22851595, ECO:0000269|PubMed:23453971,ECO:0000269|PubMed:23453972, ECO:0000269|PubMed:23746807,ECO:0000269|PubMed:26611359, ECO:0000269|PubMed:27103069}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+22115_2329730Nucleotide bindingATP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+051225_1245-98238Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+061225_1245-21242Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+171262_144912391503DomainRho-GAP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+051262_1449-98238DomainRho-GAP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05267_325-98238DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05366_420-98238DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05427_481-98238DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05482_548-98238DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05590_763-98238DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000396582+05779_944-98238DomainpG2 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+171262_144912391502DomainRho-GAP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+061262_1449-21242DomainRho-GAP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06267_325-21242DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06366_420-21242DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06427_481-21242DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06482_548-21242DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06590_763-21242DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000433497+06779_944-21242DomainpG2 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+171262_144912391503DomainRho-GAP
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+171262_144912391502DomainRho-GAP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+221407_65729730Coiled coil.
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+221658_71329730Coiled coilOntology_term=ECO:0000255
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+221309_38529730DomainNote=Ubiquitin-like
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+2219_31029730DomainProtein kinase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+171225_124512391503Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+171225_124512391502Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+171225_124512391503Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+171225_124512391502Compositional biasNote=Lys-rich
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17267_32512391503DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17366_42012391503DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17427_48112391503DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17482_54812391503DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17590_76312391503DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000345122+17779_94412391503DomainpG2 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17267_32512391502DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17366_42012391502DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17427_48112391502DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17482_54812391502DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17590_76312391502DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000432921+17779_94412391502DomainpG2 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17267_32512391503DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17366_42012391503DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17427_48112391503DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17482_54812391503DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17590_76312391503DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000539826+17779_94412391503DomainpG2 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17267_32512391502DomainNote=FF 1
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17366_42012391502DomainNote=FF 2
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17427_48112391502DomainNote=FF 3
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17482_54812391502DomainNote=FF 4
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17590_76312391502DomainpG1 pseudoGTPase
TgeneARHGAP5chr12:64849737chr14:32586346ENST00000556611+17779_94412391502DomainpG2 pseudoGTPase


Top

FusionGeneSequence for TBK1_ARHGAP5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000556611_chr14_32586346_+_292aa
MQSTSNHLWLLSDILGQGATANVFRGRHKKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGN
KTDQDNIQKQFDQDHNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVITH
LNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQL

>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000539826_chr14_32586346_+_293aa
MQSTSNHLWLLSDILGQGATANVFRGRHKQKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSG
NKTDQDNIQKQFDQDHNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVIT
HLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000556611_chr14_32586346_+_876nt
ATGCAGAGCACTTCTAATCATCTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCTTTCGTGGAAGACATAAGAAA
AAGAAAACTAAGAACTTCAATCCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTCCAGGATCTGGTTACAGCTGAG
AAGCCCATACCACTATTTGTTGAGAAATGTGTGGAATTTATTGAAGATACAGGGTTATGTACCGAAGGACTCTACCGTGTCAGCGGGAAT
AAAACTGACCAAGACAATATTCAAAAGCAGTTTGATCAAGATCATAATATCAATCTAGTGTCAATGGAAGTAACAGTAAATGCTGTAGCT
GGAGCCCTTAAAGCTTTCTTTGCAGATCTGCCAGATCCTTTAATTCCATATTCTCTTCATCCAGAACTATTGGAAGCAGCAAAAATCCCG
GATAAAACAGAACGTCTTCATGCCTTGAAAGAAATTGTTAAGAAATTTCATCCTGTAAACTATGATGTATTCAGATACGTGATAACACAT
CTAAACAGGGTTAGTCAGCAACATAAAATCAACCTAATGACAGCAGACAACTTATCCATCTGTTTTTGGCCAACCTTGATGAGACCTGAT
TTTGAAAATCGAGAGTTTCTGTCTACTACTAAGATTCATCAATCTGTTGTTGAAACATTCATTCAGCAGTGTCAGTTTTTCTTTTACAAT
GGAGAAATTGTAGAAACGACAAACATTGTGGCTCCTCCACCACCTTCAAACCCAGGACAGTTGGTGGAACCAATGGTGCCACTTCAGTTG

>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000539826_chr14_32586346_+_879nt
ATGCAGAGCACTTCTAATCATCTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCTTTCGTGGAAGACATAAGCAG
AAAAAGAAAACTAAGAACTTCAATCCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTCCAGGATCTGGTTACAGCT
GAGAAGCCCATACCACTATTTGTTGAGAAATGTGTGGAATTTATTGAAGATACAGGGTTATGTACCGAAGGACTCTACCGTGTCAGCGGG
AATAAAACTGACCAAGACAATATTCAAAAGCAGTTTGATCAAGATCATAATATCAATCTAGTGTCAATGGAAGTAACAGTAAATGCTGTA
GCTGGAGCCCTTAAAGCTTTCTTTGCAGATCTGCCAGATCCTTTAATTCCATATTCTCTTCATCCAGAACTATTGGAAGCAGCAAAAATC
CCGGATAAAACAGAACGTCTTCATGCCTTGAAAGAAATTGTTAAGAAATTTCATCCTGTAAACTATGATGTATTCAGATACGTGATAACA
CATCTAAACAGGGTTAGTCAGCAACATAAAATCAACCTAATGACAGCAGACAACTTATCCATCTGTTTTTGGCCAACCTTGATGAGACCT
GATTTTGAAAATCGAGAGTTTCTGTCTACTACTAAGATTCATCAATCTGTTGTTGAAACATTCATTCAGCAGTGTCAGTTTTTCTTTTAC
AATGGAGAAATTGTAGAAACGACAAACATTGTGGCTCCTCCACCACCTTCAAACCCAGGACAGTTGGTGGAACCAATGGTGCCACTTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000556611_chr14_32586346_+_1278nt
AATCCCAATTACTGTGTTCGCTGCTCAGGGCTCCTCATTCCCCTTTAGAGTAAAGGGCGAGGGCAACAGTGGACGGGGTGTCTCCAGACA
TCCCCCTCATTACCGTGGCCGCGGAAGCCGACTCGGCAGTTGCCGCCGCGGCTGTGGTGACTACCAGACGGGCCATAGGCGTGCGCACGC
GCACCCGCACCGGCGCGCCGGCCGTCGGTCACGTGGCCTCCGGCCAGGGCTTGCGAAGCCGGAAGTGTCCTGAGTCTCGAGGAGGCCGCG
GGAGCCCGCCGGCGGTGGCGCGGCGGAGACCCGGCTGGTATAACAAGAGGATTGCCTGATCCAGCCAAGATGCAGAGCACTTCTAATCAT
CTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCTTTCGTGGAAGACATAAGAAAAAGAAAACTAAGAACTTCAAT
CCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTCCAGGATCTGGTTACAGCTGAGAAGCCCATACCACTATTTGTT
GAGAAATGTGTGGAATTTATTGAAGATACAGGGTTATGTACCGAAGGACTCTACCGTGTCAGCGGGAATAAAACTGACCAAGACAATATT
CAAAAGCAGTTTGATCAAGATCATAATATCAATCTAGTGTCAATGGAAGTAACAGTAAATGCTGTAGCTGGAGCCCTTAAAGCTTTCTTT
GCAGATCTGCCAGATCCTTTAATTCCATATTCTCTTCATCCAGAACTATTGGAAGCAGCAAAAATCCCGGATAAAACAGAACGTCTTCAT
GCCTTGAAAGAAATTGTTAAGAAATTTCATCCTGTAAACTATGATGTATTCAGATACGTGATAACACATCTAAACAGGGTTAGTCAGCAA
CATAAAATCAACCTAATGACAGCAGACAACTTATCCATCTGTTTTTGGCCAACCTTGATGAGACCTGATTTTGAAAATCGAGAGTTTCTG
TCTACTACTAAGATTCATCAATCTGTTGTTGAAACATTCATTCAGCAGTGTCAGTTTTTCTTTTACAATGGAGAAATTGTAGAAACGACA
AACATTGTGGCTCCTCCACCACCTTCAAACCCAGGACAGTTGGTGGAACCAATGGTGCCACTTCAGTTGCCGCCACCATTGCAACCTCAG
CTGATACAACCACAATTACAAACGGATCCTCTTGGTATTATATGAGTAGGAAGTGATTGCAAACAGGCTGGATTTGGACAAAAAGCAAAT

>In-frame_TBK1_ENST00000331710_chr12_64849737_+_ARHGAP5_ENST00000539826_chr14_32586346_+_1353nt
AATCCCAATTACTGTGTTCGCTGCTCAGGGCTCCTCATTCCCCTTTAGAGTAAAGGGCGAGGGCAACAGTGGACGGGGTGTCTCCAGACA
TCCCCCTCATTACCGTGGCCGCGGAAGCCGACTCGGCAGTTGCCGCCGCGGCTGTGGTGACTACCAGACGGGCCATAGGCGTGCGCACGC
GCACCCGCACCGGCGCGCCGGCCGTCGGTCACGTGGCCTCCGGCCAGGGCTTGCGAAGCCGGAAGTGTCCTGAGTCTCGAGGAGGCCGCG
GGAGCCCGCCGGCGGTGGCGCGGCGGAGACCCGGCTGGTATAACAAGAGGATTGCCTGATCCAGCCAAGATGCAGAGCACTTCTAATCAT
CTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCTTTCGTGGAAGACATAAGCAGAAAAAGAAAACTAAGAACTTC
AATCCACCAACACGTAGAAATTGGGAAAGTAATTACTTTGGGATGCCCCTCCAGGATCTGGTTACAGCTGAGAAGCCCATACCACTATTT
GTTGAGAAATGTGTGGAATTTATTGAAGATACAGGGTTATGTACCGAAGGACTCTACCGTGTCAGCGGGAATAAAACTGACCAAGACAAT
ATTCAAAAGCAGTTTGATCAAGATCATAATATCAATCTAGTGTCAATGGAAGTAACAGTAAATGCTGTAGCTGGAGCCCTTAAAGCTTTC
TTTGCAGATCTGCCAGATCCTTTAATTCCATATTCTCTTCATCCAGAACTATTGGAAGCAGCAAAAATCCCGGATAAAACAGAACGTCTT
CATGCCTTGAAAGAAATTGTTAAGAAATTTCATCCTGTAAACTATGATGTATTCAGATACGTGATAACACATCTAAACAGGGTTAGTCAG
CAACATAAAATCAACCTAATGACAGCAGACAACTTATCCATCTGTTTTTGGCCAACCTTGATGAGACCTGATTTTGAAAATCGAGAGTTT
CTGTCTACTACTAAGATTCATCAATCTGTTGTTGAAACATTCATTCAGCAGTGTCAGTTTTTCTTTTACAATGGAGAAATTGTAGAAACG
ACAAACATTGTGGCTCCTCCACCACCTTCAAACCCAGGACAGTTGGTGGAACCAATGGTGCCACTTCAGTTGCCGCCACCATTGCAACCT
CAGCTGATACAACCACAATTACAAACGGATCCTCTTGGTATTATATGAGTAGGAAGTGATTGCAAACAGGCTGGATTTGGACAAAAAGCA
AATCTAGACATGCATGTTTCAGGGTTCAGTAGTATACTTCATGTTTCATACAGATAATTCACATTCAAAATTACATTTTCTCTTTGAACT


Top

FusionGenePPI for TBK1_ARHGAP5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TBK1CDC37, HSP90AA2P, TANK, TBKBP1, TRAF2, NFKB1, IKBKG, BTRC, REL, CUL1, ANKRD28, PPP6R2, PPP6R1, NFKB2, PPP6C, RELA, SKP1, NCK1, CYLD, IRF3, TRAF3, TNFAIP3, RB1CC1, TNF, TMEM173, CALCOCO2, TLR4, TLR9, TLR3, NCOA2, AZI2, OPTN, ATG9A, CDC42BPG, FMR1, FXR2, MIB1, MAVS, AGO2, HMMR, IKBKE, LETM1, MTPAP, RBBP5, TXLNA, TXLNG, TICAM1, MIB2, NEDD4, NLRP4, DTX4, TNIP1, TAX1BP1, TBK1, MBP, XIAP, PELI1, HERC2, IRF7, TRAIP, TRIM27, SRC, NFKBIA, HSP90AA1, APP, RNF11, YWHAE, TOMM70A, TRAF3IP2, DDX58, SYK, PROS1, STX11, LATS2, EXOC2, EGFR, CCDC8, MAP1LC3B, AKT1, SOCS3, SQSTM1, STX12, STX3, STX19, APBA3, BBOX1, TRIM10, IFIT3, USP2, NTRK1, MED4, SCLT1, SSX2IP, OFD1, CEP152, CNTROB, CEP128, CEP135, CEP44, CEP63, NINL, ODF2, SASS6, STIL, XPO1, ESR1, MCM2, TRIM26, TRAF1, DYRK2, TRIM14, CTNNBL1, PBXIP1, SMURF1, TRAF6, TRIM9, GSK3B, RNF128, PLK1, HIF1AN, TXLNB, DFNB31, HERPUD1, TRAF5, TRIM23ARHGAP5RND3, RND1, RND2, RHOA, PXN, XRCC6, SMURF1, SMURF2, NPM1, ADRB2, UNK, CDH1, PTPRU, IQCF1, PLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneTBK1chr12:64849737chr14:32586346ENST00000331710+221621_62929730AZI2%2C TANK and TBKBP1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TBK1_ARHGAP5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TBK1_ARHGAP5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTBK1C4225325FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 42UNIPROT