FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37426

FusionGeneSummary for TBC1D9_CORO1C

check button Fusion gene summary
Fusion gene informationFusion gene name: TBC1D9_CORO1C
Fusion gene ID: 37426
HgeneTgene
Gene symbol

TBC1D9

CORO1C

Gene ID

23158

23603

Gene nameTBC1 domain family member 9coronin 1C
SynonymsGRAMD9|MDR1HCRNN4
Cytomap

4q31.21

12q24.11

Type of geneprotein-codingprotein-coding
DescriptionTBC1 domain family member 9TBC1 domain family member 9ATBC1 domain family, member 9 (with GRAM domain)coronin-1Ccoronin, actin binding protein, 1Ccoronin-3
Modification date2018052320180519
UniProtAcc

Q6ZT07

Q9ULV4

Ensembl transtripts involved in fusion geneENST00000442267, ENST00000261401, 
ENST00000541050, ENST00000549384, 
ENST00000421578, ENST00000420959, 
ENST00000549772, 
Fusion gene scores* DoF score5 X 6 X 3=908 X 6 X 5=240
# samples 58
** MAII scorelog2(5/90*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/240*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TBC1D9 [Title/Abstract] AND CORO1C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A0BR-01ATBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000442267ENST00000261401TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
In-frameENST00000442267ENST00000541050TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
5CDS-intronENST00000442267ENST00000549384TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
5CDS-5UTRENST00000442267ENST00000421578TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
5CDS-5UTRENST00000442267ENST00000420959TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-
5CDS-5UTRENST00000442267ENST00000549772TBC1D9chr4

141591874

-CORO1Cchr12

109072170

-

Top

FusionProtFeatures for TBC1D9_CORO1C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TBC1D9

Q6ZT07

CORO1C

Q9ULV4

May act as a GTPase-activating protein for Rab familyprotein(s). May be involved in cytokinesis, motility, and signaltransduction. {ECO:0000250}. Isoform 3: Involved in myogenic differentiation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBC1D9chr4:141591874chr12:109072170ENST00000442267-721146_2134221267DomainNote=GRAM 1
HgeneTBC1D9chr4:141591874chr12:109072170ENST00000442267-721293_3614221267DomainNote=GRAM 2
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-111436_47465475Coiled coilOntology_term=ECO:0000269
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-111436_474118528Coiled coilOntology_term=ECO:0000269
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-111436_47465475Coiled coilOntology_term=ECO:0000269
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-111436_47471481Coiled coilOntology_term=ECO:0000269
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-111128_16865475RepeatWD 3
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-111172_20265475RepeatWD 4
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-111215_24965475RepeatWD 5
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-111263_30365475RepeatWD 6
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-11178_11865475RepeatWD 2
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-111128_168118528RepeatWD 3
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-111172_202118528RepeatWD 4
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-111215_249118528RepeatWD 5
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-111263_303118528RepeatWD 6
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-111128_16865475RepeatWD 3
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-111172_20265475RepeatWD 4
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-111215_24965475RepeatWD 5
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-111263_30365475RepeatWD 6
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-11178_11865475RepeatWD 2
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-111128_16871481RepeatWD 3
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-111172_20271481RepeatWD 4
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-111215_24971481RepeatWD 5
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-111263_30371481RepeatWD 6
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-11178_11871481RepeatWD 2

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBC1D9chr4:141591874chr12:109072170ENST00000442267-721515_7024221267DomainRab-GAP TBC
HgeneTBC1D9chr4:141591874chr12:109072170ENST00000442267-721886_9214221267DomainEF-hand
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000261401-11125_7065475RepeatWD 1
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-11125_70118528RepeatWD 1
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000420959-11178_118118528RepeatWD 2
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000541050-11125_7065475RepeatWD 1
TgeneCORO1Cchr4:141591874chr12:109072170ENST00000549772-11125_7071481RepeatWD 1


Top

FusionGeneSequence for TBC1D9_CORO1C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000261401_chr12_109072170_-_832aa
MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACGGSRKEITEH
WEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPK
LKRKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSDDETGRIDKSYPTVCGHTGPVLDIDWCPHND
QVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWN
RNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFY
DPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYP
DTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKD

>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000541050_chr12_109072170_-_832aa
MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACGGSRKEITEH
WEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPK
LKRKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSDDETGRIDKSYPTVCGHTGPVLDIDWCPHND
QVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWN
RNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFY
DPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYP
DTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000261401_chr12_109072170_-_2496nt
ATGTGGGTGAACCCGGAGGAGGTGTTGCTGGCCAACGCGCTGTGGATCACCGAGAGGGCCAACCCATACTTCATCCTGCAGCGGAGGAAG
GGCCACGCCGGCGATGGAGGCGGCGGCGGCGGACTGGCGGGCCTGCTGGTGGGTACCCTTGATGTTGTGTTGGACTCCAGCGCCCGGGTC
GCTCCTTACCGAATCTTGTACCAGACTCCAGACTCCCTGGTCTACTGGACCATCGCCTGTGGTGGTTCCAGGAAAGAAATCACTGAACAC
TGGGAATGGCTTGAGCAAAATCTCTTGCAGACACTCTCCATCTTTGAAAATGAGAATGATATCACCACATTTGTGAGAGGAAAAATACAG
GGCATCATTGCAGAATACAACAAAATCAATGATGTAAAGGAAGATGATGACACGGAGAAGTTTAAAGAAGCCATTGTGAAATTTCATAGG
CTGTTTGGGATGCCAGAGGAAGAGAAACTCGTCAACTATTACTCTTGCAGCTATTGGAAGGGGAAGGTCCCCCGTCAGGGTTGGATGTAC
CTCAGCATTAACCACCTTTGCTTTTATTCTTTTCTTATGGGAAGGGAAGCGAAACTGGTCATCCGGTGGGTAGACATCACTCAGCTTGAG
AAGAATGCCACCCTGCTTCTGCCTGATGTGATCAAAGTGAGCACACGGTCCAGTGAGCATTTCTTCTCTGTATTCCTCAACATCAACGAG
ACCTTCAAGTTAATGGAGCAGCTTGCCAACATAGCCATGAGGCAACTCTTAGACAATGAGGGATTTGAACAAGATCGATCCCTGCCCAAA
CTCAAAAGGAAATCTCCTAAAAAAGTGTCTGCTCTAAAACGTGATCTTGATGCCAGGGCAAAGAGTGAGAGATACCGTGCACTTTTCCGG
CTGCCCAAAGATGAAAAATTAGATGGCCACACAGACTGCACTCTCTGGACTCCATTTAACAAAATGCACATTTTGGGGCAGATGTTTGTG
TCCACAAATTACATCTGTTTTACCAGCAAGGAGGAGAACTTATGTAGCCTCATTATCCCGCTCCGTGAGGTGACAATTGTGGAAAAGGCA
GACAGCTCCAGTGTGCTCCCCAGTCCCTTATCCATCAGCACCCGAAACAGGATGACCTTCCTATTTGCCAACTTGAAAGATAGAGACTTT
CTAGTGCAGAGGATCTCAGATTTCCTGCAACAGACTACTTCCAAAATATATTCTGACAAGGAGTTTGCAGGAAGTTACAACAGTTCAGAT
GATGAGACTGGTCGAATTGACAAATCTTACCCTACAGTATGTGGCCACACAGGACCAGTGCTGGACATAGACTGGTGCCCACATAACGAT
CAGGTCATTGCCAGCGGTTCAGAGGACTGCACGGTCATGGTATGGCAGATCCCAGAAAATGGACTCACCCTTTCCCTGACTGAACCTGTG
GTGATTTTGGAAGGCCACTCAAAGAGAGTCGGCATCGTGGCTTGGCATCCAACGGCCCGCAATGTGCTTCTTAGTGCAGGCTGTGATAAT
GCCATTATCATCTGGAATGTGGGAACAGGGGAAGCCCTTATAAACTTGGACGATATGCATTCAGACATGATTTACAATGTGAGCTGGAAC
CGGAATGGCAGTCTGATCTGCACAGCTTCCAAAGACAAGAAAGTGAGAGTCATTGATCCCAGGAAACAAGAGATTGTTGCTGAGAAGGAG
AAAGCACATGAAGGAGCAAGACCCATGAGAGCCATCTTCCTGGCCGATGGCAATGTCTTCACCACTGGGTTCAGCCGCATGAGCGAGCGG
CAGCTGGCTCTCTGGAATCCGAAAAATATGCAGGAACCAATTGCTCTTCATGAGATGGACACTAGCAATGGGGTGTTGCTGCCTTTCTAT
GACCCTGACACCAGCATCATTTACTTATGTGGAAAGGGTGACAGCAGTATTCGCTATTTTGAGATCACGGATGAATCCCCGTACGTCCAC
TACCTCAACACATTCAGCAGCAAGGAGCCTCAGAGAGGGATGGGTTACATGCCCAAGAGGGGACTTGATGTTAACAAATGTGAGATTGCC
AGATTCTTCAAACTTCATGAGAGAAAGTGTGAACCTATTATTATGACTGTTCCCAGGAAGTCTGACCTTTTCCAAGATGACCTGTATCCT
GACACAGCGGGGCCAGAGGCCGCGCTGGAGGCAGAAGAGTGGTTCGAAGGCAAGAATGCAGACCCAATCCTCATCTCCTTGAAGCACGGG
TACATTCCAGGCAAAAACAGGGATCTCAAGGTGGTCAAGAAGAACATTCTGGATAGCAAGCCCACTGCAAACAAGAAGTGCGACCTGATC
AGCATCCCCAAGAAAACCACAGACACGGCCAGTGTGCAAAATGAAGCCAAGTTGGATGAGATTTTAAAAGAGATCAAATCTATAAAAGAC

>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000541050_chr12_109072170_-_2496nt
ATGTGGGTGAACCCGGAGGAGGTGTTGCTGGCCAACGCGCTGTGGATCACCGAGAGGGCCAACCCATACTTCATCCTGCAGCGGAGGAAG
GGCCACGCCGGCGATGGAGGCGGCGGCGGCGGACTGGCGGGCCTGCTGGTGGGTACCCTTGATGTTGTGTTGGACTCCAGCGCCCGGGTC
GCTCCTTACCGAATCTTGTACCAGACTCCAGACTCCCTGGTCTACTGGACCATCGCCTGTGGTGGTTCCAGGAAAGAAATCACTGAACAC
TGGGAATGGCTTGAGCAAAATCTCTTGCAGACACTCTCCATCTTTGAAAATGAGAATGATATCACCACATTTGTGAGAGGAAAAATACAG
GGCATCATTGCAGAATACAACAAAATCAATGATGTAAAGGAAGATGATGACACGGAGAAGTTTAAAGAAGCCATTGTGAAATTTCATAGG
CTGTTTGGGATGCCAGAGGAAGAGAAACTCGTCAACTATTACTCTTGCAGCTATTGGAAGGGGAAGGTCCCCCGTCAGGGTTGGATGTAC
CTCAGCATTAACCACCTTTGCTTTTATTCTTTTCTTATGGGAAGGGAAGCGAAACTGGTCATCCGGTGGGTAGACATCACTCAGCTTGAG
AAGAATGCCACCCTGCTTCTGCCTGATGTGATCAAAGTGAGCACACGGTCCAGTGAGCATTTCTTCTCTGTATTCCTCAACATCAACGAG
ACCTTCAAGTTAATGGAGCAGCTTGCCAACATAGCCATGAGGCAACTCTTAGACAATGAGGGATTTGAACAAGATCGATCCCTGCCCAAA
CTCAAAAGGAAATCTCCTAAAAAAGTGTCTGCTCTAAAACGTGATCTTGATGCCAGGGCAAAGAGTGAGAGATACCGTGCACTTTTCCGG
CTGCCCAAAGATGAAAAATTAGATGGCCACACAGACTGCACTCTCTGGACTCCATTTAACAAAATGCACATTTTGGGGCAGATGTTTGTG
TCCACAAATTACATCTGTTTTACCAGCAAGGAGGAGAACTTATGTAGCCTCATTATCCCGCTCCGTGAGGTGACAATTGTGGAAAAGGCA
GACAGCTCCAGTGTGCTCCCCAGTCCCTTATCCATCAGCACCCGAAACAGGATGACCTTCCTATTTGCCAACTTGAAAGATAGAGACTTT
CTAGTGCAGAGGATCTCAGATTTCCTGCAACAGACTACTTCCAAAATATATTCTGACAAGGAGTTTGCAGGAAGTTACAACAGTTCAGAT
GATGAGACTGGTCGAATTGACAAATCTTACCCTACAGTATGTGGCCACACAGGACCAGTGCTGGACATAGACTGGTGCCCACATAACGAT
CAGGTCATTGCCAGCGGTTCAGAGGACTGCACGGTCATGGTATGGCAGATCCCAGAAAATGGACTCACCCTTTCCCTGACTGAACCTGTG
GTGATTTTGGAAGGCCACTCAAAGAGAGTCGGCATCGTGGCTTGGCATCCAACGGCCCGCAATGTGCTTCTTAGTGCAGGCTGTGATAAT
GCCATTATCATCTGGAATGTGGGAACAGGGGAAGCCCTTATAAACTTGGACGATATGCATTCAGACATGATTTACAATGTGAGCTGGAAC
CGGAATGGCAGTCTGATCTGCACAGCTTCCAAAGACAAGAAAGTGAGAGTCATTGATCCCAGGAAACAAGAGATTGTTGCTGAGAAGGAG
AAAGCACATGAAGGAGCAAGACCCATGAGAGCCATCTTCCTGGCCGATGGCAATGTCTTCACCACTGGGTTCAGCCGCATGAGCGAGCGG
CAGCTGGCTCTCTGGAATCCGAAAAATATGCAGGAACCAATTGCTCTTCATGAGATGGACACTAGCAATGGGGTGTTGCTGCCTTTCTAT
GACCCTGACACCAGCATCATTTACTTATGTGGAAAGGGTGACAGCAGTATTCGCTATTTTGAGATCACGGATGAATCCCCGTACGTCCAC
TACCTCAACACATTCAGCAGCAAGGAGCCTCAGAGAGGGATGGGTTACATGCCCAAGAGGGGACTTGATGTTAACAAATGTGAGATTGCC
AGATTCTTCAAACTTCATGAGAGAAAGTGTGAACCTATTATTATGACTGTTCCCAGGAAGTCTGACCTTTTCCAAGATGACCTGTATCCT
GACACAGCGGGGCCAGAGGCCGCGCTGGAGGCAGAAGAGTGGTTCGAAGGCAAGAATGCAGACCCAATCCTCATCTCCTTGAAGCACGGG
TACATTCCAGGCAAAAACAGGGATCTCAAGGTGGTCAAGAAGAACATTCTGGATAGCAAGCCCACTGCAAACAAGAAGTGCGACCTGATC
AGCATCCCCAAGAAAACCACAGACACGGCCAGTGTGCAAAATGAAGCCAAGTTGGATGAGATTTTAAAAGAGATCAAATCTATAAAAGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000261401_chr12_109072170_-_4865nt
GCGCGCCTGTCGCGGTGGTGGGTGCAGGACTGGACCCACGGGCCCATTGTGCGCCCGCCCGCGGCAGCCAGGACCATGTGGGTGAACCCG
GAGGAGGTGTTGCTGGCCAACGCGCTGTGGATCACCGAGAGGGCCAACCCATACTTCATCCTGCAGCGGAGGAAGGGCCACGCCGGCGAT
GGAGGCGGCGGCGGCGGACTGGCGGGCCTGCTGGTGGGTACCCTTGATGTTGTGTTGGACTCCAGCGCCCGGGTCGCTCCTTACCGAATC
TTGTACCAGACTCCAGACTCCCTGGTCTACTGGACCATCGCCTGTGGTGGTTCCAGGAAAGAAATCACTGAACACTGGGAATGGCTTGAG
CAAAATCTCTTGCAGACACTCTCCATCTTTGAAAATGAGAATGATATCACCACATTTGTGAGAGGAAAAATACAGGGCATCATTGCAGAA
TACAACAAAATCAATGATGTAAAGGAAGATGATGACACGGAGAAGTTTAAAGAAGCCATTGTGAAATTTCATAGGCTGTTTGGGATGCCA
GAGGAAGAGAAACTCGTCAACTATTACTCTTGCAGCTATTGGAAGGGGAAGGTCCCCCGTCAGGGTTGGATGTACCTCAGCATTAACCAC
CTTTGCTTTTATTCTTTTCTTATGGGAAGGGAAGCGAAACTGGTCATCCGGTGGGTAGACATCACTCAGCTTGAGAAGAATGCCACCCTG
CTTCTGCCTGATGTGATCAAAGTGAGCACACGGTCCAGTGAGCATTTCTTCTCTGTATTCCTCAACATCAACGAGACCTTCAAGTTAATG
GAGCAGCTTGCCAACATAGCCATGAGGCAACTCTTAGACAATGAGGGATTTGAACAAGATCGATCCCTGCCCAAACTCAAAAGGAAATCT
CCTAAAAAAGTGTCTGCTCTAAAACGTGATCTTGATGCCAGGGCAAAGAGTGAGAGATACCGTGCACTTTTCCGGCTGCCCAAAGATGAA
AAATTAGATGGCCACACAGACTGCACTCTCTGGACTCCATTTAACAAAATGCACATTTTGGGGCAGATGTTTGTGTCCACAAATTACATC
TGTTTTACCAGCAAGGAGGAGAACTTATGTAGCCTCATTATCCCGCTCCGTGAGGTGACAATTGTGGAAAAGGCAGACAGCTCCAGTGTG
CTCCCCAGTCCCTTATCCATCAGCACCCGAAACAGGATGACCTTCCTATTTGCCAACTTGAAAGATAGAGACTTTCTAGTGCAGAGGATC
TCAGATTTCCTGCAACAGACTACTTCCAAAATATATTCTGACAAGGAGTTTGCAGGAAGTTACAACAGTTCAGATGATGAGACTGGTCGA
ATTGACAAATCTTACCCTACAGTATGTGGCCACACAGGACCAGTGCTGGACATAGACTGGTGCCCACATAACGATCAGGTCATTGCCAGC
GGTTCAGAGGACTGCACGGTCATGGTATGGCAGATCCCAGAAAATGGACTCACCCTTTCCCTGACTGAACCTGTGGTGATTTTGGAAGGC
CACTCAAAGAGAGTCGGCATCGTGGCTTGGCATCCAACGGCCCGCAATGTGCTTCTTAGTGCAGGCTGTGATAATGCCATTATCATCTGG
AATGTGGGAACAGGGGAAGCCCTTATAAACTTGGACGATATGCATTCAGACATGATTTACAATGTGAGCTGGAACCGGAATGGCAGTCTG
ATCTGCACAGCTTCCAAAGACAAGAAAGTGAGAGTCATTGATCCCAGGAAACAAGAGATTGTTGCTGAGAAGGAGAAAGCACATGAAGGA
GCAAGACCCATGAGAGCCATCTTCCTGGCCGATGGCAATGTCTTCACCACTGGGTTCAGCCGCATGAGCGAGCGGCAGCTGGCTCTCTGG
AATCCGAAAAATATGCAGGAACCAATTGCTCTTCATGAGATGGACACTAGCAATGGGGTGTTGCTGCCTTTCTATGACCCTGACACCAGC
ATCATTTACTTATGTGGAAAGGGTGACAGCAGTATTCGCTATTTTGAGATCACGGATGAATCCCCGTACGTCCACTACCTCAACACATTC
AGCAGCAAGGAGCCTCAGAGAGGGATGGGTTACATGCCCAAGAGGGGACTTGATGTTAACAAATGTGAGATTGCCAGATTCTTCAAACTT
CATGAGAGAAAGTGTGAACCTATTATTATGACTGTTCCCAGGAAGTCTGACCTTTTCCAAGATGACCTGTATCCTGACACAGCGGGGCCA
GAGGCCGCGCTGGAGGCAGAAGAGTGGTTCGAAGGCAAGAATGCAGACCCAATCCTCATCTCCTTGAAGCACGGGTACATTCCAGGCAAA
AACAGGGATCTCAAGGTGGTCAAGAAGAACATTCTGGATAGCAAGCCCACTGCAAACAAGAAGTGCGACCTGATCAGCATCCCCAAGAAA
ACCACAGACACGGCCAGTGTGCAAAATGAAGCCAAGTTGGATGAGATTTTAAAAGAGATCAAATCTATAAAAGACACAATCTGCAATCAA
GATGAGCGTATTTCCAAGTTAGAACAGCAGATGGCAAAGATAGCAGCCTGAAGGTCCCACCCCCACCCCTACAGAAAAAATGGGAGCAAG
AACTTGTGCTTGGGAGCTGGTTATTGGTGTGGTCCTAGGGAGGGCGGAAAGGGAGGCACTGCCATTTGGAGACATTCCATTTCAGATTTG
TCAACCAGCGATAGGCCACATTCCAGTAAGAACTCAATTTGTCTCCCAAATTTGCAGAAACAAAACGTGATTTAAAAGCTGAGCTTTTTA
TCAGAAAGCTTTTTTGATGTTTTAAGTGTTATGTGACTTGTTGAACTTTTTAAAAAGTGCTACTTTTAAAATCCCAGATACTCTGAATTT
TAGAAAACAAACTAATTCTGATTGTGTCGTGCCCAAGTACCCTTTTTTTTTTAATGAATAGGGACCAATGCCACATTGCTTTTTATATTT
CTTTCTTTTTTAATGTTGCCAAAACCAAAAGTAGCTTTGTTTTCCTTTGTATTTTGCTACTTTGCAGTATTTGTGTGTGTGGTTTTTTTT
CCTTAATTTGAAAGGGACAGCACTGTGTATGTTTATAAACTAAATGAAGATAAGATATTATTTTGTATAAACATTCATCTGAGAACAATC
AAAGCAGTAGCCACATGGTGCTGGCTCCTTTGCAGCACAAACCTGGTCATTTTGATGACTGTACAACAGGAAGACTTGAAAAATCACGTG
GATTCATATTACCACCGCTCTCATTTCATGGAGTCTTCTGATCAAAAAAGCTCACGTCGTATTTCTTCTTTTCCTTTCTCTTTTCTAGAA
ATTGGGTGTTTGTACCAGAATGGAATTTTGCTTCTCGGTTATCCTGTGCTTCAGATGATTATAATCTAACCCAAACTAGCATGTGTTTCT
GCAGTTTGTTACACACCTAGGATCATATTGCATTCATCACTTTAAACATCATGTTTCAGGTTTTGGTCAATACTTGACAAGGGTGCCCAG
GACAGGAAGACGTGTACTGCTGAGTGTTCCTTCTTGCCCTTTTCAGCAGCTTGCCCAGCTCTTGAGTACAGTGGTGGGGACTAAAAATGT
GGGCATGTGGAGAGGGGTATTTGCCCTGGGTGATCCTGTTTCCCTGTGCTGTCCCCATGCTGTGTTGGAGGAGGAAGTGGCTCTCCTTCC
ACCAACAAAGCTCCTGCTCTACCCTCTTCCTCACATGTGCTGCGACCTCTCTCAGGGCTCCCCCAGCCATTCCTTCTTTCCTTCCTGCCT
TTTAGCTCTAACCACATTAAGCTAAGACAAGGCCAGAGGGTGCGATTGAATGAGTATTGAGACTGAGGAGAATGATAGAGAGTGAAGCAG
AAACAGGAGCACAGACCTCTGCTGTAGCTTTAATGCATACAAACATGTCCCTCCGCACAACTAACCTGCCCTGCCTCTCCATCTCTCACC
AAGGCTGCGTCAAAGCACAGAGGCTCCCCGGACTCGGAGGGGGCCAGAGACTGAGCTCTGGTCACCTGTTCATTCCTCGGTTAGCTGGAA
CTTTGCCCCGTTTCCAGTTTCTTATAGTGCATGCTTGGGAAACAAGATTTAAGGAGCCTCTGTTTTGGAAGGGCTGTCTGTGATTGAACG
TGAAATGTGTAGTGCCATTGGGACCACGAAGGGAATTCTTGCACATGCTCGTGCTGGTGTGGGCATGGGACTGGCTGGAAACGTCTGTAT
GCAGGGAGCCAGGGTGAGGGCAGAGTGTGGTGACAGCCGAACTTGGAGTAATGTCCGTGTAGAAAAAGGACCATGTTCTTATCCAGCCAA
TACTGGGAGTGCTGTCTCCACAATTTCAGGGCATCTGAATGTTTGATGTGGTTTTGTGTGTGTGTATGTATGTGTTTAATATTGAAGTGG
ATCATGAGATGTAAAGAAAACAATAATGGCAATGACTTATATTCAAATCTGTATTTGTTTCTTTATCAATGTAATCTGCTGAGGACCTTT
TGTCTAAGATTCAGTAGTGTTTTAAGGTTCTGATATCGAATTAATGAAGTAAAGTTGTTGATGGTGGTGAAACACCGTAGGGCATGTGGT
TCAAAGAGAAGCAGGAGGGCAAGGGAAAGTTACCCTGATCTTAGTTTGTAGCTTATGACTTATTTAATGAATGGATGCCCAGCCAAGCTC
AGAGTAGGCGCCCAAAGCATTGTGGATTATTTTCCTGTTTTGTCTTTTTTTTTTTTTTTTTTTAAGCCATGACATCCCAGAAGAGGACAG
TGAATTACTCCTAGGTCGGCTCTTATAGAGTGGCCATAGTGTTCTGTCAAAACACTTGCTTCCATTTTCAGAGATAAAAATCATTGATTA

>In-frame_TBC1D9_ENST00000442267_chr4_141591874_-_CORO1C_ENST00000541050_chr12_109072170_-_3407nt
GCGCGCCTGTCGCGGTGGTGGGTGCAGGACTGGACCCACGGGCCCATTGTGCGCCCGCCCGCGGCAGCCAGGACCATGTGGGTGAACCCG
GAGGAGGTGTTGCTGGCCAACGCGCTGTGGATCACCGAGAGGGCCAACCCATACTTCATCCTGCAGCGGAGGAAGGGCCACGCCGGCGAT
GGAGGCGGCGGCGGCGGACTGGCGGGCCTGCTGGTGGGTACCCTTGATGTTGTGTTGGACTCCAGCGCCCGGGTCGCTCCTTACCGAATC
TTGTACCAGACTCCAGACTCCCTGGTCTACTGGACCATCGCCTGTGGTGGTTCCAGGAAAGAAATCACTGAACACTGGGAATGGCTTGAG
CAAAATCTCTTGCAGACACTCTCCATCTTTGAAAATGAGAATGATATCACCACATTTGTGAGAGGAAAAATACAGGGCATCATTGCAGAA
TACAACAAAATCAATGATGTAAAGGAAGATGATGACACGGAGAAGTTTAAAGAAGCCATTGTGAAATTTCATAGGCTGTTTGGGATGCCA
GAGGAAGAGAAACTCGTCAACTATTACTCTTGCAGCTATTGGAAGGGGAAGGTCCCCCGTCAGGGTTGGATGTACCTCAGCATTAACCAC
CTTTGCTTTTATTCTTTTCTTATGGGAAGGGAAGCGAAACTGGTCATCCGGTGGGTAGACATCACTCAGCTTGAGAAGAATGCCACCCTG
CTTCTGCCTGATGTGATCAAAGTGAGCACACGGTCCAGTGAGCATTTCTTCTCTGTATTCCTCAACATCAACGAGACCTTCAAGTTAATG
GAGCAGCTTGCCAACATAGCCATGAGGCAACTCTTAGACAATGAGGGATTTGAACAAGATCGATCCCTGCCCAAACTCAAAAGGAAATCT
CCTAAAAAAGTGTCTGCTCTAAAACGTGATCTTGATGCCAGGGCAAAGAGTGAGAGATACCGTGCACTTTTCCGGCTGCCCAAAGATGAA
AAATTAGATGGCCACACAGACTGCACTCTCTGGACTCCATTTAACAAAATGCACATTTTGGGGCAGATGTTTGTGTCCACAAATTACATC
TGTTTTACCAGCAAGGAGGAGAACTTATGTAGCCTCATTATCCCGCTCCGTGAGGTGACAATTGTGGAAAAGGCAGACAGCTCCAGTGTG
CTCCCCAGTCCCTTATCCATCAGCACCCGAAACAGGATGACCTTCCTATTTGCCAACTTGAAAGATAGAGACTTTCTAGTGCAGAGGATC
TCAGATTTCCTGCAACAGACTACTTCCAAAATATATTCTGACAAGGAGTTTGCAGGAAGTTACAACAGTTCAGATGATGAGACTGGTCGA
ATTGACAAATCTTACCCTACAGTATGTGGCCACACAGGACCAGTGCTGGACATAGACTGGTGCCCACATAACGATCAGGTCATTGCCAGC
GGTTCAGAGGACTGCACGGTCATGGTATGGCAGATCCCAGAAAATGGACTCACCCTTTCCCTGACTGAACCTGTGGTGATTTTGGAAGGC
CACTCAAAGAGAGTCGGCATCGTGGCTTGGCATCCAACGGCCCGCAATGTGCTTCTTAGTGCAGGCTGTGATAATGCCATTATCATCTGG
AATGTGGGAACAGGGGAAGCCCTTATAAACTTGGACGATATGCATTCAGACATGATTTACAATGTGAGCTGGAACCGGAATGGCAGTCTG
ATCTGCACAGCTTCCAAAGACAAGAAAGTGAGAGTCATTGATCCCAGGAAACAAGAGATTGTTGCTGAGAAGGAGAAAGCACATGAAGGA
GCAAGACCCATGAGAGCCATCTTCCTGGCCGATGGCAATGTCTTCACCACTGGGTTCAGCCGCATGAGCGAGCGGCAGCTGGCTCTCTGG
AATCCGAAAAATATGCAGGAACCAATTGCTCTTCATGAGATGGACACTAGCAATGGGGTGTTGCTGCCTTTCTATGACCCTGACACCAGC
ATCATTTACTTATGTGGAAAGGGTGACAGCAGTATTCGCTATTTTGAGATCACGGATGAATCCCCGTACGTCCACTACCTCAACACATTC
AGCAGCAAGGAGCCTCAGAGAGGGATGGGTTACATGCCCAAGAGGGGACTTGATGTTAACAAATGTGAGATTGCCAGATTCTTCAAACTT
CATGAGAGAAAGTGTGAACCTATTATTATGACTGTTCCCAGGAAGTCTGACCTTTTCCAAGATGACCTGTATCCTGACACAGCGGGGCCA
GAGGCCGCGCTGGAGGCAGAAGAGTGGTTCGAAGGCAAGAATGCAGACCCAATCCTCATCTCCTTGAAGCACGGGTACATTCCAGGCAAA
AACAGGGATCTCAAGGTGGTCAAGAAGAACATTCTGGATAGCAAGCCCACTGCAAACAAGAAGTGCGACCTGATCAGCATCCCCAAGAAA
ACCACAGACACGGCCAGTGTGCAAAATGAAGCCAAGTTGGATGAGATTTTAAAAGAGATCAAATCTATAAAAGACACAATCTGCAATCAA
GATGAGCGTATTTCCAAGTTAGAACAGCAGATGGCAAAGATAGCAGCCTGAAGGTCCCACCCCCACCCCTACAGAAAAAATGGGAGCAAG
AACTTGTGCTTGGGAGCTGGTTATTGGTGTGGTCCTAGGGAGGGCGGAAAGGGAGGCACTGCCATTTGGAGACATTCCATTTCAGATTTG
TCAACCAGCGATAGGCCACATTCCAGTAAGAACTCAATTTGTCTCCCAAATTTGCAGAAACAAAACGTGATTTAAAAGCTGAGCTTTTTA
TCAGAAAGCTTTTTTGATGTTTTAAGTGTTATGTGACTTGTTGAACTTTTTAAAAAGTGCTACTTTTAAAATCCCAGATACTCTGAATTT
TAGAAAACAAACTAATTCTGATTGTGTCGTGCCCAAGTACCCTTTTTTTTTTAATGAATAGGGACCAATGCCACATTGCTTTTTATATTT
CTTTCTTTTTTAATGTTGCCAAAACCAAAAGTAGCTTTGTTTTCCTTTGTATTTTGCTACTTTGCAGTATTTGTGTGTGTGGTTTTTTTT
CCTTAATTTGAAAGGGACAGCACTGTGTATGTTTATAAACTAAATGAAGATAAGATATTATTTTGTATAAACATTCATCTGAGAACAATC
AAAGCAGTAGCCACATGGTGCTGGCTCCTTTGCAGCACAAACCTGGTCATTTTGATGACTGTACAACAGGAAGACTTGAAAAATCACGTG
GATTCATATTACCACCGCTCTCATTTCATGGAGTCTTCTGATCAAAAAAGCTCACGTCGTATTTCTTCTTTTCCTTTCTCTTTTCTAGAA


Top

FusionGenePPI for TBC1D9_CORO1C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TBC1D9MAP1LC3B, GABARAPL2, MAP1LC3A, GABARAPL1, LANCL1, PRICKLE3, SRSF2, SNRPE, SSB, YME1L1, DDX41, PRPF38B, ABHD16A, TBC1D9B, TMEM55A, MRS2, CPT1A, EPHA1, MUL1CORO1CUSP45, ELAVL1, CBL, UBASH3B, PIK3R2, SHC1, CRK, AP2M1, MRPS5, ACTB, STT3B, GNAI2, RAB7A, CYB5B, MMGT1, ACTR2, RHOB, TPM4, PREB, FMNL1, BTK, FN1, VCAM1, UBL4A, PAN2, LMO2, LRCH3, CORO1B, DNAJB11, VPS26A, VPS35, ETF1, FAM129B, GARS, H3F3A, NUDC, PAPOLA, SMOC1, TARS, TP53, ALK, CUL7, OBSL1, DAPK1, ABCE1, ACTG1, ACTR3, AIMP1, ATP6V1F, ALG9, FAP, MCTS1, MDH2, NFYC, NHP2L1, PHKB, RAD23B, SEPT10, SFTPA2, MRPL1, MYCBP, PDIA3, RPA1, SKP1, TIPRL, MED4, MED20, MED23, CAPZA2, CDK2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, PPP1CC, IQGAP1, SYNPO, LIMA1, ANLN, MYO19, MYO18A, RCC2, RAC1, ESR1, PDP1, CORO6, CORO1A, GTPBP1, SSH1, DLST, PDHA1, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TBC1D9_CORO1C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TBC1D9_CORO1C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTBC1D9C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneCORO1CC0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneCORO1CC0017661IGA Glomerulonephritis1CTD_human