FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37370

FusionGeneSummary for TBC1D22A_OTUD7A

check button Fusion gene summary
Fusion gene informationFusion gene name: TBC1D22A_OTUD7A
Fusion gene ID: 37370
HgeneTgene
Gene symbol

TBC1D22A

OTUD7A

Gene ID

25771

161725

Gene nameTBC1 domain family member 22AOTU deubiquitinase 7A
SynonymsC22orf4|HSC79E021C15orf16|C16ORF15|CEZANNE2|OTUD7
Cytomap

22q13.31

15q13.3

Type of geneprotein-codingprotein-coding
DescriptionTBC1 domain family member 22Aputative GTPase activatorOTU domain-containing protein 7AOTU domain-containing 7Acezanne 2zinc finger protein Cezanne 2
Modification date2018052320180523
UniProtAcc

Q8WUA7

Q8TE49

Ensembl transtripts involved in fusion geneENST00000337137, ENST00000380995, 
ENST00000407381, ENST00000355704, 
ENST00000472791, ENST00000406733, 
ENST00000382902, ENST00000307050, 
Fusion gene scores* DoF score18 X 10 X 12=21602 X 2 X 2=8
# samples 192
** MAII scorelog2(19/2160*10)=-3.50695998871988
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: TBC1D22A [Title/Abstract] AND OTUD7A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneOTUD7A

GO:0035871

protein K11-linked deubiquitination

23827681


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-BF-A5EQ-01ATBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337137ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000337137ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000380995ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000380995ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000407381ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000407381ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000355704ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000355704ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
intron-3CDSENST00000472791ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
intron-3CDSENST00000472791ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000406733ENST00000382902TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-
In-frameENST00000406733ENST00000307050TBC1D22Achr22

47308084

+OTUD7Achr15

31862400

-

Top

FusionProtFeatures for TBC1D22A_OTUD7A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TBC1D22A

Q8WUA7

OTUD7A

Q8TE49

Has deubiquitinating activity towards 'Lys-11'-linkedpolyubiquitin chains. {ECO:0000269|PubMed:20622874,ECO:0000269|PubMed:23827681}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000307050-011199_37450927DomainOTU
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000382902-011199_37450934DomainOTU
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000307050-011494_50950927MotifNuclear localization signal
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000382902-011494_50950934MotifNuclear localization signal
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000307050-011168_41050927RegionTRAF-binding
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000307050-011183_44950927RegionCatalytic
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000382902-011168_41050934RegionTRAF-binding
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000382902-011183_44950934RegionCatalytic
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000307050-011884_91950927Zinc fingerA20-type
TgeneOTUD7Achr22:47308084chr15:31862400ENST00000382902-011884_91950934Zinc fingerA20-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBC1D22Achr22:47308084chr15:31862400ENST00000337137+813222_446338518DomainRab-GAP TBC
HgeneTBC1D22Achr22:47308084chr15:31862400ENST00000355704+611222_446260440DomainRab-GAP TBC
HgeneTBC1D22Achr22:47308084chr15:31862400ENST00000380995+89222_446291325DomainRab-GAP TBC


Top

FusionGeneSequence for TBC1D22A_OTUD7A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_1222aa
MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLN
SEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTS
DPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRND
EVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTA
NLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSED
FRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRW
QQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAF
APIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLIL
SLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVAN
KLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGG
GPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPP
RRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGARDEACA
PAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSN

>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_1215aa
MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLN
SEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTS
DPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRND
EVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTA
NLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSED
FRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRW
QQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGG
IYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLN
LLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSK
TLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAW
KYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEG
VPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALR
PCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGG

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_1175aa
MPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGD
LRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTSDPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPV
RPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASG
YVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGIS
HASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGN
CLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGV
DNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQRE
QAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAD
SLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKE
KKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEE
MIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGT
ASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPG
ALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGRAETEHYCSYCYREELRRRREAR

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_1168aa
MPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGD
LRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTSDPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPV
RPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASG
YVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGIS
HASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGN
CLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPV
YESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLT
DSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRD
SVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRK
GSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLT
SAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGA
RRASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAG

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_1163aa
MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLN
SEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAEELRRLSWSGIPKPVRPMTWKLLSGYL
PANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPF
FVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARS
HVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWG
FHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLE
EFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHK
LLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSN
SNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEE
SGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQER
FSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASA
SGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAA

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_1156aa
MASDGARKQFWKRSNSKLPGSIQHVYGAQHPPFDPLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLN
SEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAEELRRLSWSGIPKPVRPMTWKLLSGYL
PANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPF
FVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARS
HVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWG
FHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVL
AHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFA
VDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGK
NGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASAST
SPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQ
RRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGR
SPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAAEHKSQTY

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_1144aa
MASDGARKQFWKRSNSKLPGSLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQ
GRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAEELRRLSWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYF
AFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIGKNWDLTAAL
SDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYT
FQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTG
AEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVA
DTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKD
DNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRK
EKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTD
KAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAA
AAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQSVIH
VQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLE

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_1137aa
MASDGARKQFWKRSNSKLPGSLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQ
GRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAEELRRLSWSGIPKPVRPMTWKLLSGYLPANVDRRPATLQRKQKEYF
AFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFVVFICEYIGKNWDLTAAL
SDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYT
FQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTG
AEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDS
GGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARL
AHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRA
DSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASP
AEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAAT
AKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGAR
DEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAP

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_1175aa
MPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGD
LRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTSDPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPV
RPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASG
YVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGIS
HASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGN
CLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKESGLVYTEEEWEREWTELLKLASSEPRTHFSKNGGTGGGV
DNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQRE
QAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAD
SLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKE
KKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEE
MIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGT
ASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPG
ALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGRAETEHYCSYCYREELRRRREAR

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_1168aa
MPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQRQGRPTLQEGPGLQQKPRPEAEPPSPPSGD
LRLVKSVSESHTSCPAESASDAAPLQRSQSLPHSATVTLGGTSDPSTLSSSALSEREASRLDKFKQLLAGPNTDLEELRRLSWSGIPKPV
RPMTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASG
YVQGINDLVTPFFVVFICEYIGKNWDLTAALSDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGIS
HASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGN
CLLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPV
YESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLT
DSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRD
SVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRK
GSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLT
SAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGA
RRASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3666nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCAC
CCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACC
TTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAAC
TCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTT
CAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCC
TGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCT
GACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACG
GACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCC
GCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGAC
GAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAG
ATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTT
GTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCC
AATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTG
CAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCAC
GTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGAT
TTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTG
TGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTT
CACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGG
CAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCC
AGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAG
TTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTC
GCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAA
GCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTG
CTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTG
TCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAG
CCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCT
AACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAAC
AAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGC
GCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCT
GGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGT
GGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTC
ATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTC
AGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCG
CGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCG
AGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGC
GGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCG
CCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCC
GCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAG
CACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAAC
GGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCAC

>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3645nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCAC
CCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACC
TTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAAC
TCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTT
CAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCC
TGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCT
GACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACG
GACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCC
GCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGAC
GAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAG
ATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTT
GTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCC
AATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTG
CAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCAC
GTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGAT
TTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTG
TGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTT
CACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGG
CAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTC
AGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCC
CATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGG
ATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTG
TCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTG
GACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAAC
CTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCG
GCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAAC
GGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAG
ACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAG
AACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCG
CCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGG
AAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTC
ACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGG
CGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGC
GTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGG
CGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGC
CCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGG
CCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACG
GTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACC
AACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGC
CCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGC

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3525nt
ATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGAC
GACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAG
CGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGAC
CTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCT
CTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGG
CTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTG
CGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATAT
TTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATG
AGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGA
TACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCT
CTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGA
GAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCC
CACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTAC
ACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCT
TTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAAC
TGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACG
GGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAG
TGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTG
GACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTG
GCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAAC
AGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAA
CAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAA
GACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGG
ATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGAC
TCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGC
AAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATG
GGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAG
AAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACA
GACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTC
AACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAG
ATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCT
GCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGC
CCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACG
GCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATC
CACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGC
TCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGG
GCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTG
GAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGC
GAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGC

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3504nt
ATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGAC
GACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAG
CGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGAC
CTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCT
CTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGG
CTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTG
CGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATAT
TTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATG
AGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGA
TACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCT
CTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGA
GAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCC
CACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTAC
ACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCT
TTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAAC
TGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACG
GGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAG
CTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTG
TACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGAC
TCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTG
GTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACG
GATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGG
CTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACA
CGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGAT
TCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGC
GCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTG
CACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAG
GGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCG
CCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATG
CAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACG
AGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCC
ACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTC
AAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCG
CGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCG
CGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTAC
AGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGG
ACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCG
CCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGG

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3489nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCAC
CCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACC
TTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAAC
TCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTT
CAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCC
TGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTT
CCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAAC
GACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACG
GAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTC
TTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACA
GCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGC
CTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCC
CACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAG
GATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACT
GTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGG
TTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGG
TGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCC
TCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAA
GAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCG
TTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGAT
CAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAG
CTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATC
CTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCA
CAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAAT
TCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCC
AACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGC
CGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAG
TCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGC
GGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAG
TTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGC
TTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCG
CCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGG
CCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCC
AGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGC
GCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCC
GCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCC
GAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCG
AACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAG

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3468nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCAC
CCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACC
TTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAAC
TCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTT
CAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCC
TGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTT
CCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAAC
GACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACG
GAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTC
TTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACA
GCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGC
CTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCC
CACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAG
GATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACT
GTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGG
TTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGG
TGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACAC
TTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTA
GCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGA
GGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTT
GTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCA
GTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTG
AACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCC
TCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAG
AACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGC
AAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGC
AAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACG
TCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCC
TGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTG
CTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAG
CGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAG
GGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCA
GGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGC
AGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTG
CGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAAC
ACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTAC
ACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGC
GGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTAC

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3432nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGTTTGCTCAGGTCCACGGCCAAGATGCCG
ACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGAT
GAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAG
GGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGG
CTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGT
CCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTT
GCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGC
CCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATAC
GTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTG
AGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAG
CCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCAC
GCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACA
TTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTG
GAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGC
CTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGA
GCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAGTGG
GAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGAC
AACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCA
GATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGA
TGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAA
GCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGAC
GACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATC
CGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCG
CTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAG
GAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGC
GGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAG
AAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGAC
AAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAAC
ATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATG
ATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCC
GCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCA
CCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCC
TCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCAC
GTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCG
CTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCC
CTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAG
TTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAG
AACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGG

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3411nt
ATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGTTTGCTCAGGTCCACGGCCAAGATGCCG
ACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGAT
GAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAG
GGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGG
CTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGT
CCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTT
GCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGC
CCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATAC
GTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTG
AGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAG
CCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCAC
GCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACA
TTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTG
GAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGC
CTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGA
GCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTG
CTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTAC
GAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCA
GGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTT
CTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGAT
TCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTG
GCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGG
GCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCG
GTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCC
GACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCAC
GGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGC
AGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCG
GCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAG
GGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGC
GCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACG
GCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAG
CTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGG
CGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGG
GACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGC
CCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACG
GCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCG
ACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGC

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3525nt
ATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGAC
GACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAG
CGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGAC
CTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCT
CTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGG
CTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTG
CGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATAT
TTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATG
AGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGA
TACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCT
CTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGA
GAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCC
CACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTAC
ACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCT
TTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAAC
TGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACG
GGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAG
TGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTG
GACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTG
GCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAAC
AGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAA
CAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAA
GACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGG
ATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGAC
TCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGC
AAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATG
GGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAG
AAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACA
GACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTC
AACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAG
ATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCT
GCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGC
CCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACG
GCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATC
CACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGC
TCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGG
GCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTG
GAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGC
GAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGC

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3504nt
ATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGAC
GACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAG
CGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGAC
CTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCT
CTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGG
CTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTG
CGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATAT
TTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATG
AGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGA
TACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCT
CTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGA
GAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCC
CACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTAC
ACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCT
TTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAAC
TGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACG
GGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAG
CTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTG
TACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGAC
TCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTG
GTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACG
GATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGG
CTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACA
CGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGAT
TCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGC
GCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTG
CACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAG
GGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCG
CCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATG
CAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACG
AGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCC
ACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTC
AAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCG
CGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCG
CGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTAC
AGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGG
ACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCG
CCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_4000nt
GCGCGTAGGCACAACTTCCGGAAGGAGGCGGAAGAGCTTCTCGGCTCTAGGCTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCA
CAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGG
GGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCC
ACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGA
GAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCAT
GGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAG
GCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAG
TGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCT
CAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATT
ACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCG
GAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGA
CACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGAT
CTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTG
TGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGT
GTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGA
CATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATG
CAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCAT
CGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAA
ACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCT
GGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCA
GAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCAC
ACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGT
CCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATT
CGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGC
CCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTT
TGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAA
GCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCAC
GGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGG
CAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTT
CAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAA
TGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAG
CACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGA
CGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCT
GCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGA
GCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGAC
GGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGC
GGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGG
CCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGC
GCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGT
CAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGAC
CTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCG
TGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTG
CTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTC
GAGGATTTCTTTTCCATTGTGTCGGTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTG

>In-frame_TBC1D22A_ENST00000337137_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3979nt
GCGCGTAGGCACAACTTCCGGAAGGAGGCGGAAGAGCTTCTCGGCTCTAGGCTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCA
CAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGG
GGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCC
ACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGA
GAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCAT
GGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAG
GCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAG
TGCCAGCGATGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCT
CAGCAGCTCAGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATT
ACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCG
GAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGA
CACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGAT
CTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTG
TGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGT
GTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGA
CATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATG
CAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCAT
CGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAA
ACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCT
GGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCA
GAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGG
CACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAG
GCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTT
GGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAG
AGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGA
CTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTA
CATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGT
GCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGA
GAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAA
GCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGC
CGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGAC
CACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGA
TGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCA
CCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGC
TACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGA
GCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGC
GGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGC
GCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTA
CCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGC
GCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGC
CCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCA
GCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCG
GCGGCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTG
TCGGTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAAACGTTCCTAATG

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3989nt
CAACTTCCGGAAGGAGGCGGAAGAGCTTCTCGGCTCTAGGCTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGC
CGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGC
AATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACATG
GCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCA
GCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCA
ACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAG
AGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATG
CCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAG
CGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGA
GCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCA
CTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGC
AGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATAT
GGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAG
GCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAG
GGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAG
AAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGC
AGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACT
TGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTC
CTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGA
AAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGT
CAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCA
AGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATA
TATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCT
ACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCA
TGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACC
CTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTC
TGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAG
GGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCA
AGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGC
TGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACG
GGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGT
CGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGT
ACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCA
GCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCC
GCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGC
CGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTG
CGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCC
CGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGT
GCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCG
AGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACG
GCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGG
GGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGG
AGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTT
TTCCATTGTGTCGGTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAAAC

>In-frame_TBC1D22A_ENST00000380995_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3968nt
CAACTTCCGGAAGGAGGCGGAAGAGCTTCTCGGCTCTAGGCTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGC
CGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGC
AATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACATG
GCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCA
GCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCA
ACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAG
AGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGATG
CCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTCAG
CGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTTGA
GCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCA
CTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGC
AGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATAT
GGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAG
GCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAG
GGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAG
AAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGC
AGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACT
TGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTC
CTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGA
AAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGG
AGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGG
GTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTG
TTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTC
CCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAA
GAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGG
GGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGA
CGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGG
CCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGC
AGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAA
ACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCA
AGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGC
CCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGA
GCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACG
AGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCG
CCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTC
CGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCG
GCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCG
TCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGA
ACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGC
CCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACG
GCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCC
AGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGG
CGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCGGTGTCTTT
TTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAAACGTTCCTAATGGTGCCTGAACC

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3772nt
CTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCG
CGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCAT
CCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACC
AGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCT
GGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCC
CACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAA
GTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGAC
GTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTAT
TGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGC
GTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGG
TATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTA
TGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCC
CGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTC
AGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTT
GCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGC
AGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACA
TGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAG
GGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGA
GTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGA
GGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAAT
GTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTG
CTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGAT
CCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGA
TAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCC
CTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTC
GGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGA
CAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGG
CGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAA
GTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGC
GGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCG
CGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTA
CTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGC
CGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCA
GCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGG
GGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGC
GTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTC
GCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGG
CGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGA
CGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGC
GTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCC
CTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCGGTGTCTTTTTTACATGCCCTGGTC

>In-frame_TBC1D22A_ENST00000407381_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3751nt
CTCTGGAGTCCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCG
CGGGTCTGAGGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGCAT
CCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACATGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACC
AGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCT
GGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCC
CACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAA
GTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGAC
GTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTAT
TGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGC
GTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGG
TATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTA
TGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCC
CGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTC
AGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTT
GCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGC
AGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACA
TGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAG
GGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCT
GGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCT
GGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGA
AGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTA
TGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCA
CAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCT
TATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCT
GGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAG
CAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGT
GGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGAT
GGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGA
GGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAA
GGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCG
CAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGA
GCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCG
GCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGA
GCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAG
CGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGC
GTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCG
CGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGC
GGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCG
CTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGAC
CGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGC
GGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCGGTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCC

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_3706nt
CCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGA
GGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGTTTGCTCAGGTC
CACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGC
TGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAA
CCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCC
CAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAAT
CCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAA
ACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGA
CATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCA
CCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGA
CCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAA
GCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTC
CCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGA
GATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGC
AACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAAC
AGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATAC
CATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGTCAGGGCTGGTGTA
CACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCAC
GGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCC
CATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGA
GGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGA
CCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTG
GGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACAT
GAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCA
GTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAA
GGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCT
GAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGA
GCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCAC
GCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGT
GAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCA
GTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTAC
TGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCG
CGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGC
GGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCG
CCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCC
GCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCG
CGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCT
GCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCG
GCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCG
GCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCG
GTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAAACGTTCCTAATGGTG

>In-frame_TBC1D22A_ENST00000355704_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_3685nt
CCCGGGAGCAGTGAGGGGCCACCCGGGGCACAGGAAAGGGCCGCTAGGGGAGGGCCGGGTGCACTCGGGGTGTCTGGGCCGCGGGTCTGA
GGGATGAGGAGGGGCCATGGCCAGCGACGGGGCCAGGAAGCAATTCTGGAAGCGCAGCAACAGCAAGCTCCCGGGCAGTTTGCTCAGGTC
CACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATACCAGCGATGCCTGGGACGC
TGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGCCAACCGTGTGCTGCGTAA
CCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGCAGAGCCGCCCTCACCCCC
CAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAGGAATTACGGAGGTTGAGCTGGTCCGGAAT
CCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGCCACTCTCCAGAGAAA
ACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAGGCAGATCCACATAGA
CATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCATATGGGCGATCCGCCA
CCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACATAGGCAAAAACTGGGA
CCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAA
GCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTC
CCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAGCAGTTCCCCCTGGA
GATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGACTTGATCGAGCAGGC
AACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAAC
AGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCTATAC
CATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGAGGAGGAGTGGGAGCG
GGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTC
TGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATAC
AATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCA
CTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGT
GATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAA
CGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCCGGAT
CCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGA
CTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAA
GGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCT
CGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGC
CAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGC
AGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCT
GCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGATCGG
CTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGC
CGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCAC
GCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCC
GGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCA
GGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTC
GTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACC
GGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGC
CGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTG
TGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCG
GCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCGGTGTCTTTTTTACATGCCCTG

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000382902_chr15_31862400_-_4081nt
AGAAGTCTGTGCCCTTACCCATCACAGCCTCATCCTTATCTCCTCCATTCCCTAGGGGACTTAACAGGTGTTGAAATTATTACAGAGAAA
GCTGACTCACTCACCAGGAATCTGATCCTGCTGTGGGCTGGCTTGGGTGGAGGTGTTCCTCCCGCCCCCGCACCCATCCTCCTGTTTGAA
CTCAGGCTGCTGCCTGCTGGGCCTGCCTGCCCTTGGAGCCCTGCTGAGCTCAGCCTGAGGCCTGGCTCCTCCAGGCTGGGGGAAAACCAG
GCTTGCTGTGCTCGGCAGCAGAGATTCTTCTGGAGTGAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACA
TGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATAC
CAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGC
CAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGC
AGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGA
TGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTC
AGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTT
GAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGC
CACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAG
GCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCAT
ATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACAT
AGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGA
AGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCA
AGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGA
GCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGA
CTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCT
TCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACG
GAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGA
GTCAGGGCTGGTGTACACAGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAG
CAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCA
TATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGAT
CTACCTGCCCTTGGAGGTCCCTCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTC
CATGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGA
CCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCT
TCTGCACAGCTACATGAACGTGACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGC
AGGGGAGGACGTGCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGG
CAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGAC
GCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAA
CGGGGACTCGGCCGAGCGGGGCAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCC
GTCGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAA
GTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCAC
CAGCCACCGGCACCAGTTCCACGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCG
CCGCGACGCCGCTACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGT
GCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCG
TGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCC
CCCGGCGCCAGCGCGCCAGAGCGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCC
GTGCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGT
CGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAA
CGGCTTCGGCGCCCTGCGCGACGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCC
GGGGCCGGTGCAGCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGA
GGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTC
TTTTCCATTGTGTCGGTGTCTTTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAA

>In-frame_TBC1D22A_ENST00000406733_chr22_47308084_+_OTUD7A_ENST00000307050_chr15_31862400_-_4060nt
AGAAGTCTGTGCCCTTACCCATCACAGCCTCATCCTTATCTCCTCCATTCCCTAGGGGACTTAACAGGTGTTGAAATTATTACAGAGAAA
GCTGACTCACTCACCAGGAATCTGATCCTGCTGTGGGCTGGCTTGGGTGGAGGTGTTCCTCCCGCCCCCGCACCCATCCTCCTGTTTGAA
CTCAGGCTGCTGCCTGCTGGGCCTGCCTGCCCTTGGAGCCCTGCTGAGCTCAGCCTGAGGCCTGGCTCCTCCAGGCTGGGGGAAAACCAG
GCTTGCTGTGCTCGGCAGCAGAGATTCTTCTGGAGTGAGCATCCAGCACGTGTATGGTGCCCAGCACCCCCCCTTTGATCCACTGTTACA
TGGCACTTTGCTCAGGTCCACGGCCAAGATGCCGACCACACCAGTGAAGGCCAAGAGGGTCAGCACCTTCCAGGAGTTTGAGAGCAATAC
CAGCGATGCCTGGGACGCTGGGGAGGACGACGATGAGCTCCTGGCCATGGCGGCGGAGAGCCTGAACTCCGAGGTGGTCATGGAGACGGC
CAACCGTGTGCTGCGTAACCACAGCCAGCGGCAGGGGCGGCCCACGCTGCAGGAGGGGCCAGGGCTTCAGCAGAAGCCCAGGCCCGAGGC
AGAGCCGCCCTCACCCCCCAGCGGCGACCTCCGGCTGGTGAAGTCGGTCAGTGAGAGCCACACGTCCTGTCCTGCAGAAAGTGCCAGCGA
TGCCGCCCCTCTGCAGAGGTCCCAGTCTCTCCCACACTCGGCCACCGTCACGCTGGGTGGCACATCTGACCCCAGCACTCTCAGCAGCTC
AGCGCTGAGCGAAAGAGAGGCCTCCCGGCTCGACAAGTTCAAGCAGCTGCTTGCCGGCCCCAACACGGACCTTGAGGAATTACGGAGGTT
GAGCTGGTCCGGAATCCCTAAGCCAGTGCGTCCAATGACGTGGAAGCTCCTCTCAGGTTACCTTCCCGCCAATGTAGACCGGAGACCAGC
CACTCTCCAGAGAAAACAAAAAGAATATTTTGCATTTATTGAGCACTATTACGATTCTAGGAACGACGAAGTTCACCAGGACACATACAG
GCAGATCCACATAGACATCCCTCGCATGAGCCCTGAAGCGTTGATCCTGCAGCCCAAGGTGACGGAGATTTTTGAAAGGATCTTGTTCAT
ATGGGCGATCCGCCACCCAGCCAGTGGATACGTTCAGGGTATAAATGATCTCGTCACTCCTTTCTTTGTGGTCTTCATTTGTGAATACAT
AGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCACACAGCCAATCTGCCACATGTGTTCAATGA
AGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCGGGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCA
AGAAAAGCGGCTTTCCCGGGGGATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGA
GCAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCAGGAGCTTCATCGAGCGGGA
CTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAACTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCT
TCCTCTGGCCACAACAGGGGATGGGAACTGCCTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACG
GAAAGCTCTCTATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCAGAATAAGGA
GGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACACACTTCAGCAAGAATGGCGGCACGGGCGG
GGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGGAAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGT
TGTTGTGGCAGATACAATGTTAAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCC
TCCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCATGGAACAGAGAGACCAGCA
AAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCCTCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTG
GGGGAAAGACGACAACGATAACGCCCGGCTGGCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGT
GACGTGGATCCGGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGTGCAGTCCCT
GGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGCAAGAACGGCAAGGACAAGGAGAAGGAGAA
GCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGGCCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAA
AAACATGGGCGGCCTCGGCGGCCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGG
CAAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGTCGGAAAAGACCACGCCGTC
GCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCCGCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCT
GAGCCTCAACATCCTGCGCGCCGCCATGCAGGGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCA
CGAGGAGATGATCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGCTACTGCGGC
CGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACGGAGGGCGTGCCGGTCCCGGAGCGCGCCTC
TCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGCGGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGG
CGGCACGGCCTCCCCGGGGGGAGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAG
CGTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGTGCGCCACGTACCCGCAGCA
GAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCTGCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGT
GCCCGGGGCCCTACCGGGCGCGGCGGGGACGGCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGA
CGGCCTGGAGTTCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCAGCGGCGCTG
CCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGCTACCGCGAGGAGCTGCGGCGGCGGCGCGA
GGCGCGCGGGGCCCGGCCCTGAGCGGCGCGGCGCGGCGCGGGCGGCGAGGTTCTACCTTCGAGGATTTCTTTTCCATTGTGTCGGTGTCT
TTTTTACATGCCCTGGTCCACCGGAAGGCCGGCGCCTCCTCTGTCAGTGCCGTGTACGTGTTTGGTCAAACGTTCCTAATGGTGCCTGAA


Top

FusionGenePPI for TBC1D22A_OTUD7A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TBC1D22AYWHAB, HSPA1L, ACBD3, FDXR, ACSL4, FLYWCH2, BIRC6, ARFGEF1, QSOX2, MICU1, KIRREL, MICU2, DNAJB4, SUPT6H, EFNB3, EPHA4, EXOG, METTL13, PVRL2, DNAJB5, AMBRA1, CERK, TBC1D22BOTUD7AUBC, TRAF6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TBC1D22A_OTUD7A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TBC1D22A_OTUD7A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource