FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37350

FusionGeneSummary for TBC1D19_ANAPC4

check button Fusion gene summary
Fusion gene informationFusion gene name: TBC1D19_ANAPC4
Fusion gene ID: 37350
HgeneTgene
Gene symbol

TBC1D19

ANAPC4

Gene ID

55296

29945

Gene nameTBC1 domain family member 19anaphase promoting complex subunit 4
Synonyms-APC4
Cytomap

4p15.2

4p15.2

Type of geneprotein-codingprotein-coding
DescriptionTBC1 domain family member 19anaphase-promoting complex subunit 4cyclosome subunit 4
Modification date2018051920180523
UniProtAcc

Q8N5T2

Q9UJX5

Ensembl transtripts involved in fusion geneENST00000264866, ENST00000511789, 
ENST00000515568, 
ENST00000315368, 
ENST00000510092, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 2 X 2=8
# samples 22
** MAII scorelog2(2/8*10)=1.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: TBC1D19 [Title/Abstract] AND ANAPC4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneANAPC4

GO:0070979

protein K11-linked ubiquitination

18485873


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-HD-7753-01ATBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264866ENST00000315368TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
In-frameENST00000264866ENST00000510092TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
In-frameENST00000511789ENST00000315368TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
In-frameENST00000511789ENST00000510092TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
3UTR-3CDSENST00000515568ENST00000315368TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+
3UTR-3CDSENST00000515568ENST00000510092TBC1D19chr4

26641809

+ANAPC4chr4

25381996

+

Top

FusionProtFeatures for TBC1D19_ANAPC4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TBC1D19

Q8N5T2

ANAPC4

Q9UJX5

May act as a GTPase-activating protein for Rab familyprotein(s). Component of the anaphase promoting complex/cyclosome(APC/C), a cell cycle-regulated E3 ubiquitin ligase that controlsprogression through mitosis and the G1 phase of the cell cycle.The APC/C complex acts by mediating ubiquitination and subsequentdegradation of target proteins: it mainly mediates the formationof 'Lys-11'-linked polyubiquitin chains and, to a lower extent,the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitinchains. {ECO:0000269|PubMed:18485873}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTBC1D19chr4:26641809chr4:25381996ENST00000264866+721251_472160527DomainRab-GAP TBC


Top

FusionGeneSequence for TBC1D19_ANAPC4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_926aa
MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWASLQRPEIKLESLKEDIKEFFKISGWEKKLQNAVYSELSVFPLPSHPAAPPEHLKEP
LVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLLHRLASFHRVWSFPPNEN
TGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTS
KIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYS
FLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKL
GQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYV
AMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLL
FPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRR
HTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRL
DEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAEN

>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_927aa
MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWASLQRPEIKLESLKEDIKEFFKISGWEKKLQNAVYSELSVFPLPSHPAAPPEHLKEP
LVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLLHRLASFHRVWSFPPNEN
TGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTS
KIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNLLYS
FLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKL
GQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRWLYV
AMLRMTEDHVLPELNKVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPL
LFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILR
RHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTR
LDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESEAE

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_861aa
MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAP
KDFLEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSF
YNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLS
VVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLL
LWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFIL
KANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVS
PPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNN
KTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQ
LPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESS

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_862aa
MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAP
KDFLEVLLHRLASFHRVWSFPPNENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSF
YNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLS
VVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMHLL
LWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFIL
KANELLQVIDSSMKNFKAFFRWLYVAMLRMTEDHVLPELNKVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLV
SPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWN
NKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLV
QLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_2778nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGCCAGTCTTCAGAGACCTGAGATTAAACTTGAATCACTGAAAGAAGATATTAAGGAATTCTTTAAAATATCAGGTTGGGAG
AAGAAACTTCAGAATGCTGTTTATAGTGAACTGAGTGTGTTTCCTTTACCTAGTCATCCTGCTGCACCTCCTGAACATCTTAAAGAACCT
TTGGTATACATGAGGAAAGCACAGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTG
GCACGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGA
CCTGTTTATGCACCTAAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAAT
ACAGGAAAGGAGGTGACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGT
GATGTAGAAAAACCTGAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGT
GTTCTCACATCATTTTATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCA
AAAATATTTAGTGAAGAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGA
TTTATTGAGCTTTATGCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGAT
TTGAAATCATTATCAGTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCT
TTCTTACCTGAAGTAACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGT
GAAGCATGGGAAGAAATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAG
TTCATGCACTTGCTATTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTT
GGCCAGTCTATAGAGTCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTG
AGTGAATTGAAAGGAATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTG
GGTTCTTTTATACTCAAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTG
GCAATGTTGAGAATGACAGAAGACCATGTGCTTCCCGAGCTGAATAAGATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTTACT
GAACATTTCAATGAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAAGAT
GATGATCTTGTGTCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTGCTG
TTTCCTTATTATCCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGATGTA
ATTGGAAAATCGATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTTCCT
TTTCTGTGGAATAATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGGAGA
CATACTGATATTTCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGAAGA
AGCATCTACAGTTGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGAGAT
AGACTCTTGGTCCAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGGCTA
GATGAACAGTGTAGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTTGCT
GGGAATGGTTTTCGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGGGAG
CTCGATGAGTCTTCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAGAAC

>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_2781nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGCCAGTCTTCAGAGACCTGAGATTAAACTTGAATCACTGAAAGAAGATATTAAGGAATTCTTTAAAATATCAGGTTGGGAG
AAGAAACTTCAGAATGCTGTTTATAGTGAACTGAGTGTGTTTCCTTTACCTAGTCATCCTGCTGCACCTCCTGAACATCTTAAAGAACCT
TTGGTATACATGAGGAAAGCACAGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTG
GCACGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGA
CCTGTTTATGCACCTAAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAAT
ACAGGAAAGGAGGTGACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGT
GATGTAGAAAAACCTGAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGT
GTTCTCACATCATTTTATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCA
AAAATATTTAGTGAAGAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGA
TTTATTGAGCTTTATGCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGAT
TTGAAATCATTATCAGTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCT
TTCTTACCTGAAGTAACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGT
GAAGCATGGGAAGAAATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAG
TTCATGCACTTGCTATTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTT
GGCCAGTCTATAGAGTCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTG
AGTGAATTGAAAGGAATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTG
GGTTCTTTTATACTCAAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTG
GCAATGTTGAGAATGACAGAAGACCATGTGCTTCCCGAGCTGAATAAGGTAATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTT
ACTGAACATTTCAATGAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAA
GATGATGATCTTGTGTCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTG
CTGTTTCCTTATTATCCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGAT
GTAATTGGAAAATCGATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTT
CCTTTTCTGTGGAATAATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGG
AGACATACTGATATTTCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGA
AGAAGCATCTACAGTTGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGA
GATAGACTCTTGGTCCAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGG
CTAGATGAACAGTGTAGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTT
GCTGGGAATGGTTTTCGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGG
GAGCTCGATGAGTCTTCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAG

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_2583nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTGGCACGAAAGAGGCCA
GTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGACCTGTTTATGCACCT
AAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAATACAGGAAAGGAGGTG
ACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGTGATGTAGAAAAACCT
GAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGTGTTCTCACATCATTT
TATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCAAAAATATTTAGTGAA
GAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGATTTATTGAGCTTTAT
GCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGATTTGAAATCATTATCA
GTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCTTTCTTACCTGAAGTA
ACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGTGAAGCATGGGAAGAA
ATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAGTTCATGCACTTGCTA
TTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTTGGCCAGTCTATAGAG
TCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTGAGTGAATTGAAAGGA
ATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTGGGTTCTTTTATACTC
AAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTGGCAATGTTGAGAATG
ACAGAAGACCATGTGCTTCCCGAGCTGAATAAGATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTTACTGAACATTTCAATGAG
GCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAAGATGATGATCTTGTGTCA
CCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTGCTGTTTCCTTATTATCCT
CGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGATGTAATTGGAAAATCGATG
AATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTTCCTTTTCTGTGGAATAAT
AAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGGAGACATACTGATATTTCT
CAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGAAGAAGCATCTACAGTTGT
TTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGAGATAGACTCTTGGTCCAG
CTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGGCTAGATGAACAGTGTAGT
GCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTTGCTGGGAATGGTTTTCGA
AAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGGGAGCTCGATGAGTCTTCA
GATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAGAACCAACAAGCTGGTGCT

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_2586nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTGGCACGAAAGAGGCCA
GTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGACCTGTTTATGCACCT
AAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAATACAGGAAAGGAGGTG
ACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGTGATGTAGAAAAACCT
GAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGTGTTCTCACATCATTT
TATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCAAAAATATTTAGTGAA
GAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGATTTATTGAGCTTTAT
GCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGATTTGAAATCATTATCA
GTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCTTTCTTACCTGAAGTA
ACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGTGAAGCATGGGAAGAA
ATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAGTTCATGCACTTGCTA
TTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTTGGCCAGTCTATAGAG
TCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTGAGTGAATTGAAAGGA
ATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTGGGTTCTTTTATACTC
AAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTGGCAATGTTGAGAATG
ACAGAAGACCATGTGCTTCCCGAGCTGAATAAGGTAATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTTACTGAACATTTCAAT
GAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAAGATGATGATCTTGTG
TCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTGCTGTTTCCTTATTAT
CCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGATGTAATTGGAAAATCG
ATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTTCCTTTTCTGTGGAAT
AATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGGAGACATACTGATATT
TCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGAAGAAGCATCTACAGT
TGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGAGATAGACTCTTGGTC
CAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGGCTAGATGAACAGTGT
AGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTTGCTGGGAATGGTTTT
CGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGGGAGCTCGATGAGTCT
TCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAGAACCAACAAGCTGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_3172nt
TTTCAACCATAGACAAGGCAGGAACAACGGTGTGAAAAGCGTCCTCCCCGCCCCGGTCTTTTTCCGCCGGCGGAACGCAGATGCTGTGGC
CTTCAGGCGCTGAGGGGACCAGAGAGGGACGGACACAAGGCTCGGCAGTTGCCTGGTAACGCCCGCTGGAGGAGTCCCAGTGTAATAAGG
TCCCGGAGAAGTGTCACTGGCCCTGAGTGGGACCCGGTAGCCCGTTCGCTCCGCGCCGGCGGCCTGTCCCCGCGGCTTGGCGGGCTAGGG
CAGGGGAAATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGC
TGGAACGGCAGGCCTGGGCCAGTCTTCAGAGACCTGAGATTAAACTTGAATCACTGAAAGAAGATATTAAGGAATTCTTTAAAATATCAG
GTTGGGAGAAGAAACTTCAGAATGCTGTTTATAGTGAACTGAGTGTGTTTCCTTTACCTAGTCATCCTGCTGCACCTCCTGAACATCTTA
AAGAACCTTTGGTATACATGAGGAAAGCACAGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTA
TCCCACTGGCACGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCC
TTTTCAGACCTGTTTATGCACCTAAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAA
ATGAAAATACAGGAAAGGAGGTGACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTG
TTTTGTGTGATGTAGAAAAACCTGAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAG
AAAGCAGTGTTCTCACATCATTTTATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCA
ACACCTCAAAAATATTTAGTGAAGAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAA
GCTCTGGATTTATTGAGCTTTATGCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTAT
CAAGTGATTTGAAATCATTATCAGTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGT
TGTACTCTTTCTTACCTGAAGTAACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACAT
GTATGTGTGAAGCATGGGAAGAAATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGC
AAGATGAGTTCATGCACTTGCTATTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGA
AAAAGCTTGGCCAGTCTATAGAGTCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTAT
ACCATTTGAGTGAATTGAAAGGAATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAA
CTGCTGTGGGTTCTTTTATACTCAAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGC
TTTATGTGGCAATGTTGAGAATGACAGAAGACCATGTGCTTCCCGAGCTGAATAAGATGACTCAGAAAGATATCACATTTGTTGCTGAAT
TTCTTACTGAACATTTCAATGAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAG
ATGAAGATGATGATCTTGTGTCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTC
CTTTGCTGTTTCCTTATTATCCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAG
CAGATGTAATTGGAAAATCGATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCA
AATTTCCTTTTCTGTGGAATAATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCT
TAAGGAGACATACTGATATTTCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAG
TCAGAAGAAGCATCTACAGTTGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAG
GAAGAGATAGACTCTTGGTCCAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTA
CAAGGCTAGATGAACAGTGTAGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGT
ATGTTGCTGGGAATGGTTTTCGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATG
AATGGGAGCTCGATGAGTCTTCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGG
CAGAGAACCAACAAGCTGGTGCTGCCGCTTTAGCTCCAGAGATAGTCATTAAAGTGGAAAAACTTGACCCTGAGCTAGACTCCTAATCTA
GCTTGCCATTATTGTGTGTGTAATTATGGCCAAAAGGACATAGGAGATGGACTAAGATGTCTTGGACCACCTTTGTGTAACAAAGAAATA

>In-frame_TBC1D19_ENST00000264866_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_3166nt
TTTCAACCATAGACAAGGCAGGAACAACGGTGTGAAAAGCGTCCTCCCCGCCCCGGTCTTTTTCCGCCGGCGGAACGCAGATGCTGTGGC
CTTCAGGCGCTGAGGGGACCAGAGAGGGACGGACACAAGGCTCGGCAGTTGCCTGGTAACGCCCGCTGGAGGAGTCCCAGTGTAATAAGG
TCCCGGAGAAGTGTCACTGGCCCTGAGTGGGACCCGGTAGCCCGTTCGCTCCGCGCCGGCGGCCTGTCCCCGCGGCTTGGCGGGCTAGGG
CAGGGGAAATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGC
TGGAACGGCAGGCCTGGGCCAGTCTTCAGAGACCTGAGATTAAACTTGAATCACTGAAAGAAGATATTAAGGAATTCTTTAAAATATCAG
GTTGGGAGAAGAAACTTCAGAATGCTGTTTATAGTGAACTGAGTGTGTTTCCTTTACCTAGTCATCCTGCTGCACCTCCTGAACATCTTA
AAGAACCTTTGGTATACATGAGGAAAGCACAGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTA
TCCCACTGGCACGAAAGAGGCCAGTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCC
TTTTCAGACCTGTTTATGCACCTAAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAA
ATGAAAATACAGGAAAGGAGGTGACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTG
TTTTGTGTGATGTAGAAAAACCTGAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAG
AAAGCAGTGTTCTCACATCATTTTATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCA
ACACCTCAAAAATATTTAGTGAAGAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAA
GCTCTGGATTTATTGAGCTTTATGCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTAT
CAAGTGATTTGAAATCATTATCAGTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGT
TGTACTCTTTCTTACCTGAAGTAACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACAT
GTATGTGTGAAGCATGGGAAGAAATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGC
AAGATGAGTTCATGCACTTGCTATTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGA
AAAAGCTTGGCCAGTCTATAGAGTCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTAT
ACCATTTGAGTGAATTGAAAGGAATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAA
CTGCTGTGGGTTCTTTTATACTCAAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGC
TTTATGTGGCAATGTTGAGAATGACAGAAGACCATGTGCTTCCCGAGCTGAATAAGGTAATGACTCAGAAAGATATCACATTTGTTGCTG
AATTTCTTACTGAACATTTCAATGAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGA
AAGATGAAGATGATGATCTTGTGTCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAA
GTCCTTTGCTGTTTCCTTATTATCCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGC
CAGCAGATGTAATTGGAAAATCGATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGT
TCAAATTTCCTTTTCTGTGGAATAATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCA
TCTTAAGGAGACATACTGATATTTCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAA
AAGTCAGAAGAAGCATCTACAGTTGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTG
AAGGAAGAGATAGACTCTTGGTCCAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATT
CTACAAGGCTAGATGAACAGTGTAGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCAC
AGTATGTTGCTGGGAATGGTTTTCGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATG
ATGAATGGGAGCTCGATGAGTCTTCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAG
AGGCAGAGAACCAACAAGCTGGTGCTGCCGCTTTAGCTCCAGAGATAGTCATTAAAGTGGAAAAACTTGACCCTGAGCTAGACTCCTAAT
CTAGCTTGCCATTATTGTGTGTGTAATTATGGCCAAAAGGACATAGGAGATGGACTAAGATGTCTTGGACCACCTTTGTGTAACAAAGAA

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000315368_chr4_25381996_+_2699nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTGGCACGAAAGAGGCCA
GTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGACCTGTTTATGCACCT
AAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAATACAGGAAAGGAGGTG
ACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGTGATGTAGAAAAACCT
GAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGTGTTCTCACATCATTT
TATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCAAAAATATTTAGTGAA
GAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGATTTATTGAGCTTTAT
GCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGATTTGAAATCATTATCA
GTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCTTTCTTACCTGAAGTA
ACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGTGAAGCATGGGAAGAA
ATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAGTTCATGCACTTGCTA
TTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTTGGCCAGTCTATAGAG
TCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTGAGTGAATTGAAAGGA
ATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTGGGTTCTTTTATACTC
AAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTGGCAATGTTGAGAATG
ACAGAAGACCATGTGCTTCCCGAGCTGAATAAGATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTTACTGAACATTTCAATGAG
GCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAAGATGATGATCTTGTGTCA
CCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTGCTGTTTCCTTATTATCCT
CGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGATGTAATTGGAAAATCGATG
AATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTTCCTTTTCTGTGGAATAAT
AAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGGAGACATACTGATATTTCT
CAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGAAGAAGCATCTACAGTTGT
TTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGAGATAGACTCTTGGTCCAG
CTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGGCTAGATGAACAGTGTAGT
GCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTTGCTGGGAATGGTTTTCGA
AAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGGGAGCTCGATGAGTCTTCA
GATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAGAACCAACAAGCTGGTGCT
GCCGCTTTAGCTCCAGAGATAGTCATTAAAGTGGAAAAACTTGACCCTGAGCTAGACTCCTAATCTAGCTTGCCATTATTGTGTGTGTAA

>In-frame_TBC1D19_ENST00000511789_chr4_26641809_+_ANAPC4_ENST00000510092_chr4_25381996_+_2693nt
ATGTTGCAGGAGGAGTCGGACCTCTCTCTCATTATTGCCCAGATAGTCCAAAAGCTCAAGGGCTCCAATTTGTACTCTCAGCTGGAACGG
CAGGCCTGGGGAAGTTGGGAAAAAAGAATTTTGAAGAGTTTAAATAGTATGTGCACTGAACTGAGTATCCCACTGGCACGAAAGAGGCCA
GTTGGAGAACAGAAAGAACTTCTTAATAAATGGAATGAAATGGGAACTGATGAACCAGATTTAAGCCTTTTCAGACCTGTTTATGCACCT
AAGGATTTTCTTGAGGTTTTACTTCATCGACTGGCAAGTTTTCATCGAGTTTGGAGTTTTCCACCAAATGAAAATACAGGAAAGGAGGTG
ACGTGTCTGGCATGGAGACCAGATGGCAAACTTTTGGCCTTTGCTCTTGCTGATACCAAGAAAATTGTTTTGTGTGATGTAGAAAAACCT
GAGAGCTTACACTCTTTTTCTGTGGAGGCTCCAGTTTCCTGTATGCATTGGATGGAAGTGACAGTAGAAAGCAGTGTTCTCACATCATTT
TATAATGCTGAGGATGAATCAAATCTTCTCTTACCTAAACTACCTACACTGCCAAAAAACTATAGCAACACCTCAAAAATATTTAGTGAA
GAAAATTCTGATGAAATTATTAAGCTCTTGGGAGACGTCAGGCTTAATATTCTCGTCCTTGGAGGAAGCTCTGGATTTATTGAGCTTTAT
GCTTATGGAATGTTTAAAATTGCTCGAGTCACAGGGATTGCTGGTACTTGTCTTGCATTATGTTTATCAAGTGATTTGAAATCATTATCA
GTGGTCACAGAAGTCTCTACCAATGGTGCTTCAGAAGTTTCATACTTTCAGCTTGAAACTAATCTGTTGTACTCTTTCTTACCTGAAGTA
ACTCGGATGGCCAGAAAGTTTACTCATATTTCAGCTCTGTTACAGTATATAAATTTGTCACTAACATGTATGTGTGAAGCATGGGAAGAA
ATACTAATGCAGATGGATTCTCGTCTCACCAAGTTTGTGCAGGAAAAGAACACAACCACATCAGTGCAAGATGAGTTCATGCACTTGCTA
TTATGGGGGAAAGCAAGTGCTGAACTTCAGACTCTCTTGATGAATCAGTTAACAGTAAAGGGCTTGAAAAAGCTTGGCCAGTCTATAGAG
TCATCATACTCCAGTATACAAAAATTGGTCATAAGTCATTTACAGAGTGGCTCGGAGTCTTTATTATACCATTTGAGTGAATTGAAAGGA
ATGGCTTCATGGAAGCAAAAATATGAACCTCTTGGACTAGATGCTGCAGGAATCGAAGAAGCTATAACTGCTGTGGGTTCTTTTATACTC
AAGGCAAATGAACTTCTTCAAGTTATAGATAGTAGTATGAAAAACTTCAAAGCATTTTTTCGGTGGCTTTATGTGGCAATGTTGAGAATG
ACAGAAGACCATGTGCTTCCCGAGCTGAATAAGGTAATGACTCAGAAAGATATCACATTTGTTGCTGAATTTCTTACTGAACATTTCAAT
GAGGCTCCAGACCTTTATAATCGAAAAGGAAAATACTTTAACGTTGAAAGAGTTGGTCAGTACTTGAAAGATGAAGATGATGATCTTGTG
TCACCCCCTAACACAGAAGGAAACCAGTGGTATGACTTTCTTCAAAATAGCAGCCACCTTAAAGAAAGTCCTTTGCTGTTTCCTTATTAT
CCTCGAAAATCATTGCATTTTGTGAAAAGGCGGATGGAGAATATTATTGATCAGTGTTTGCAAAAGCCAGCAGATGTAATTGGAAAATCG
ATGAATCAAGCAATCTGTATTCCATTGTATAGAGATACCAGAAGTGAGGATTCTACACGTAGATTGTTCAAATTTCCTTTTCTGTGGAAT
AATAAAACTTCAAATCTACATTATCTTCTTTTTACTATTCTAGAAGATTCACTTTATAAAATGTGCATCTTAAGGAGACATACTGATATT
TCTCAATCTGTGAGTAATGGACTAATTGCTATTAAATTTGGGAGCTTTACATATGCCACAACAGAAAAAGTCAGAAGAAGCATCTACAGT
TGTTTAGATGCACAGTTTTATGATGATGAAACTGTAACAGTAGTTCTTAAAGACACTGTAGGACGTGAAGGAAGAGATAGACTCTTGGTC
CAGCTGCCTTTGTCTTTAGTATATAACAGTGAAGATTCTGCAGAATATCAGTTCACTGGGACTTATTCTACAAGGCTAGATGAACAGTGT
AGTGCTATTCCCACCCGTACCATGCATTTTGAGAAGCACTGGAGATTACTGGAAAGTATGAAAGCACAGTATGTTGCTGGGAATGGTTTT
CGAAAAGTGTCCTGTGTGTTAAGCTCAAATCTTCGTCATGTGAGAGTATTTGAAATGGACATAGATGATGAATGGGAGCTCGATGAGTCT
TCAGATGAAGAGGAGGAGGCCAGTAATAAGCCTGTAAAAATAAAGGAAGAAGTGTTGTCGGAGTCAGAGGCAGAGAACCAACAAGCTGGT
GCTGCCGCTTTAGCTCCAGAGATAGTCATTAAAGTGGAAAAACTTGACCCTGAGCTAGACTCCTAATCTAGCTTGCCATTATTGTGTGTG


Top

FusionGenePPI for TBC1D19_ANAPC4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TBC1D19PPP1CC, MAGEA12, TTLL1, CEP135, LRRC49, NICN1ANAPC4CDC27, ANAPC1, ANAPC15, CDC16, ANAPC7, ANAPC11, BUB1B, RAD21, CDC20, BUB3, MAD2L1, SH3KBP1, CCNB1, ANAPC4, CCNA2, COPS2, FBXO5, ANAPC5, CDC23, ANAPC2, ANAPC10, ANAPC13, MDC1, PAXIP1, TP53BP1, TRIM33, PTEN, SOX2, PHF8, HECW2, ANAPC16, CDC26, FZR1, DCPS, UBE2S, NEK2, KIF18A, PENK, MAGIX, RRM2, TTLL1, KRAS, XPO1, CFAP97, CDK1, USP37, NANOG, POU5F1, PSMD8, C16orf87, ANO6, GPR156, NUP98, HOXD13, LNP1, HHEX


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TBC1D19_ANAPC4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TBC1D19_ANAPC4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource